F462199

General Info

Members Datasets Scaffolds Average Seq Length
548 332 542 144

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100890552|Ga0070706_1008905521
Length 164
Sequence MKFTDSVDLILKQKPGNVWSISPEQSVYEAIQEMAEKQVGALLVIKERALVGIISERDYARKVILMGRSSKNTQVNEIMTSPVVYVTLTNTLDECMALMTEHRIRHLPVMQGQKGQEVVGILSVGDLVKWIISAQEATIRHLEHYITGTPSELVTAHRGPGSGE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
6 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
7 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
8 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
193 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
211 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
212 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
220 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
221 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
222 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
223 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
224 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
225 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
226 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
229 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
312 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.59
Metatranscriptomes 11.31
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.47
Nodule 0.18
Rhizoplane 2.92
Rhizosphere 91.06
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_975409 2162886007 Unclassified 2605
2 MRS1b_contig_8124326 2162886011 Unclassified 2337
3 JGI24749J21850_1051909 3300002076 Unclassified 613
4 JGI25405J52794_10048972 3300003911 Bacteria 903
5 Ga0058863_11560427 3300004799 Bacteria 807
6 Ga0058863_11906289 3300004799 Bacteria 822
7 Ga0058861_10005562 3300004800 Unclassified 851
8 Ga0058861_10019033 3300004800 Bacteria 1119
9 Ga0058861_11584140 3300004800 Unclassified 595
10 Ga0058861_12059346 3300004800 Unclassified 635
11 Ga0058860_11534087 3300004801 Unclassified 529
12 Ga0058862_10006799 3300004803 Unclassified 565
13 Ga0058862_10013143 3300004803 Bacteria 754
14 Ga0058862_10086714 3300004803 Bacteria 788
15 Ga0058862_12368229 3300004803 Unclassified 688
16 Ga0065712_10000676 3300005290 Bacteria 20109
17 Ga0065715_10002561 3300005293 Bacteria 4669
18 Ga0065707_10083877 3300005295 Bacteria 8060
19 Ga0065707_10157251 3300005295 Bacteria 1597
20 Ga0065707_10834947 3300005295 Bacteria 587
21 Ga0070658_10630277 3300005327 Bacteria 930
22 Ga0070658_11004615 3300005327 Unclassified 726
23 Ga0070676_10010484 3300005328 Bacteria 5030
24 Ga0070676_10317201 3300005328 Bacteria 1062
25 Ga0070683_100240127 3300005329 Bacteria 1723
26 Ga0070690_100437048 3300005330 Unclassified 968
27 Ga0070670_100004678 3300005331 Bacteria 11478
28 Ga0070670_100199823 3300005331 Bacteria 1737
29 Ga0070670_101179778 3300005331 Unclassified 699
30 Ga0070677_10293776 3300005333 Unclassified 823
31 Ga0068869_100970778 3300005334 Unclassified 738
32 Ga0070680_100068243 3300005336 Unclassified 2918
33 Ga0070680_100224295 3300005336 Bacteria 1586
34 Ga0070680_101574566 3300005336 Bacteria 569
35 Ga0070682_101714201 3300005337 Unclassified 546
36 Ga0068868_100812565 3300005338 Bacteria 844
37 Ga0068868_100983754 3300005338 Unclassified 771
38 Ga0070691_10071163 3300005341 Bacteria 1688
39 Ga0070661_100575211 3300005344 Bacteria 909
40 Ga0070692_10157251 3300005345 Bacteria 1299
41 Ga0070668_100063770 3300005347 Bacteria 2856
42 Ga0070668_100097381 3300005347 Bacteria 2326
43 Ga0070668_100106265 3300005347 Bacteria 2230
44 Ga0070668_100432869 3300005347 Bacteria 1128
45 Ga0070669_100030601 3300005353 Bacteria 3885
46 Ga0070669_100207557 3300005353 Bacteria 1544
47 Ga0070675_100024043 3300005354 Bacteria 4877
48 Ga0070671_100697594 3300005355 Unclassified 880
49 Ga0070674_100059987 3300005356 Bacteria 2650
50 Ga0070673_100113317 3300005364 Unclassified 2252
51 Ga0070673_100595282 3300005364 Bacteria 1008
52 Ga0070688_100000341 3300005365 Bacteria 23817
53 Ga0070659_100092857 3300005366 Bacteria 2421
54 Ga0070667_100069926 3300005367 Bacteria 2987
55 Ga0070709_10867111 3300005434 Bacteria 712
56 Ga0070714_100907904 3300005435 Unclassified 855
57 Ga0070713_100009620 3300005436 Bacteria 6937
58 Ga0070713_100094102 3300005436 Bacteria 2582
59 Ga0070713_100831828 3300005436 Bacteria 886
60 Ga0070701_10224366 3300005438 Bacteria 1122
61 Ga0070701_11020721 3300005438 Bacteria 578
62 Ga0070711_100292340 3300005439 Unclassified 1293
63 Ga0070694_100034090 3300005444 Bacteria 3355
64 Ga0070663_100021366 3300005455 Bacteria 4304
65 Ga0070663_100428518 3300005455 Bacteria 1086
66 Ga0070678_100227194 3300005456 Bacteria 1554
67 Ga0070678_100532010 3300005456 Bacteria 1041
68 Ga0070678_100618041 3300005456 Bacteria 969
69 Ga0070662_100010273 3300005457 Bacteria 6137
70 Ga0070662_100014291 3300005457 Bacteria 5301
71 Ga0070662_100208496 3300005457 Bacteria 1554
72 Ga0070681_10926054 3300005458 Bacteria 790
73 Ga0068867_100010417 3300005459 Bacteria 6561
74 Ga0070685_10369240 3300005466 Unclassified 985
75 Ga0070706_100532570 3300005467 Unclassified 1093
76 Ga0070706_100890552 3300005467 Bacteria 822
77 Ga0070698_100368703 3300005471 Unclassified 1368
78 Ga0070679_100276021 3300005530 Bacteria 1634
79 Ga0070679_101344822 3300005530 Unclassified 660
80 Ga0070697_100635832 3300005536 Bacteria 939
81 Ga0068853_100000762 3300005539 Bacteria 22338
82 Ga0068853_100000975 3300005539 Bacteria 20135
83 Ga0068853_100123692 3300005539 Bacteria 2310
84 Ga0068853_100343267 3300005539 Unclassified 1388
85 Ga0070672_100000775 3300005543 Bacteria 19031
86 Ga0070672_100451828 3300005543 Unclassified 1107
87 Ga0070686_100431732 3300005544 Unclassified 1009
88 Ga0070693_100722774 3300005547 Unclassified 731
89 Ga0070665_100004227 3300005548 Bacteria 15114
90 Ga0070665_100050891 3300005548 Bacteria 4157
91 Ga0070704_100107970 3300005549 Bacteria 2112
92 Ga0070704_100492752 3300005549 Unclassified 1062
93 Ga0068855_100006801 3300005563 Bacteria 13871
94 Ga0068855_100096416 3300005563 Bacteria 3407
95 Ga0068855_100742650 3300005563 Bacteria 1047
96 Ga0068857_101556843 3300005577 Bacteria 645
97 Ga0068857_102239616 3300005577 Unclassified 536
98 Ga0068856_100039388 3300005614 Bacteria 4640
99 Ga0070702_100256889 3300005615 Unclassified 1187
100 Ga0068852_100708746 3300005616 Bacteria 1017
101 Ga0068864_100003339 3300005618 Bacteria 13267
102 Ga0068866_10010001 3300005718 Bacteria 4051
103 Ga0068866_10030257 3300005718 Bacteria 2597
104 Ga0068861_100000924 3300005719 Bacteria 17839
105 Ga0068861_100370490 3300005719 Unclassified 1262
106 Ga0068861_100496088 3300005719 Bacteria 1103
107 Ga0068851_10194597 3300005834 Bacteria 1129
108 Ga0068870_10272159 3300005840 Unclassified 1058
109 Ga0068863_100018888 3300005841 Bacteria 6596
110 Ga0068863_100120870 3300005841 Bacteria 2497
111 Ga0068862_100011962 3300005844 Bacteria 7167
112 Ga0068862_100021863 3300005844 Bacteria 5349
