F462199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 548 | 332 | 542 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100890552|Ga0070706_1008905521 |
| Length | 164 |
| Sequence | MKFTDSVDLILKQKPGNVWSISPEQSVYEAIQEMAEKQVGALLVIKERALVGIISERDYARKVILMGRSSKNTQVNEIMTSPVVYVTLTNTLDECMALMTEHRIRHLPVMQGQKGQEVVGILSVGDLVKWIISAQEATIRHLEHYITGTPSELVTAHRGPGSGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 6 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 7 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 8 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 112 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 193 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 197 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 211 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 212 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 213 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 217 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 220 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 221 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 223 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 224 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 225 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 226 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 227 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 228 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 229 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 230 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 231 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 234 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 261 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 300 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 302 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 304 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 309 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 312 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.59 |
| Metatranscriptomes | 11.31 |
| Isolates | 1.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.47 |
| Nodule | 0.18 |
| Rhizoplane | 2.92 |
| Rhizosphere | 91.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_975409 | 2162886007 | Unclassified | 2605 |
| 2 | MRS1b_contig_8124326 | 2162886011 | Unclassified | 2337 |
| 3 | JGI24749J21850_1051909 | 3300002076 | Unclassified | 613 |
| 4 | JGI25405J52794_10048972 | 3300003911 | Bacteria | 903 |
| 5 | Ga0058863_11560427 | 3300004799 | Bacteria | 807 |
| 6 | Ga0058863_11906289 | 3300004799 | Bacteria | 822 |
| 7 | Ga0058861_10005562 | 3300004800 | Unclassified | 851 |
| 8 | Ga0058861_10019033 | 3300004800 | Bacteria | 1119 |
| 9 | Ga0058861_11584140 | 3300004800 | Unclassified | 595 |
| 10 | Ga0058861_12059346 | 3300004800 | Unclassified | 635 |
| 11 | Ga0058860_11534087 | 3300004801 | Unclassified | 529 |
| 12 | Ga0058862_10006799 | 3300004803 | Unclassified | 565 |
| 13 | Ga0058862_10013143 | 3300004803 | Bacteria | 754 |
| 14 | Ga0058862_10086714 | 3300004803 | Bacteria | 788 |
| 15 | Ga0058862_12368229 | 3300004803 | Unclassified | 688 |
| 16 | Ga0065712_10000676 | 3300005290 | Bacteria | 20109 |
| 17 | Ga0065715_10002561 | 3300005293 | Bacteria | 4669 |