113 Ga0081455_10006436 3300005937 Bacteria 12590
114 Ga0081540_1040780 3300005983 Bacteria 2415
115 Ga0070717_10265681 3300006028 Unclassified 1519
116 Ga0070717_10670210 3300006028 Unclassified 942
117 Ga0070716_100017128 3300006173 Bacteria 3752
118 Ga0070716_100035731 3300006173 Bacteria 2734
119 Ga0070712_100004652 3300006175 Bacteria 8486
120 Ga0070712_100537675 3300006175 Unclassified 983
121 Ga0097621_100361887 3300006237 Bacteria 1292
122 Ga0068871_100636493 3300006358 Unclassified 973
123 Ga0068871_101269525 3300006358 Bacteria 692
124 Ga0075428_100006966 3300006844 Bacteria 12541
125 Ga0075428_100028202 3300006844 Bacteria 6209
126 Ga0075428_100293264 3300006844 Bacteria 1749
127 Ga0075430_100097518 3300006846 Bacteria 2456
128 Ga0075430_100440814 3300006846 Bacteria 1075
129 Ga0075431_100031192 3300006847 Bacteria 5490
130 Ga0075431_100106629 3300006847 Bacteria 2891
131 Ga0075431_100528486 3300006847 Bacteria 1168
132 Ga0075431_101731254 3300006847 Unclassified 582
133 Ga0075434_100307384 3300006871 Bacteria 1606
134 Ga0075429_100056506 3300006880 Bacteria 3416
135 Ga0075429_100062203 3300006880 Bacteria 3252
136 Ga0075429_100281391 3300006880 Bacteria 1457
137 Ga0099826_10119588 3300006948 Bacteria 1554
138 Ga0111539_10016185 3300009094 Bacteria 9252
139 Ga0111539_10020676 3300009094 Bacteria 8107
140 Ga0111539_10822873 3300009094 Bacteria 1080
141 Ga0105247_10089674 3300009101 Bacteria 1950
142 Ga0114129_10103116 3300009147 Bacteria 3944
143 Ga0114129_10995028 3300009147 Unclassified 1056
144 Ga0105243_10193043 3300009148 Bacteria 1780
145 Ga0105241_10489399 3300009174 Bacteria 1095
146 Ga0105241_11327529 3300009174 Bacteria 686
147 Ga0105242_10184493 3300009176 Bacteria 1843
148 Ga0105242_10184628 3300009176 Bacteria 1842
149 Ga0105242_10526519 3300009176 Unclassified 1129
150 Ga0105248_10702498 3300009177 Unclassified 1141
151 Ga0105249_10026809 3300009553 Bacteria 5197
152 Ga0105249_10070843 3300009553 Bacteria 3219
153 Ga0105239_10225453 3300010375 Bacteria 2102
154 Ga0105239_10559662 3300010375 Bacteria 1302
155 Ga0105246_10356906 3300011119 Unclassified 1200
156 Ga0157373_10552153 3300013100 Bacteria 835
157 Ga0157369_11688253 3300013105 Unclassified 644
158 Ga0157374_11178779 3300013296 Unclassified 787
159 Ga0157378_10778675 3300013297 Unclassified 981
160 Ga0163162_10298910 3300013306 Bacteria 1742
161 Ga0163162_11537856 3300013306 Bacteria 758
162 Ga0163162_12186199 3300013306 Unclassified 635
163 Ga0157372_10597414 3300013307 Bacteria 1286
164 Ga0157375_10048802 3300013308 Bacteria 4143
165 Ga0157375_10375905 3300013308 Unclassified 1587
166 Ga0157375_10532936 3300013308 Bacteria 1337
167 Ga0163163_10083888 3300014325 Bacteria 3192
168 Ga0163163_10362858 3300014325 Bacteria 1505
169 Ga0163163_12109898 3300014325 Bacteria 623
170 Ga0157380_10004477 3300014326 Bacteria 9682
171 Ga0157380_10021556 3300014326 Bacteria 4834
172 Ga0157380_11909195 3300014326 Bacteria 654
173 Ga0182007_10143692 3300015262 Unclassified 808
174 Ga0163161_10436326 3300017792 Bacteria 1056
175 Ga0197907_10309475 3300020069 Bacteria 631
176 Ga0197907_10481651 3300020069 Bacteria 1002
177 Ga0197907_11305640 3300020069 Unclassified 922
178 Ga0197907_11314326 3300020069 Viruses 887
179 Ga0206356_10394661 3300020070 Unclassified 868
180 Ga0206356_10506610 3300020070 Bacteria 684
181 Ga0206356_10675169 3300020070 Bacteria 765
182 Ga0206356_11895739 3300020070 Viruses 904
183 Ga0206349_1894552 3300020075 Bacteria 643
184 Ga0206349_1954048 3300020075 Unclassified 1346
185 Ga0206355_1475349 3300020076 Unclassified 804
186 Ga0206355_1678219 3300020076 Bacteria 946
187 Ga0206351_10459302 3300020077 Bacteria 1049
188 Ga0206351_10483349 3300020077 Unclassified 841
189 Ga0206351_10672749 3300020077 Unclassified 973
190 Ga0206352_10226561 3300020078 Unclassified 777
191 Ga0206352_10909166 3300020078 Bacteria 2287
192 Ga0206350_10195778 3300020080 Unclassified 1213
193 Ga0206350_10421805 3300020080 Viruses 1115
194 Ga0206350_10458104 3300020080 Unclassified 727
195 Ga0206353_10550515 3300020082 Bacteria 673
196 Ga0206353_11078394 3300020082 Unclassified 910
197 Ga0206353_11677454 3300020082 Unclassified 734
198 Ga0154015_1459979 3300020610 Unclassified 854
199 Ga0224712_10061048 3300022467 Viruses 1502
200 Ga0224712_10103935 3300022467 Bacteria 1209
201 Ga0224712_10265370 3300022467 Unclassified 796
202 Ga0209051_1018121 3300025303 Bacteria 3124
203 Ga0207642_10353122 3300025899 Bacteria 868
204 Ga0207699_10208510 3300025906 Unclassified 1328
205 Ga0207645_10000790 3300025907 Bacteria 26451
206 Ga0207643_10235253 3300025908 Unclassified 1125
207 Ga0207684_10406901 3300025910 Unclassified 1170
208 Ga0207654_10415312 3300025911 Bacteria 938
209 Ga0207671_10184654 3300025914 Bacteria 1624
210 Ga0207693_10110348 3300025915 Unclassified 2157
211 Ga0207663_10059060 3300025916 Unclassified 2424
212 Ga0207663_10857977 3300025916 Unclassified 725
213 Ga0207660_10175300 3300025917 Bacteria 1662
214 Ga0207662_10040975 3300025918 Bacteria 2725
215 Ga0207657_10689408 3300025919 Bacteria 794
216 Ga0207649_10711473 3300025920 Bacteria 779
217 Ga0207652_10123016 3300025921 Bacteria 2310
218 Ga0207652_11286815 3300025921 Bacteria 634
219 Ga0207681_10029737 3300025923 Bacteria 3553
220 Ga0207650_10034198 3300025925 Bacteria 3685
221 Ga0207650_10080575 3300025925 Bacteria 2468
222 Ga0207659_10384229 3300025926 Unclassified 1171
223 Ga0207700_10025152 3300025928 Bacteria 4131
224 Ga0207700_10065230 3300025928 Unclassified 2777
225 Ga0207690_10023046 3300025932 Bacteria 3882
226 Ga0207706_10000586 3300025933 Bacteria 38762
227 Ga0207706_10004219 3300025933 Bacteria 13535
228 Ga0207706_10093108 3300025933 Bacteria 2650
229 Ga0207686_10248278 3300025934 Bacteria 1299
230 Ga0207704_10129624 3300025938 Bacteria 1744
231 Ga0207704_10728054 3300025938 Bacteria 823
232 Ga0207665_10030972 3300025939 Bacteria 3539
233 Ga0207691_10000872 3300025940 Bacteria 30019
234 Ga0207691_10235538 3300025940 Unclassified 1584
235 Ga0207711_10558283 3300025941 Unclassified 1068
236 Ga0207689_10237986 3300025942 Bacteria 1505
237 Ga0207679_11353717 3300025945 Bacteria 653
238 Ga0207667_10028581 3300025949 Bacteria 6055
239 Ga0207667_10246160 3300025949 Bacteria 1829
240 Ga0207667_10306046 3300025949 Bacteria 1624
241 Ga0207712_10458037 3300025961 Unclassified 1083
242 Ga0207668_10030913 3300025972 Bacteria 3523
243 Ga0207668_10053567 3300025972 Bacteria 2797
244 Ga0207668_10294405 3300025972 Bacteria 1337
245 Ga0207668_11066804 3300025972 Bacteria 723
246 Ga0207640_10071376 3300025981 Bacteria 2339
247 Ga0207640_11232687 3300025981 Bacteria 666
248 Ga0207658_10064384 3300025986 Bacteria 2750
249 Ga0207658_10128208 3300025986 Bacteria 2034
250 Ga0207658_10483776 3300025986 Unclassified 1100
251 Ga0207639_10000657 3300026041 Bacteria 23785
252 Ga0207639_10003833 3300026041 Bacteria 10134
253 Ga0207639_10256944 3300026041 Bacteria 1526
254 Ga0207678_10042014 3300026067 Bacteria 3963
255 Ga0207708_10041283 3300026075 Bacteria 3517
256 Ga0207708_10187929 3300026075 Bacteria 1643
257 Ga0207708_10198820 3300026075 Bacteria 1598
258 Ga0207702_10058560 3300026078 Bacteria 3278
259 Ga0207641_10140102 3300026088 Bacteria 2181
260 Ga0207648_10000544 3300026089 Bacteria 42055
261 Ga0207648_10086707 3300026089 Unclassified 2732
262 Ga0207676_10030598 3300026095 Bacteria 4042
263 Ga0207674_10196433 3300026116 Bacteria 1967
264 Ga0207674_11443649 3300026116 Bacteria 657
265 Ga0207675_100001615 3300026118 Bacteria 22586
266 Ga0207675_100005250 3300026118 Bacteria 12468
267 Ga0207675_100030331 3300026118 Bacteria 5036
268 Ga0207675_100158259 3300026118 Unclassified 2159
269 Ga0207675_100539425 3300026118 Bacteria 1165
270 Ga0207683_10269776 3300026121 Bacteria 1554
271 Ga0207683_10406873 3300026121 Bacteria 1252
272 Ga0207698_10196466 3300026142 Bacteria 1803
273 Ga0207698_11160280 3300026142 Bacteria 786
274 Ga0209967_1004350 3300027364 Bacteria 1880
275 Ga0209968_1014555 3300027526 Bacteria 1239
276 Ga0209999_1003307 3300027543 Bacteria 2876
277 Ga0209970_1005977 3300027614 Bacteria 1997
278 Ga0210002_1017166 3300027617 Bacteria 1150
279 Ga0209971_1000749 3300027682 Bacteria 8370
280 Ga0209966_1003407 3300027695 Bacteria 2673
281 Ga0209998_10004905 3300027717 Bacteria 2816
282 Ga0209974_10000879 3300027876 Bacteria 10426
283 Ga0207428_10365186 3300027907 Bacteria 1061
284 Ga0207428_10590103 3300027907 Bacteria 801
285 Ga0268266_10024952 3300028379 Bacteria 5087
286 Ga0268266_10084991 3300028379 Bacteria 2764
287 Ga0268265_10008849 3300028380 Bacteria 6804
288 Ga0268265_10018036 3300028380 Bacteria 4886
289 Ga0265334_10001494 3300028573 Bacteria 11284
290 Ga0265318_10006068 3300028577 Bacteria 5599
291 Ga0265338_10007423 3300028800 Bacteria 13605
292 Ga0265338_10056298 3300028800 Bacteria 3488
293 Ga0265324_10013594 3300029957 Bacteria 3031
294 Ga0265330_10006083 3300031235 Bacteria 5979
295 Ga0265332_10017482 3300031238 Bacteria 3165
296 Ga0265328_10000585 3300031239 Bacteria 16880
297 Ga0265328_10047118 3300031239 Bacteria 1584
298 Ga0265320_10041365 3300031240 Bacteria 2291
299 Ga0265325_10003461 3300031241 Bacteria 10299
300 Ga0265329_10025194 3300031242 Bacteria 1970
301 Ga0265340_10037163 3300031247 Bacteria 2413
302 Ga0265339_10019067 3300031249 Bacteria 4032
303 Ga0265339_10131736 3300031249 Bacteria 1278
304 Ga0265331_10000065 3300031250 Bacteria 164724
305 Ga0265331_10002811 3300031250 Bacteria 11539
306 Ga0265331_10046620 3300031250 Bacteria 2088
307 Ga0265327_10000123 3300031251 Bacteria 169532
308 Ga0265327_10022091 3300031251 Bacteria 3818
309 Ga0265316_10026444 3300031344 Bacteria 4826
310 Ga0265316_10039529 3300031344 Bacteria 3788
311 Ga0265316_10291822 3300031344 Bacteria 1190
312 Ga0307509_10179837 3300031507 Bacteria 1982
313 Ga0307408_100072024 3300031548 Bacteria 2557
314 Ga0265313_10011808 3300031595 Bacteria 5400
315 Ga0316575_10002443 3300031665 Bacteria 6236
316 Ga0316579_10068379 3300031691 Bacteria 1680
317 Ga0316579_10277867 3300031691 Bacteria 810
318 Ga0265314_10007342 3300031711 Bacteria 9567
319 Ga0265342_10055546 3300031712 Bacteria 2350
320 Ga0316576_10245211 3300031727 Bacteria 1345
321 Ga0316576_10468625 3300031727 Unclassified 929
322 Ga0316578_10052983 3300031728 Bacteria 2377
323 Ga0307405_11085284 3300031731 Bacteria 687
324 Ga0307405_11424633 3300031731 Bacteria 607
325 Ga0316577_10057893 3300031733 Bacteria 2163
326 Ga0307413_10026221 3300031824 Bacteria 3209
327 Ga0307413_10172904 3300031824 Bacteria 1531
328 Ga0307410_10153496 3300031852 Bacteria 1717
329 Ga0307410_10976166 3300031852 Bacteria 729
330 Ga0307406_10059362 3300031901 Bacteria 2462
331 Ga0307407_10968748 3300031903 Bacteria 656
332 Ga0307412_10584315 3300031911 Bacteria 943
333 Ga0307412_10705395 3300031911 Bacteria 866
334 Ga0307409_100215727 3300031995 Bacteria 1728
335 Ga0307416_100120789 3300032002 Bacteria 2334
336 Ga0307416_100293929 3300032002 Bacteria 1610
337 Ga0307416_100465755 3300032002 Bacteria 1320
338 Ga0307416_100980025 3300032002 Bacteria 948
339 Ga0307414_11684778 3300032004 Bacteria 591
340 Ga0307411_10056689 3300032005 Bacteria 2584
341 Ga0307411_11130923 3300032005 Bacteria 707
342 Ga0307415_100070741 3300032126 Bacteria 2451
343 Ga0307415_100142688 3300032126 Bacteria 1832
344 Ga0316583_10295778 3300032133 Bacteria 560
345 Ga0316585_10028006 3300032137 Bacteria 1761
346 Ga0316580_10011023 3300032139 Bacteria 2739
347 Ga0373946_0045631 3300035171 Bacteria 1814
348 Ga0316574_0000470 3300035398 Bacteria 16292
349 Ga0316574_0165276 3300035398 Bacteria 1425
350 Ga0373947_0051879 3300035725 Unclassified 2469
351 Ga0316582_0001306 3300036647 Bacteria 10788
352 Ga0316582_0065153 3300036647 Unclassified 2345
353 Ga0316582_0854790 3300036647 Unclassified 623
354 Ga0316584_0006760 3300036712 Bacteria 7780
355 Ga0316584_0387305 3300036712 Bacteria 998
356 Ga0373925_0021595 3300037068 Unclassified 4692
357 Ga0400490_60992 3300038726 Plasmid 3472
358 Ga0400488_55436 3300038741 Bacteria 1834
359 Ga0451807_1641010 3300041486 Bacteria 1325
360 Ga0451833_1240965 3300041491 Bacteria 570
361 Ga0451835_0658749 3300041492 Bacteria 573
362 Ga0451841_0183847 3300041498 Bacteria 884
363 Ga0451847_0549916 3300041503 Bacteria 986
364 Ga0451851_0917330 3300041507 Bacteria 944
365 Ga0451853_1060211 3300041512 Bacteria 1911
366 Ga0451853_1956397 3300041512 Bacteria 740
367 Ga0450923_000521 3300042125 Bacteria 4298
368 Ga0450896_005791 3300042133 Bacteria 1690
369 Ga0439460_0019273 3300042461 Bacteria 1846
370 Ga0450893_0009053 3300042532 Bacteria 1626
371 Ga0451577_0002503 3300042876 Bacteria 21799
372 Ga0451577_0813029 3300042876 Unclassified 844
373 Ga0453683_0773639 3300044673 Unclassified 631
374 Ga0466965_0157928 3300044683 Bacteria 1188
375 Ga0453684_0000581 3300044712 Bacteria 136088
376 Ga0453684_0010306 3300044712 Bacteria 16006
377 Ga0453684_0072380 3300044712 Bacteria 4352
378 Ga0453684_0154565 3300044712 Bacteria 2722
379 Ga0453684_0665998 3300044712 Bacteria 1134
380 Ga0453684_0919594 3300044712 Unclassified 936
381 Ga0453684_1599998 3300044712 Unclassified 669
382 Ga0466957_0488259 3300044842 Bacteria 853
383 Ga0451576_0235056 3300045051 Bacteria 1914
384 Ga0451576_0479912 3300045051 Bacteria 1306
385 Ga0466967_0978070 3300045976 Bacteria 842
386 Ga0495629_0047965 3300046459 Bacteria 2995
387 Ga0495638_0009952 3300046460 Bacteria 6629
388 Ga0495638_0020533 3300046460 Bacteria 4363
389 Ga0495580_0002689 3300046472 Bacteria 15387
390 Ga0495580_0010461 3300046472 Bacteria 7230
391 Ga0495580_0017921 3300046472 Bacteria 5281
392 Ga0495582_0006361 3300046473 Bacteria 6567
393 Ga0495586_0291870 3300046535 Bacteria 934
394 Ga0495668_0095532 3300046616 Bacteria 1627
395 Ga0495625_0004733 3300046660 Bacteria 12745
396 Ga0495625_0272752 3300046660 Bacteria 1091
397 Ga0495613_0116569 3300046689 Unclassified 1921