| 18 | Ga0065707_10083877 | 3300005295 | Bacteria | 8060 |
| 19 | Ga0065707_10157251 | 3300005295 | Bacteria | 1597 |
| 20 | Ga0065707_10834947 | 3300005295 | Bacteria | 587 |
| 21 | Ga0070658_10630277 | 3300005327 | Bacteria | 930 |
| 22 | Ga0070658_11004615 | 3300005327 | Unclassified | 726 |
| 23 | Ga0070676_10010484 | 3300005328 | Bacteria | 5030 |
| 24 | Ga0070676_10317201 | 3300005328 | Bacteria | 1062 |
| 25 | Ga0070683_100240127 | 3300005329 | Bacteria | 1723 |
| 26 | Ga0070690_100437048 | 3300005330 | Unclassified | 968 |
| 27 | Ga0070670_100004678 | 3300005331 | Bacteria | 11478 |
| 28 | Ga0070670_100199823 | 3300005331 | Bacteria | 1737 |
| 29 | Ga0070670_101179778 | 3300005331 | Unclassified | 699 |
| 30 | Ga0070677_10293776 | 3300005333 | Unclassified | 823 |
| 31 | Ga0068869_100970778 | 3300005334 | Unclassified | 738 |
| 32 | Ga0070680_100068243 | 3300005336 | Unclassified | 2918 |
| 33 | Ga0070680_100224295 | 3300005336 | Bacteria | 1586 |
| 34 | Ga0070680_101574566 | 3300005336 | Bacteria | 569 |
| 35 | Ga0070682_101714201 | 3300005337 | Unclassified | 546 |
| 36 | Ga0068868_100812565 | 3300005338 | Bacteria | 844 |
| 37 | Ga0068868_100983754 | 3300005338 | Unclassified | 771 |
| 38 | Ga0070691_10071163 | 3300005341 | Bacteria | 1688 |
| 39 | Ga0070661_100575211 | 3300005344 | Bacteria | 909 |
| 40 | Ga0070692_10157251 | 3300005345 | Bacteria | 1299 |
| 41 | Ga0070668_100063770 | 3300005347 | Bacteria | 2856 |
| 42 | Ga0070668_100097381 | 3300005347 | Bacteria | 2326 |
| 43 | Ga0070668_100106265 | 3300005347 | Bacteria | 2230 |
| 44 | Ga0070668_100432869 | 3300005347 | Bacteria | 1128 |
| 45 | Ga0070669_100030601 | 3300005353 | Bacteria | 3885 |
| 46 | Ga0070669_100207557 | 3300005353 | Bacteria | 1544 |
| 47 | Ga0070675_100024043 | 3300005354 | Bacteria | 4877 |
| 48 | Ga0070671_100697594 | 3300005355 | Unclassified | 880 |
| 49 | Ga0070674_100059987 | 3300005356 | Bacteria | 2650 |
| 50 | Ga0070673_100113317 | 3300005364 | Unclassified | 2252 |
| 51 | Ga0070673_100595282 | 3300005364 | Bacteria | 1008 |
| 52 | Ga0070688_100000341 | 3300005365 | Bacteria | 23817 |
| 53 | Ga0070659_100092857 | 3300005366 | Bacteria | 2421 |
| 54 | Ga0070667_100069926 | 3300005367 | Bacteria | 2987 |
| 55 | Ga0070709_10867111 | 3300005434 | Bacteria | 712 |
| 56 | Ga0070714_100907904 | 3300005435 | Unclassified | 855 |
| 57 | Ga0070713_100009620 | 3300005436 | Bacteria | 6937 |
| 58 | Ga0070713_100094102 | 3300005436 | Bacteria | 2582 |
| 59 | Ga0070713_100831828 | 3300005436 | Bacteria | 886 |
| 60 | Ga0070701_10224366 | 3300005438 | Bacteria | 1122 |
| 61 | Ga0070701_11020721 | 3300005438 | Bacteria | 578 |
| 62 | Ga0070711_100292340 | 3300005439 | Unclassified | 1293 |
| 63 | Ga0070694_100034090 | 3300005444 | Bacteria | 3355 |
| 64 | Ga0070663_100021366 | 3300005455 | Bacteria | 4304 |
| 65 | Ga0070663_100428518 | 3300005455 | Bacteria | 1086 |
| 66 | Ga0070678_100227194 | 3300005456 | Bacteria | 1554 |
| 67 | Ga0070678_100532010 | 3300005456 | Bacteria | 1041 |
| 68 | Ga0070678_100618041 | 3300005456 | Bacteria | 969 |
| 69 | Ga0070662_100010273 | 3300005457 | Bacteria | 6137 |
| 70 | Ga0070662_100014291 | 3300005457 | Bacteria | 5301 |
| 71 | Ga0070662_100208496 | 3300005457 | Bacteria | 1554 |
| 72 | Ga0070681_10926054 | 3300005458 | Bacteria | 790 |