398 Ga0495674_0202994 3300047319 Bacteria 1644
399 Ga0495674_0907076 3300047319 Bacteria 680
400 Ga0495686_0133702 3300047472 Bacteria 1469
401 Ga0495686_0533742 3300047472 Bacteria 614
402 Ga0496101_0130241 3300048904 Unclassified 1910
403 Ga0496104_0031420 3300048907 Bacteria 4938
404 Ga0496104_1116467 3300048907 Unclassified 692
405 Ga0496106_0040094 3300048909 Bacteria 3506
406 Ga0496107_0249814 3300048910 Bacteria 1320
407 Ga0496108_0005390 3300048911 Bacteria 10339
408 Ga0496109_0005268 3300048912 Bacteria 10803
409 Ga0496109_1595980 3300048912 Bacteria 587
410 Ga0496110_0463184 3300048913 Unclassified 1155
411 Ga0496110_0918631 3300048913 Unclassified 781
412 Ga0496111_0515985 3300048914 Unclassified 879
413 Ga0496112_0001381 3300048915 Bacteria 18527
414 Ga0496112_0307382 3300048915 Unclassified 1531
415 Ga0496113_0057849 3300048916 Bacteria 2915
416 Ga0496114_0418507 3300048917 Unclassified 1187
417 Ga0496121_0193920 3300048924 Bacteria 1454
418 Ga0501031_0005224 3300049568 Bacteria 8462
419 Ga0501031_0109242 3300049568 Bacteria 1806
420 Ga0501032_0001719 3300049569 Bacteria 17319
421 Ga0501033_0006165 3300049570 Bacteria 9401
422 Ga0501034_0003806 3300049571 Bacteria 17014
423 Ga0501034_0123201 3300049571 Bacteria 2578
424 Ga0501036_0028440 3300049572 Bacteria 4724
425 Ga0501036_0679887 3300049572 Bacteria 851
426 Ga0501036_0938561 3300049572 Bacteria 709
427 Ga0501037_0001849 3300049573 Bacteria 15361
428 Ga0501037_0272127 3300049573 Bacteria 1182
429 Ga0501037_0785526 3300049573 Bacteria 629
430 Ga0501038_0010417 3300049574 Bacteria 8501
431 Ga0501038_0993482 3300049574 Bacteria 616
432 Ga0501039_0055013 3300049575 Bacteria 3081
433 Ga0501039_0491004 3300049575 Bacteria 964
434 Ga0501040_0013337 3300049576 Bacteria 5401
435 Ga0501040_0078339 3300049576 Bacteria 2287
436 Ga0501041_0059303 3300049577 Bacteria 2342
437 Ga0501041_0818963 3300049577 Bacteria 597
438 Ga0501042_0003484 3300049578 Bacteria 9891
439 Ga0501043_0024125 3300049579 Bacteria 4772
440 Ga0501046_0039267 3300049580 Bacteria 3792
441 Ga0501046_0052981 3300049580 Bacteria 3196
442 Ga0501046_0109126 3300049580 Bacteria 2116
443 Ga0501046_1260325 3300049580 Bacteria 506
444 Ga0501047_0004284 3300049581 Bacteria 13428
445 Ga0501047_0012877 3300049581 Bacteria 7924
446 Ga0501048_0785714 3300049582 Bacteria 684
447 Ga0501067_0363108 3300049583 Bacteria 807
448 Ga0501068_0040096 3300049584 Bacteria 2810
449 Ga0501068_0243405 3300049584 Bacteria 1145
450 Ga0501070_0026300 3300049586 Bacteria 4884
451 Ga0501070_0223234 3300049586 Bacteria 1545
452 Ga0501071_0012726 3300049587 Bacteria 5720
453 Ga0501072_0020521 3300049588 Bacteria 5121
454 Ga0501072_0138106 3300049588 Bacteria 1944
455 Ga0501073_0028945 3300049589 Bacteria 3958
456 Ga0501073_0080656 3300049589 Bacteria 2263
457 Ga0501073_0239141 3300049589 Bacteria 1254
458 Ga0501074_0067503 3300049590 Bacteria 2572
459 Ga0501074_1183195 3300049590 Bacteria 536
460 Ga0501075_0006371 3300049591 Bacteria 8122
461 Ga0501076_0082269 3300049592 Bacteria 2584
462 Ga0501076_0160903 3300049592 Bacteria 1829
463 Ga0501077_0042260 3300049593 Bacteria 2899
464 Ga0501079_0033421 3300049741 Bacteria 3956
465 Ga0501079_0375122 3300049741 Bacteria 1115
466 Ga0501080_0016690 3300049742 Bacteria 6780
467 Ga0501080_0276183 3300049742 Bacteria 1528
468 Ga0501080_0735305 3300049742 Bacteria 868
469 Ga0501081_0041085 3300049743 Bacteria 3166
470 Ga0501083_0323068 3300049744 Bacteria 1004
471 Ga0501035_0017998 3300049822 Bacteria 6514
472 Ga0501035_0023646 3300049822 Bacteria 5638
473 Ga0501035_1436358 3300049822 Bacteria 528
474 Ga0501044_0043013 3300049823 Bacteria 4694
475 Ga0501044_0183337 3300049823 Bacteria 2059
476 Ga0501045_0445588 3300049824 Bacteria 963
477 nmdc:mga05p37_209785_c1 3300050507 Bacteria 2355
478 nmdc:mga05p37_916190_c1 3300050507 Unclassified 943
479 nmdc:mga09592_114852_c1 3300050508 Bacteria 2311
480 nmdc:mga09592_273690_c1 3300050508 Bacteria 1465
481 nmdc:mga09592_284269_c1 3300050508 Bacteria 1434
482 nmdc:mga09592_347831_c1 3300050508 Bacteria 1283
483 nmdc:mga0qj67_185092_c1 3300050509 Bacteria 1692
484 nmdc:mga0qj67_3864_c1 3300050509 Bacteria 10824
485 nmdc:mga06r32_117975_c1 3300050510 Bacteria 2616
486 nmdc:mga06r32_46293_c1 3300050510 Bacteria 4151
487 nmdc:mga06r32_534471_c1 3300050510 Bacteria 1147
488 nmdc:mga06r32_64504_c1 3300050510 Bacteria 3532
489 nmdc:mga06r32_92012_c1 3300050510 Bacteria 2964
490 nmdc:mga08y16_157573_c1 3300050511 Bacteria 2360
491 nmdc:mga08y16_363509_c1 3300050511 Bacteria 1486
492 nmdc:mga08y16_736736_c1 3300050511 Bacteria 983
493 nmdc:mga0n895_1522552_c1 3300050512 Bacteria 635
494 Ga0500610_0454064 3300053079 Bacteria 501
495 Ga0500644_0016504 3300053088 Bacteria 2127
496 Ga0500583_0011885 3300053092 Bacteria 3301
497 Ga0500654_168831 3300053099 Bacteria 724
498 Ga0500562_000033 3300053108 Bacteria 86295
499 Ga0500562_127286 3300053108 Bacteria 694
500 Ga0500594_0073161 3300053118 Bacteria 1011
501 Ga0500568_0021082 3300053139 Bacteria 2809
502 Ga0500568_0056455 3300053139 Bacteria 1530
503 Ga0500568_0222447 3300053139 Bacteria 689
504 Ga0500589_144486 3300053147 Bacteria 976
505 Ga0500616_0042300 3300053153 Bacteria 2440
506 Ga0500616_0191690 3300053153 Bacteria 912
507 Ga0500622_0002345 3300053156 Bacteria 13779
508 Ga0500622_0003964 3300053156 Bacteria 9557
509 Ga0500622_0004622 3300053156 Bacteria 8542
510 Ga0500637_0050333 3300053178 Bacteria 2373
511 Ga0501084_0061838 3300054114 Bacteria 3135
512 Ga0501084_0149738 3300054114 Bacteria 1967
513 Ga0501084_0675890 3300054114 Bacteria 871
514 Ga0500661_003241 3300055283 Bacteria 3063
515 Ga0587084_028212 3300059477 Bacteria 887
516 Ga0587070_052120 3300059491 Bacteria 820
517 Ga0587070_100421 3300059491 Unclassified 665
518 Ga0587073_0092752 3300059492 Bacteria 771
519 Ga0587073_0221606 3300059492 Unclassified 578
520 Ga0587077_075263 3300059493 Unclassified 763
521 Ga0587080_088856 3300059503 Unclassified 645
522 Ga0587082_063225 3300059504 Bacteria 735
523 Ga0587082_145969 3300059504 Unclassified 556
524 Ga0587086_019149 3300059507 Bacteria 918
525 Ga0587088_143373 3300059508 Unclassified 572
526 Ga0587089_055916 3300059509 Unclassified 643
527 Ga0587091_077885 3300059511 Unclassified 738
528 Ga0587092_104395 3300059512 Bacteria 588
529 Ga0587094_021068 3300059513 Bacteria 948
530 Ga0587101_044416 3300059623 Bacteria 744
531 Ga0587067_158127 3300059640 Unclassified 574
532 Ga0587072_046345 3300059643 Unclassified 859
533 Ga0587072_074849 3300059643 Bacteria 722
534 Ga0587075_097617 3300059644 Bacteria 582
535 Ga0587078_026124 3300059646 Bacteria 765
536 Ga0587107_034871 3300059652 Unclassified 785
537 Ga0587071_042241 3300060344 Unclassified 917
538 Ga0587071_111903 3300060344 Unclassified 643
539 Ga0501082_0028417 3300060353 Bacteria 4818
540 Ga0501082_0030265 3300060353 Bacteria 4665
541 Ga0501082_0168989 3300060353 Bacteria 1901
542 Ga0530510_0336796 3300061734 Bacteria 1132

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100532570 Ga0070706_1005325702 116
2 3300036712 Ga0316584_0387305 Ga0316584_0387305_597_962 119
3 3300046460 Ga0495638_0020533 Ga0495638_0020533_3932_4303 120
4 3300047319 Ga0495674_0907076 Ga0495674_0907076_232_630 128
5 3300020070 Ga0206356_10506610 Ga0206356_105066101 133
6 3300027695 Ga0209966_1003407 Ga0209966_10034072 135
7 3300049584 Ga0501068_0243405 Ga0501068_0243405_137_544 135
8 3300049586 Ga0501070_0223234 Ga0501070_0223234_682_1089 135
9 3300049589 Ga0501073_0239141 Ga0501073_0239141_673_1080 135
10 3300049590 Ga0501074_1183195 Ga0501074_1183195_16_423 135
11 3300049741 Ga0501079_0375122 Ga0501079_0375122_676_1083 135
12 3300049744 Ga0501083_0323068 Ga0501083_0323068_327_734 135
13 3300054114 Ga0501084_0149738 Ga0501084_0149738_633_1040 135
14 iso_pu_bacteria 2501025502 2501082062 138
15 iso_pu_bacteria 2510917013 2511088721 138
16 iso_pu_bacteria 2929154850 2929157991 138
17 iso_pu_bacteria 2808606384 2808969211 139
18 iso_pu_bacteria 2808606390 2809004042 139
19 iso_pu_bacteria 2808606391 2809012761 139
20 2162886011 MRS1b_contig_8124326 MRS1b_0845.00001140 141
21 3300002076 JGI24749J21850_1051909 JGI24749J21850_10519091 141
22 3300004799 Ga0058863_11560427 Ga0058863_115604271 141
23 3300004799 Ga0058863_11906289 Ga0058863_119062891 141
24 3300004800 Ga0058861_10005562 Ga0058861_100055622 141
25 3300004800 Ga0058861_10019033 Ga0058861_100190331 141
26 3300004800 Ga0058861_11584140 Ga0058861_115841401 141
27 3300004800 Ga0058861_12059346 Ga0058861_120593461 141
28 3300004801 Ga0058860_11534087 Ga0058860_115340871 141
29 3300004803 Ga0058862_10006799 Ga0058862_100067991 141
30 3300004803 Ga0058862_10013143 Ga0058862_100131431 141
31 3300004803 Ga0058862_10086714 Ga0058862_100867141 141
32 3300004803 Ga0058862_12368229 Ga0058862_123682291 141
33 3300005290 Ga0065712_10000676 Ga0065712_100006761 141
34 3300005293 Ga0065715_10002561 Ga0065715_100025616 141
35 3300005327 Ga0070658_11004615 Ga0070658_110046152 141
36 3300005330 Ga0070690_100437048 Ga0070690_1004370481 141
37 3300005331 Ga0070670_100004678 Ga0070670_10000467812 141
38 3300005334 Ga0068869_100970778 Ga0068869_1009707782 141
39 3300005336 Ga0070680_101574566 Ga0070680_1015745661 141
40 3300005337 Ga0070682_101714201 Ga0070682_1017142011 141
41 3300005347 Ga0070668_100106265 Ga0070668_1001062652 141
42 3300005354 Ga0070675_100024043 Ga0070675_1000240432 141
43 3300005355 Ga0070671_100697594 Ga0070671_1006975942 141
44 3300005364 Ga0070673_100113317 Ga0070673_1001133171 141
45 3300005365 Ga0070688_100000341 Ga0070688_10000034112 141
46 3300005436 Ga0070713_100831828 Ga0070713_1008318282 141
47 3300005456 Ga0070678_100227194 Ga0070678_1002271941 141
48 3300005459 Ga0068867_100010417 Ga0068867_1000104177 141
49 3300005466 Ga0070685_10369240 Ga0070685_103692402 141
50 3300005467 Ga0070706_100890552 Ga0070706_1008905521 141
51 3300005539 Ga0068853_100343267 Ga0068853_1003432672 141
52 3300005543 Ga0070672_100451828 Ga0070672_1004518282 141
53 3300005544 Ga0070686_100431732 Ga0070686_1004317321 141
54 3300005548 Ga0070665_100050891 Ga0070665_1000508912 141
55 3300005563 Ga0068855_100742650 Ga0068855_1007426502 141
56 3300005615 Ga0070702_100256889 Ga0070702_1002568891 141
57 3300005618 Ga0068864_100003339 Ga0068864_10000333912 141
58 3300005719 Ga0068861_100370490 Ga0068861_1003704902 141
59 3300005840 Ga0068870_10272159 Ga0068870_102721592 141
60 3300005841 Ga0068863_100120870 Ga0068863_1001208702 141
61 3300005983 Ga0081540_1040780 Ga0081540_10407802 141
62 3300006237 Ga0097621_100361887 Ga0097621_1003618872 141
63 3300006358 Ga0068871_100636493 Ga0068871_1006364932 141
64 3300009176 Ga0105242_10526519 Ga0105242_105265192 141
65 3300009177 Ga0105248_10702498 Ga0105248_107024982 141
66 3300009553 Ga0105249_10026809 Ga0105249_100268093 141
67 3300011119 Ga0105246_10356906 Ga0105246_103569061 141
68 3300013105 Ga0157369_11688253 Ga0157369_116882531 141
69 3300013297 Ga0157378_10778675 Ga0157378_107786752 141
70 3300013306 Ga0163162_10298910 Ga0163162_102989101 141
71 3300013308 Ga0157375_10048802 Ga0157375_100488024 141
72 3300013308 Ga0157375_10375905 Ga0157375_103759052 141
73 3300014325 Ga0163163_10083888 Ga0163163_100838882 141
74 3300014325 Ga0163163_10362858 Ga0163163_103628582 141
75 3300020069 Ga0197907_10309475 Ga0197907_103094751 141
76 3300020069 Ga0197907_10481651 Ga0197907_104816512 141
77 3300020069 Ga0197907_11305640 Ga0197907_113056401 141
78 3300020069 Ga0197907_11314326 Ga0197907_113143261 141
79 3300020070 Ga0206356_10394661 Ga0206356_103946611 141
80 3300020070 Ga0206356_10675169 Ga0206356_106751691 141
81 3300020070 Ga0206356_11895739 Ga0206356_118957391 141
82 3300020075 Ga0206349_1894552 Ga0206349_18945521 141
83 3300020075 Ga0206349_1954048 Ga0206349_19540482 141
84 3300020076 Ga0206355_1475349 Ga0206355_14753492 141
85 3300020076 Ga0206355_1678219 Ga0206355_16782191 141
86 3300020077 Ga0206351_10459302 Ga0206351_104593022 141
87 3300020077 Ga0206351_10483349 Ga0206351_104833491 141
88 3300020077 Ga0206351_10672749 Ga0206351_106727492 141
89 3300020078 Ga0206352_10226561 Ga0206352_102265611 141
90 3300020078 Ga0206352_10909166 Ga0206352_109091662 141
91 3300020080 Ga0206350_10195778 Ga0206350_101957781 141
92 3300020080 Ga0206350_10421805 Ga0206350_104218052 141
93 3300020080 Ga0206350_10458104 Ga0206350_104581041 141
94 3300020082 Ga0206353_10550515 Ga0206353_105505152 141
95 3300020082 Ga0206353_11078394 Ga0206353_110783941 141
96 3300020082 Ga0206353_11677454 Ga0206353_116774541 141
97 3300020610 Ga0154015_1459979 Ga0154015_14599791 141
98 3300022467 Ga0224712_10061048 Ga0224712_100610482 141
99 3300022467 Ga0224712_10103935 Ga0224712_101039352 141
100 3300022467 Ga0224712_10265370 Ga0224712_102653702 141
101 3300025899 Ga0207642_10353122 Ga0207642_103531221 141
102 3300025908 Ga0207643_10235253 Ga0207643_102352532 141
103 3300025916 Ga0207663_10857977 Ga0207663_108579771 141
104 3300025918 Ga0207662_10040975 Ga0207662_100409753 141
105 3300025925 Ga0207650_10034198 Ga0207650_100341981 141
106 3300025926 Ga0207659_10384229 Ga0207659_103842292 141
107 3300025938 Ga0207704_10129624 Ga0207704_101296241 141
108 3300025940 Ga0207691_10235538 Ga0207691_102355382 141
109 3300025941 Ga0207711_10558283 Ga0207711_105582833 141
110 3300025949 Ga0207667_10306046 Ga0207667_103060461 141
111 3300025961 Ga0207712_10458037 Ga0207712_104580372 141
112 3300025972 Ga0207668_10053567 Ga0207668_100535672 141
113 3300025986 Ga0207658_10483776 Ga0207658_104837762 141
114 3300026088 Ga0207641_10140102 Ga0207641_101401022 141
115 3300026089 Ga0207648_10086707 Ga0207648_100867072 141
116 3300026095 Ga0207676_10030598 Ga0207676_100305983 141
117 3300026118 Ga0207675_100158259 Ga0207675_1001582592 141
118 3300026121 Ga0207683_10269776 Ga0207683_102697761 141
119 3300028379 Ga0268266_10084991 Ga0268266_100849913 141
120 3300031344 Ga0265316_10291822 Ga0265316_102918222 141
121 3300044712 Ga0453684_0665998 Ga0453684_0665998_415_858 141
122 3300044842 Ga0466957_0488259 Ga0466957_0488259_291_773 141
123 3300048904 Ga0496101_0130241 Ga0496101_0130241_939_1367 141
124 3300048907 Ga0496104_0031420 Ga0496104_0031420_499_927 141
125 3300048907 Ga0496104_1116467 Ga0496104_1116467_168_647 141
126 3300048909 Ga0496106_0040094 Ga0496106_0040094_2070_2498 141
127 3300048910 Ga0496107_0249814 Ga0496107_0249814_58_486 141
128 3300048911 Ga0496108_0005390 Ga0496108_0005390_7461_7889 141
129 3300048912 Ga0496109_0005268 Ga0496109_0005268_348_776 141
130 3300048913 Ga0496110_0463184 Ga0496110_0463184_82_561 141
131 3300048913 Ga0496110_0918631 Ga0496110_0918631_223_651 141
132 3300048914 Ga0496111_0515985 Ga0496111_0515985_334_813 141
133 3300048915 Ga0496112_0001381 Ga0496112_0001381_2627_3055 141
134 3300048916 Ga0496113_0057849 Ga0496113_0057849_2266_2694 141
135 3300048917 Ga0496114_0418507 Ga0496114_0418507_449_928 141
136 3300049571 Ga0501034_0123201 Ga0501034_0123201_1230_1679 141
137 3300049573 Ga0501037_0272127 Ga0501037_0272127_378_827 141
138 3300049580 Ga0501046_0109126 Ga0501046_0109126_705_1154 141
139 3300049581 Ga0501047_0004284 Ga0501047_0004284_6136_6585 141
140 3300049582 Ga0501048_0785714 Ga0501048_0785714_158_607 141
141 3300049586 Ga0501070_0026300 Ga0501070_0026300_2375_2824 141
142 3300049742 Ga0501080_0735305 Ga0501080_0735305_327_776 141
143 3300049822 Ga0501035_0023646 Ga0501035_0023646_1010_1459 141
144 3300049822 Ga0501035_1436358 Ga0501035_1436358_43_492 141
145 3300049823 Ga0501044_0183337 Ga0501044_0183337_485_934 141
146 3300059477 Ga0587084_028212 Ga0587084_028212_172_621 141
147 3300059491 Ga0587070_052120 Ga0587070_052120_173_622 141
148 3300059491 Ga0587070_100421 Ga0587070_100421_65_514 141
149 3300059492 Ga0587073_0092752 Ga0587073_0092752_174_623 141
150 3300059492 Ga0587073_0221606 Ga0587073_0221606_37_486 141
151 3300059493 Ga0587077_075263 Ga0587077_075263_166_615 141
152 3300059503 Ga0587080_088856 Ga0587080_088856_126_575 141
153 3300059504 Ga0587082_063225 Ga0587082_063225_114_563 141
154 3300059504 Ga0587082_145969 Ga0587082_145969_34_483 141
155 3300059507 Ga0587086_019149 Ga0587086_019149_171_620 141
156 3300059508 Ga0587088_143373 Ga0587088_143373_109_558 141
157 3300059509 Ga0587089_055916 Ga0587089_055916_178_627 141
158 3300059511 Ga0587091_077885 Ga0587091_077885_127_576 141
159 3300059512 Ga0587092_104395 Ga0587092_104395_127_576 141
160 3300059513 Ga0587094_021068 Ga0587094_021068_174_623 141
161 3300059623 Ga0587101_044416 Ga0587101_044416_152_601 141
162 3300059640 Ga0587067_158127 Ga0587067_158127_26_475 141
163 3300059643 Ga0587072_046345 Ga0587072_046345_256_705 141
164 3300059643 Ga0587072_074849 Ga0587072_074849_166_615 141
165 3300059644 Ga0587075_097617 Ga0587075_097617_15_491 141
166 3300059646 Ga0587078_026124 Ga0587078_026124_168_617 141
167 3300059652 Ga0587107_034871 Ga0587107_034871_158_607 141
168 3300060344 Ga0587071_042241 Ga0587071_042241_176_625 141
169 3300060344 Ga0587071_111903 Ga0587071_111903_68_517 141
170 2162886007 SwRhRL2b_contig_975409 SwRhRL2b_0585.00006800 142
171 3300003911 JGI25405J52794_10048972 JGI25405J52794_100489722 142
172 3300005295 Ga0065707_10083877 Ga0065707_100838772 142
173 3300005295 Ga0065707_10157251 Ga0065707_101572512 142
174 3300005295 Ga0065707_10834947 Ga0065707_108349471 142
175 3300005327 Ga0070658_10630277 Ga0070658_106302772 142
176 3300005328 Ga0070676_10010484 Ga0070676_100104845 142
177 3300005328 Ga0070676_10317201 Ga0070676_103172011 142
178 3300005329 Ga0070683_100240127 Ga0070683_1002401272 142
179 3300005331 Ga0070670_100199823 Ga0070670_1001998232 142
180 3300005331 Ga0070670_101179778 Ga0070670_1011797782 142
181 3300005333 Ga0070677_10293776 Ga0070677_102937761 142
182 3300005336 Ga0070680_100068243 Ga0070680_1000682434 142
183 3300005336 Ga0070680_100224295 Ga0070680_1002242952 142
184 3300005338 Ga0068868_100812565 Ga0068868_1008125651 142
185 3300005338 Ga0068868_100983754 Ga0068868_1009837542 142
186 3300005341 Ga0070691_10071163 Ga0070691_100711632 142
187 3300005344 Ga0070661_100575211 Ga0070661_1005752111 142
188 3300005345 Ga0070692_10157251 Ga0070692_101572512 142
189 3300005347 Ga0070668_100063770 Ga0070668_1000637701 142
190 3300005347 Ga0070668_100097381 Ga0070668_1000973812 142
191 3300005347 Ga0070668_100432869 Ga0070668_1004328692 142
192 3300005353 Ga0070669_100030601 Ga0070669_1000306015 142
193 3300005353 Ga0070669_100207557 Ga0070669_1002075572 142
194 3300005356 Ga0070674_100059987 Ga0070674_1000599875 142
195 3300005364 Ga0070673_100595282 Ga0070673_1005952821 142
196 3300005366 Ga0070659_100092857 Ga0070659_1000928572 142
197 3300005367 Ga0070667_100069926 Ga0070667_1000699262 142
198 3300005434 Ga0070709_10867111 Ga0070709_108671111 142
199 3300005435 Ga0070714_100907904 Ga0070714_1009079042 142
200 3300005436 Ga0070713_100009620 Ga0070713_1000096208 142
201 3300005436 Ga0070713_100094102 Ga0070713_1000941022 142
202 3300005438 Ga0070701_10224366 Ga0070701_102243662 142
203 3300005438 Ga0070701_11020721 Ga0070701_110207211 142
204 3300005439 Ga0070711_100292340 Ga0070711_1002923402 142
205 3300005444 Ga0070694_100034090 Ga0070694_1000340901 142
206 3300005455 Ga0070663_100021366 Ga0070663_1000213662 142
207 3300005455 Ga0070663_100428518 Ga0070663_1004285181 142
208 3300005456 Ga0070678_100532010 Ga0070678_1005320102 142
209 3300005456 Ga0070678_100618041 Ga0070678_1006180411 142
210 3300005457 Ga0070662_100010273 Ga0070662_1000102735 142
211 3300005457 Ga0070662_100014291 Ga0070662_1000142915 142
212 3300005457 Ga0070662_100208496 Ga0070662_1002084962 142
213 3300005458 Ga0070681_10926054 Ga0070681_109260541 142
214 3300005471 Ga0070698_100368703 Ga0070698_1003687032 142
215 3300005530 Ga0070679_100276021 Ga0070679_1002760212 142
216 3300005530 Ga0070679_101344822 Ga0070679_1013448221 142
217 3300005536 Ga0070697_100635832 Ga0070697_1006358322 142
218 3300005539 Ga0068853_100000762 Ga0068853_10000076213 142
219 3300005539 Ga0068853_100000975 Ga0068853_10000097510 142
220 3300005539 Ga0068853_100123692 Ga0068853_1001236922 142
221 3300005543 Ga0070672_100000775 Ga0070672_1000007757 142
222 3300005547 Ga0070693_100722774 Ga0070693_1007227741 142
223 3300005548 Ga0070665_100004227 Ga0070665_1000042272 142
224 3300005549 Ga0070704_100107970 Ga0070704_1001079703 142
225 3300005549 Ga0070704_100492752 Ga0070704_1004927521 142
226 3300005563 Ga0068855_100006801 Ga0068855_1000068015 142
227 3300005563 Ga0068855_100096416 Ga0068855_1000964162 142
228 3300005577 Ga0068857_101556843 Ga0068857_1015568431 142
229 3300005577 Ga0068857_102239616 Ga0068857_1022396161 142
230 3300005614 Ga0068856_100039388 Ga0068856_1000393883 142
231 3300005616 Ga0068852_100708746 Ga0068852_1007087461 142
232 3300005718 Ga0068866_10010001 Ga0068866_100100012 142
233 3300005718 Ga0068866_10030257 Ga0068866_100302572 142
234 3300005719 Ga0068861_100000924 Ga0068861_10000092410 142
235 3300005719 Ga0068861_100496088 Ga0068861_1004960881 142
236 3300005834 Ga0068851_10194597 Ga0068851_101945972 142
237 3300005841 Ga0068863_100018888 Ga0068863_1000188882 142
238 3300005844 Ga0068862_100011962 Ga0068862_1000119623 142
239 3300005844 Ga0068862_100021863 Ga0068862_1000218636 142
240 3300005937 Ga0081455_10006436 Ga0081455_100064367 142
241 3300006028 Ga0070717_10265681 Ga0070717_102656812 142
242 3300006028 Ga0070717_10670210 Ga0070717_106702101 142
243 3300006173 Ga0070716_100017128 Ga0070716_1000171283 142
244 3300006173 Ga0070716_100035731 Ga0070716_1000357313 142
245 3300006175 Ga0070712_100004652 Ga0070712_1000046525 142
246 3300006175 Ga0070712_100537675 Ga0070712_1005376753 142
247 3300006358 Ga0068871_101269525 Ga0068871_1012695251 142
248 3300006844 Ga0075428_100006966 Ga0075428_10000696613 142
249 3300006844 Ga0075428_100028202 Ga0075428_1000282024 142
250 3300006844 Ga0075428_100293264 Ga0075428_1002932642 142
251 3300006846 Ga0075430_100097518 Ga0075430_1000975183 142
252 3300006846 Ga0075430_100440814 Ga0075430_1004408142 142
253 3300006847 Ga0075431_100031192 Ga0075431_1000311926 142
254 3300006847 Ga0075431_100106629 Ga0075431_1001066294 142
255 3300006847 Ga0075431_100528486 Ga0075431_1005284862 142
256 3300006847 Ga0075431_101731254 Ga0075431_1017312541 142
257 3300006871 Ga0075434_100307384 Ga0075434_1003073841 142
258 3300006880 Ga0075429_100056506 Ga0075429_1000565063 142
259 3300006880 Ga0075429_100062203 Ga0075429_1000622033 142
260 3300006880 Ga0075429_100281391 Ga0075429_1002813912 142
261 3300006948 Ga0099826_10119588 Ga0099826_101195883 142
262 3300009094 Ga0111539_10016185 Ga0111539_100161857 142
263 3300009094 Ga0111539_10020676 Ga0111539_100206766 142
264 3300009094 Ga0111539_10822873 Ga0111539_108228732 142
265 3300009101 Ga0105247_10089674 Ga0105247_100896742 142
266 3300009147 Ga0114129_10103116 Ga0114129_101031162 142
267 3300009147 Ga0114129_10995028 Ga0114129_109950282 142
268 3300009148 Ga0105243_10193043 Ga0105243_101930431 142
269 3300009174 Ga0105241_10489399 Ga0105241_104893992 142
270 3300009174 Ga0105241_11327529 Ga0105241_113275292 142
271 3300009176 Ga0105242_10184493 Ga0105242_101844932 142
272 3300009176 Ga0105242_10184628 Ga0105242_101846282 142
273 3300009553 Ga0105249_10070843 Ga0105249_100708432 142
274 3300010375 Ga0105239_10225453 Ga0105239_102254533 142
275 3300010375 Ga0105239_10559662 Ga0105239_105596622 142
276 3300013100 Ga0157373_10552153 Ga0157373_105521531 142
277 3300013296 Ga0157374_11178779 Ga0157374_111787792 142
278 3300013306 Ga0163162_11537856 Ga0163162_115378561 142
279 3300013306 Ga0163162_12186199 Ga0163162_121861991 142
280 3300013307 Ga0157372_10597414 Ga0157372_105974142 142
281 3300013308 Ga0157375_10532936 Ga0157375_105329362 142
282 3300014325 Ga0163163_12109898 Ga0163163_121098982 142
283 3300014326 Ga0157380_10004477 Ga0157380_1000447710 142
284 3300014326 Ga0157380_10021556 Ga0157380_100215562 142
285 3300014326 Ga0157380_11909195 Ga0157380_119091951 142
286 3300015262 Ga0182007_10143692 Ga0182007_101436922 142
287 3300017792 Ga0163161_10436326 Ga0163161_104363262 142
288 3300025303 Ga0209051_1018121 Ga0209051_10181213 142
289 3300025906 Ga0207699_10208510 Ga0207699_102085101 142
290 3300025907 Ga0207645_10000790 Ga0207645_100007909 142
291 3300025910 Ga0207684_10406901 Ga0207684_104069012 142
292 3300025911 Ga0207654_10415312 Ga0207654_104153122 142
293 3300025914 Ga0207671_10184654 Ga0207671_101846543 142
294 3300025915 Ga0207693_10110348 Ga0207693_101103482 142
295 3300025916 Ga0207663_10059060 Ga0207663_100590602 142
296 3300025917 Ga0207660_10175300 Ga0207660_101753002 142
297 3300025919 Ga0207657_10689408 Ga0207657_106894081 142
298 3300025920 Ga0207649_10711473 Ga0207649_107114732 142
299 3300025921 Ga0207652_10123016 Ga0207652_101230161 142
300 3300025921 Ga0207652_11286815 Ga0207652_112868151 142
301 3300025923 Ga0207681_10029737 Ga0207681_100297372 142
302 3300025925 Ga0207650_10080575 Ga0207650_100805752 142
303 3300025928 Ga0207700_10025152 Ga0207700_100251522 142
304 3300025928 Ga0207700_10065230 Ga0207700_100652302 142
305 3300025932 Ga0207690_10023046 Ga0207690_100230462 142
306 3300025933 Ga0207706_10000586 Ga0207706_1000058621 142
307 3300025933 Ga0207706_10004219 Ga0207706_1000421913 142
308 3300025933 Ga0207706_10093108 Ga0207706_100931084 142
309 3300025934 Ga0207686_10248278 Ga0207686_102482782 142
310 3300025938 Ga0207704_10728054 Ga0207704_107280542 142
311 3300025939 Ga0207665_10030972 Ga0207665_100309725 142
312 3300025940 Ga0207691_10000872 Ga0207691_1000087214 142
313 3300025942 Ga0207689_10237986 Ga0207689_102379861 142
314 3300025945 Ga0207679_11353717 Ga0207679_113537171 142
315 3300025949 Ga0207667_10028581 Ga0207667_100285815 142
316 3300025949 Ga0207667_10246160 Ga0207667_102461603 142
317 3300025972 Ga0207668_10030913 Ga0207668_100309133 142
318 3300025972 Ga0207668_10294405 Ga0207668_102944052 142
319 3300025972 Ga0207668_11066804 Ga0207668_110668041 142
320 3300025981 Ga0207640_10071376 Ga0207640_100713761 142
321 3300025981 Ga0207640_11232687 Ga0207640_112326871 142
322 3300025986 Ga0207658_10064384 Ga0207658_100643842 142
323 3300025986 Ga0207658_10128208 Ga0207658_101282083 142
324 3300026041 Ga0207639_10000657 Ga0207639_100006577 142
325 3300026041 Ga0207639_10003833 Ga0207639_1000383310 142
326 3300026041 Ga0207639_10256944 Ga0207639_102569442 142
327 3300026067 Ga0207678_10042014 Ga0207678_100420142 142
328 3300026075 Ga0207708_10041283 Ga0207708_100412834 142
329 3300026075 Ga0207708_10187929 Ga0207708_101879292 142
330 3300026075 Ga0207708_10198820 Ga0207708_101988202 142
331 3300026078 Ga0207702_10058560 Ga0207702_100585601 142
332 3300026089 Ga0207648_10000544 Ga0207648_1000054424 142
333 3300026116 Ga0207674_10196433 Ga0207674_101964333 142
334 3300026116 Ga0207674_11443649 Ga0207674_114436491 142
335 3300026118 Ga0207675_100001615 Ga0207675_1000016159 142
336 3300026118 Ga0207675_100005250 Ga0207675_1000052506 142
337 3300026118 Ga0207675_100030331 Ga0207675_1000303316 142
338 3300026118 Ga0207675_100539425 Ga0207675_1005394252 142
339 3300026121 Ga0207683_10406873 Ga0207683_104068732 142
340 3300026142 Ga0207698_10196466 Ga0207698_101964662 142
341 3300026142 Ga0207698_11160280 Ga0207698_111602801 142
342 3300027364 Ga0209967_1004350 Ga0209967_10043502 142
343 3300027526 Ga0209968_1014555 Ga0209968_10145552 142
344 3300027543 Ga0209999_1003307 Ga0209999_10033075 142
345 3300027614 Ga0209970_1005977 Ga0209970_10059771 142
346 3300027617 Ga0210002_1017166 Ga0210002_10171662 142
347 3300027682 Ga0209971_1000749 Ga0209971_10007498 142
348 3300027717 Ga0209998_10004905 Ga0209998_100049053 142
349 3300027876 Ga0209974_10000879 Ga0209974_100008793 142
350 3300027907 Ga0207428_10365186 Ga0207428_103651862 142
351 3300027907 Ga0207428_10590103 Ga0207428_105901031 142
352 3300028379 Ga0268266_10024952 Ga0268266_100249525 142
353 3300028380 Ga0268265_10008849 Ga0268265_100088493 142
354 3300028380 Ga0268265_10018036 Ga0268265_100180366 142
355 3300028573 Ga0265334_10001494 Ga0265334_100014944 142
356 3300028577 Ga0265318_10006068 Ga0265318_100060687 142
357 3300028800 Ga0265338_10007423 Ga0265338_100074239 142
358 3300028800 Ga0265338_10056298 Ga0265338_100562982 142
359 3300029957 Ga0265324_10013594 Ga0265324_100135943 142
360 3300031235 Ga0265330_10006083 Ga0265330_100060834 142
361 3300031238 Ga0265332_10017482 Ga0265332_100174822 142
362 3300031239 Ga0265328_10000585 Ga0265328_1000058514 142
363 3300031239 Ga0265328_10047118 Ga0265328_100471181 142
364 3300031240 Ga0265320_10041365 Ga0265320_100413652 142
365 3300031241 Ga0265325_10003461 Ga0265325_100034616 142
366 3300031242 Ga0265329_10025194 Ga0265329_100251941 142
367 3300031247 Ga0265340_10037163 Ga0265340_100371631 142
368 3300031249 Ga0265339_10019067 Ga0265339_100190674 142
369 3300031249 Ga0265339_10131736 Ga0265339_101317361 142
370 3300031250 Ga0265331_10000065 Ga0265331_10000065133 142
371 3300031250 Ga0265331_10002811 Ga0265331_100028115 142
372 3300031250 Ga0265331_10046620 Ga0265331_100466203 142
373 3300031251 Ga0265327_10000123 Ga0265327_1000012345 142
374 3300031251 Ga0265327_10022091 Ga0265327_100220912 142
375 3300031344 Ga0265316_10026444 Ga0265316_100264443 142
376 3300031344 Ga0265316_10039529 Ga0265316_100395292 142
377 3300031507 Ga0307509_10179837 Ga0307509_101798372 142
378 3300031548 Ga0307408_100072024 Ga0307408_1000720242 142
379 3300031595 Ga0265313_10011808 Ga0265313_100118084 142
380 3300031665 Ga0316575_10002443 Ga0316575_100024432 142
381 3300031691 Ga0316579_10068379 Ga0316579_100683792 142
382 3300031691 Ga0316579_10277867 Ga0316579_102778672 142
383 3300031711 Ga0265314_10007342 Ga0265314_100073427 142
384 3300031712 Ga0265342_10055546 Ga0265342_100555462 142
385 3300031727 Ga0316576_10245211 Ga0316576_102452112 142
386 3300031727 Ga0316576_10468625 Ga0316576_104686252 142
387 3300031728 Ga0316578_10052983 Ga0316578_100529832 142
388 3300031731 Ga0307405_11085284 Ga0307405_110852841 142
389 3300031731 Ga0307405_11424633 Ga0307405_114246332 142
390 3300031733 Ga0316577_10057893 Ga0316577_100578932 142
391 3300031824 Ga0307413_10026221 Ga0307413_100262212 142
392 3300031824 Ga0307413_10172904 Ga0307413_101729042 142
393 3300031852 Ga0307410_10153496 Ga0307410_101534963 142
394 3300031852 Ga0307410_10976166 Ga0307410_109761662 142
395 3300031901 Ga0307406_10059362 Ga0307406_100593622 142
396 3300031903 Ga0307407_10968748 Ga0307407_109687481 142
397 3300031911 Ga0307412_10584315 Ga0307412_105843152 142
398 3300031911 Ga0307412_10705395 Ga0307412_107053951 142
399 3300031995 Ga0307409_100215727 Ga0307409_1002157272 142
400 3300032002 Ga0307416_100120789 Ga0307416_1001207892 142
401 3300032002 Ga0307416_100293929 Ga0307416_1002939292 142
402 3300032002 Ga0307416_100465755 Ga0307416_1004657552 142
403 3300032002 Ga0307416_100980025 Ga0307416_1009800251 142
404 3300032004 Ga0307414_11684778 Ga0307414_116847781 142
405 3300032005 Ga0307411_10056689 Ga0307411_100566893 142
406 3300032005 Ga0307411_11130923 Ga0307411_111309231 142
407 3300032126 Ga0307415_100070741 Ga0307415_1000707412 142
408 3300032126 Ga0307415_100142688 Ga0307415_1001426883 142
409 3300032133 Ga0316583_10295778 Ga0316583_102957781 142
410 3300032137 Ga0316585_10028006 Ga0316585_100280062 142
411 3300032139 Ga0316580_10011023 Ga0316580_100110232 142
412 3300035171 Ga0373946_0045631 Ga0373946_0045631_113_565 142
413 3300035398 Ga0316574_0000470 Ga0316574_0000470_14403_14831 142
414 3300035398 Ga0316574_0165276 Ga0316574_0165276_518_955 142
415 3300035725 Ga0373947_0051879 Ga0373947_0051879_17_469 142
416 3300036647 Ga0316582_0001306 Ga0316582_0001306_9288_9716 142
417 3300036647 Ga0316582_0065153 Ga0316582_0065153_1448_1879 142
418 3300036647 Ga0316582_0854790 Ga0316582_0854790_56_493 142
419 3300036712 Ga0316584_0006760 Ga0316584_0006760_3312_3740 142
420 3300037068 Ga0373925_0021595 Ga0373925_0021595_1927_2379 142
421 3300038726 Ga0400490_60992 Ga0400490_60992_628_1065 142
422 3300038741 Ga0400488_55436 Ga0400488_55436_1223_1660 142
423 3300041486 Ga0451807_1641010 Ga0451807_1641010_99_527 142
424 3300041491 Ga0451833_1240965 Ga0451833_1240965_51_479 142
425 3300041492 Ga0451835_0658749 Ga0451835_0658749_21_449 142
426 3300041498 Ga0451841_0183847 Ga0451841_0183847_145_573 142
427 3300041503 Ga0451847_0549916 Ga0451847_0549916_24_452 142
428 3300041507 Ga0451851_0917330 Ga0451851_0917330_91_519 142
429 3300041512 Ga0451853_1060211 Ga0451853_1060211_834_1262 142
430 3300041512 Ga0451853_1956397 Ga0451853_1956397_41_469 142
431 3300042125 Ga0450923_000521 Ga0450923_000521_2635_3066 142
432 3300042133 Ga0450896_005791 Ga0450896_005791_457_888 142
433 3300042461 Ga0439460_0019273 Ga0439460_0019273_1402_1836 142
434 3300042532 Ga0450893_0009053 Ga0450893_0009053_322_753 142
435 3300042876 Ga0451577_0002503 Ga0451577_0002503_14406_14834 142
436 3300042876 Ga0451577_0813029 Ga0451577_0813029_133_573 142
437 3300044673 Ga0453683_0773639 Ga0453683_0773639_133_570 142
438 3300044683 Ga0466965_0157928 Ga0466965_0157928_19_447 142
439 3300044712 Ga0453684_0000581 Ga0453684_0000581_131293_131787 142
440 3300044712 Ga0453684_0010306 Ga0453684_0010306_11046_11477 142
441 3300044712 Ga0453684_0072380 Ga0453684_0072380_2328_2768 142
442 3300044712 Ga0453684_0154565 Ga0453684_0154565_449_889 142
443 3300044712 Ga0453684_0919594 Ga0453684_0919594_17_454 142
444 3300044712 Ga0453684_1599998 Ga0453684_1599998_159_608 142
445 3300045051 Ga0451576_0235056 Ga0451576_0235056_433_861 142
446 3300045051 Ga0451576_0479912 Ga0451576_0479912_386_820 142
447 3300045976 Ga0466967_0978070 Ga0466967_0978070_28_489 142
448 3300046459 Ga0495629_0047965 Ga0495629_0047965_1146_1598 142
449 3300046460 Ga0495638_0009952 Ga0495638_0009952_2669_3097 142
450 3300046472 Ga0495580_0002689 Ga0495580_0002689_13269_13721 142
451 3300046472 Ga0495580_0010461 Ga0495580_0010461_4249_4701 142
452 3300046472 Ga0495580_0017921 Ga0495580_0017921_4315_4767 142
453 3300046473 Ga0495582_0006361 Ga0495582_0006361_3727_4179 142
454 3300046535 Ga0495586_0291870 Ga0495586_0291870_253_681 142
455 3300046616 Ga0495668_0095532 Ga0495668_0095532_465_893 142
456 3300046660 Ga0495625_0004733 Ga0495625_0004733_1872_2300 142
457 3300046660 Ga0495625_0272752 Ga0495625_0272752_206_634 142
458 3300046689 Ga0495613_0116569 Ga0495613_0116569_397_849 142
459 3300047319 Ga0495674_0202994 Ga0495674_0202994_1030_1482 142
460 3300047472 Ga0495686_0133702 Ga0495686_0133702_35_463 142
461 3300047472 Ga0495686_0533742 Ga0495686_0533742_16_459 142
462 3300048912 Ga0496109_1595980 Ga0496109_1595980_30_458 142
463 3300048915 Ga0496112_0307382 Ga0496112_0307382_1006_1458 142
464 3300048924 Ga0496121_0193920 Ga0496121_0193920_26_454 142
465 3300049568 Ga0501031_0005224 Ga0501031_0005224_3546_3974 142
466 3300049568 Ga0501031_0109242 Ga0501031_0109242_1354_1782 142
467 3300049569 Ga0501032_0001719 Ga0501032_0001719_6221_6649 142
468 3300049570 Ga0501033_0006165 Ga0501033_0006165_1926_2354 142
469 3300049571 Ga0501034_0003806 Ga0501034_0003806_12831_13259 142
470 3300049572 Ga0501036_0028440 Ga0501036_0028440_61_489 142
471 3300049572 Ga0501036_0679887 Ga0501036_0679887_322_750 142
472 3300049572 Ga0501036_0938561 Ga0501036_0938561_247_675 142
473 3300049573 Ga0501037_0001849 Ga0501037_0001849_10286_10714 142
474 3300049573 Ga0501037_0785526 Ga0501037_0785526_122_550 142
475 3300049574 Ga0501038_0010417 Ga0501038_0010417_6015_6443 142
476 3300049574 Ga0501038_0993482 Ga0501038_0993482_12_440 142
477 3300049575 Ga0501039_0055013 Ga0501039_0055013_232_660 142
478 3300049575 Ga0501039_0491004 Ga0501039_0491004_84_512 142
479 3300049576 Ga0501040_0013337 Ga0501040_0013337_2957_3385 142
480 3300049576 Ga0501040_0078339 Ga0501040_0078339_326_754 142
481 3300049577 Ga0501041_0059303 Ga0501041_0059303_274_702 142
482 3300049577 Ga0501041_0818963 Ga0501041_0818963_100_528 142
483 3300049578 Ga0501042_0003484 Ga0501042_0003484_6685_7113 142
484 3300049579 Ga0501043_0024125 Ga0501043_0024125_2047_2475 142
485 3300049580 Ga0501046_0039267 Ga0501046_0039267_3304_3732 142
486 3300049580 Ga0501046_0052981 Ga0501046_0052981_233_661 142
487 3300049580 Ga0501046_1260325 Ga0501046_1260325_39_467 142
488 3300049581 Ga0501047_0012877 Ga0501047_0012877_105_533 142
489 3300049583 Ga0501067_0363108 Ga0501067_0363108_52_480 142
490 3300049584 Ga0501068_0040096 Ga0501068_0040096_223_651 142
491 3300049587 Ga0501071_0012726 Ga0501071_0012726_3178_3606 142
492 3300049588 Ga0501072_0020521 Ga0501072_0020521_2374_2802 142
493 3300049588 Ga0501072_0138106 Ga0501072_0138106_947_1375 142
494 3300049589 Ga0501073_0028945 Ga0501073_0028945_1390_1818 142
495 3300049589 Ga0501073_0080656 Ga0501073_0080656_67_495 142
496 3300049590 Ga0501074_0067503 Ga0501074_0067503_1953_2381 142
497 3300049591 Ga0501075_0006371 Ga0501075_0006371_6017_6445 142
498 3300049592 Ga0501076_0082269 Ga0501076_0082269_1806_2234 142
499 3300049592 Ga0501076_0160903 Ga0501076_0160903_866_1294 142
500 3300049593 Ga0501077_0042260 Ga0501077_0042260_352_780 142
501 3300049741 Ga0501079_0033421 Ga0501079_0033421_734_1162 142
502 3300049742 Ga0501080_0016690 Ga0501080_0016690_4574_5002 142
503 3300049742 Ga0501080_0276183 Ga0501080_0276183_367_795 142
504 3300049743 Ga0501081_0041085 Ga0501081_0041085_740_1168 142
505 3300049822 Ga0501035_0017998 Ga0501035_0017998_3582_4010 142
506 3300049823 Ga0501044_0043013 Ga0501044_0043013_2130_2558 142
507 3300049824 Ga0501045_0445588 Ga0501045_0445588_84_512 142
508 3300050507 nmdc:mga05p37_209785_c1 nmdc:mga05p37_209785_c1_223_654 142
509 3300050507 nmdc:mga05p37_916190_c1 nmdc:mga05p37_916190_c1_133_561 142
510 3300050508 nmdc:mga09592_114852_c1 nmdc:mga09592_114852_c1_875_1303 142
511 3300050508 nmdc:mga09592_273690_c1 nmdc:mga09592_273690_c1_236_667 142
512 3300050508 nmdc:mga09592_284269_c1 nmdc:mga09592_284269_c1_891_1319 142
513 3300050508 nmdc:mga09592_347831_c1 nmdc:mga09592_347831_c1_774_1202 142
514 3300050509 nmdc:mga0qj67_185092_c1 nmdc:mga0qj67_185092_c1_1150_1581 142
515 3300050509 nmdc:mga0qj67_3864_c1 nmdc:mga0qj67_3864_c1_4907_5338 142
516 3300050510 nmdc:mga06r32_117975_c1 nmdc:mga06r32_117975_c1_1283_1714 142
517 3300050510 nmdc:mga06r32_46293_c1 nmdc:mga06r32_46293_c1_3377_3808 142
518 3300050510 nmdc:mga06r32_534471_c1 nmdc:mga06r32_534471_c1_55_483 142
519 3300050510 nmdc:mga06r32_64504_c1 nmdc:mga06r32_64504_c1_1280_1708 142
520 3300050510 nmdc:mga06r32_92012_c1 nmdc:mga06r32_92012_c1_75_503 142
521 3300050511 nmdc:mga08y16_157573_c1 nmdc:mga08y16_157573_c1_1772_2200 142
522 3300050511 nmdc:mga08y16_363509_c1 nmdc:mga08y16_363509_c1_381_812 142
523 3300050511 nmdc:mga08y16_736736_c1 nmdc:mga08y16_736736_c1_331_759 142
524 3300050512 nmdc:mga0n895_1522552_c1 nmdc:mga0n895_1522552_c1_44_472 142
525 3300053079 Ga0500610_0454064 Ga0500610_0454064_44_472 142
526 3300053088 Ga0500644_0016504 Ga0500644_0016504_179_610 142
527 3300053092 Ga0500583_0011885 Ga0500583_0011885_501_929 142
528 3300053099 Ga0500654_168831 Ga0500654_168831_156_584 142
529 3300053108 Ga0500562_000033 Ga0500562_000033_21831_22262 142
530 3300053108 Ga0500562_127286 Ga0500562_127286_29_457 142
531 3300053118 Ga0500594_0073161 Ga0500594_0073161_474_905 142
532 3300053139 Ga0500568_0021082 Ga0500568_0021082_873_1301 142
533 3300053139 Ga0500568_0056455 Ga0500568_0056455_479_907 142
534 3300053139 Ga0500568_0222447 Ga0500568_0222447_29_457 142
535 3300053147 Ga0500589_144486 Ga0500589_144486_70_498 142
536 3300053153 Ga0500616_0042300 Ga0500616_0042300_1333_1761 142
537 3300053153 Ga0500616_0191690 Ga0500616_0191690_434_862 142
538 3300053156 Ga0500622_0002345 Ga0500622_0002345_6111_6539 142
539 3300053156 Ga0500622_0003964 Ga0500622_0003964_2961_3404 142
540 3300053156 Ga0500622_0004622 Ga0500622_0004622_3371_3799 142
541 3300053178 Ga0500637_0050333 Ga0500637_0050333_1218_1646 142
542 3300054114 Ga0501084_0061838 Ga0501084_0061838_2051_2479 142
543 3300054114 Ga0501084_0675890 Ga0501084_0675890_384_812 142
544 3300055283 Ga0500661_003241 Ga0500661_003241_2205_2636 142
545 3300060353 Ga0501082_0028417 Ga0501082_0028417_4160_4588 142
546 3300060353 Ga0501082_0030265 Ga0501082_0030265_1924_2352 142
547 3300060353 Ga0501082_0168989 Ga0501082_0168989_793_1221 142
548 3300061734 Ga0530510_0336796 Ga0530510_0336796_143_571 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

75

133

0.94

PF00571

CBS

CBS domain

13

64

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fry-assembly1.cif.gz_A the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 0.9645 2 129
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.962 2 126
3fhm-assembly2.cif.gz_B crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9502 2 124
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.948 1 126
3fhm-assembly2.cif.gz_C crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9446 3 124
ID Description Score Start End Superfamily
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9645 2 129 3.10.580.10
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.963 2 142 3.10.580.10
af_O13965_237_391_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9587 2 125 3.10.580.10
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9564 2 142 3.10.580.10
af_A0A1D6Q1S7_52_188_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.956 3 123 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A7C4BV57-F1-model_v4 CBS domain-containing protein 0.9898 2 131
AF-A0A7W7YAX3-F1-model_v4 CBS domain-containing protein 0.9884 2 122
AF-A0A838FTB4-F1-model_v4 CBS domain-containing protein 0.9861 2 130
AF-A0A7V7DYX7-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9858 1 130 GO:0016772
AF-T1B6V4-F1-model_v4 Signal-transduction protein with CBS domain protein 0.9842 1 117

Feature Viewer

pLDDT pTM Quality
94.97 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map