| 73 | Ga0068867_100010417 | 3300005459 | Bacteria | 6561 |
| 74 | Ga0070685_10369240 | 3300005466 | Unclassified | 985 |
| 75 | Ga0070706_100532570 | 3300005467 | Unclassified | 1093 |
| 76 | Ga0070706_100890552 | 3300005467 | Bacteria | 822 |
| 77 | Ga0070698_100368703 | 3300005471 | Unclassified | 1368 |
| 78 | Ga0070679_100276021 | 3300005530 | Bacteria | 1634 |
| 79 | Ga0070679_101344822 | 3300005530 | Unclassified | 660 |
| 80 | Ga0070697_100635832 | 3300005536 | Bacteria | 939 |
| 81 | Ga0068853_100000762 | 3300005539 | Bacteria | 22338 |
| 82 | Ga0068853_100000975 | 3300005539 | Bacteria | 20135 |
| 83 | Ga0068853_100123692 | 3300005539 | Bacteria | 2310 |
| 84 | Ga0068853_100343267 | 3300005539 | Unclassified | 1388 |
| 85 | Ga0070672_100000775 | 3300005543 | Bacteria | 19031 |
| 86 | Ga0070672_100451828 | 3300005543 | Unclassified | 1107 |
| 87 | Ga0070686_100431732 | 3300005544 | Unclassified | 1009 |
| 88 | Ga0070693_100722774 | 3300005547 | Unclassified | 731 |
| 89 | Ga0070665_100004227 | 3300005548 | Bacteria | 15114 |
| 90 | Ga0070665_100050891 | 3300005548 | Bacteria | 4157 |
| 91 | Ga0070704_100107970 | 3300005549 | Bacteria | 2112 |
| 92 | Ga0070704_100492752 | 3300005549 | Unclassified | 1062 |
| 93 | Ga0068855_100006801 | 3300005563 | Bacteria | 13871 |
| 94 | Ga0068855_100096416 | 3300005563 | Bacteria | 3407 |
| 95 | Ga0068855_100742650 | 3300005563 | Bacteria | 1047 |
| 96 | Ga0068857_101556843 | 3300005577 | Bacteria | 645 |
| 97 | Ga0068857_102239616 | 3300005577 | Unclassified | 536 |
| 98 | Ga0068856_100039388 | 3300005614 | Bacteria | 4640 |
| 99 | Ga0070702_100256889 | 3300005615 | Unclassified | 1187 |
| 100 | Ga0068852_100708746 | 3300005616 | Bacteria | 1017 |
| 101 | Ga0068864_100003339 | 3300005618 | Bacteria | 13267 |
| 102 | Ga0068866_10010001 | 3300005718 | Bacteria | 4051 |
| 103 | Ga0068866_10030257 | 3300005718 | Bacteria | 2597 |
| 104 | Ga0068861_100000924 | 3300005719 | Bacteria | 17839 |
| 105 | Ga0068861_100370490 | 3300005719 | Unclassified | 1262 |
| 106 | Ga0068861_100496088 | 3300005719 | Bacteria | 1103 |
| 107 | Ga0068851_10194597 | 3300005834 | Bacteria | 1129 |
| 108 | Ga0068870_10272159 | 3300005840 | Unclassified | 1058 |
| 109 | Ga0068863_100018888 | 3300005841 | Bacteria | 6596 |
| 110 | Ga0068863_100120870 | 3300005841 | Bacteria | 2497 |
| 111 | Ga0068862_100011962 | 3300005844 | Bacteria | 7167 |
| 112 | Ga0068862_100021863 | 3300005844 | Bacteria | 5349 |
| 113 | Ga0081455_10006436 | 3300005937 | Bacteria | 12590 |
| 114 | Ga0081540_1040780 | 3300005983 | Bacteria | 2415 |
| 115 | Ga0070717_10265681 | 3300006028 | Unclassified | 1519 |
| 116 | Ga0070717_10670210 | 3300006028 | Unclassified | 942 |
| 117 | Ga0070716_100017128 | 3300006173 | Bacteria | 3752 |
| 118 | Ga0070716_100035731 | 3300006173 | Bacteria | 2734 |
| 119 | Ga0070712_100004652 | 3300006175 | Bacteria | 8486 |
| 120 | Ga0070712_100537675 | 3300006175 | Unclassified | 983 |
| 121 | Ga0097621_100361887 | 3300006237 | Bacteria | 1292 |
| 122 | Ga0068871_100636493 | 3300006358 | Unclassified | 973 |
| 123 | Ga0068871_101269525 | 3300006358 | Bacteria | 692 |
| 124 | Ga0075428_100006966 | 3300006844 | Bacteria | 12541 |
| 125 | Ga0075428_100028202 | 3300006844 | Bacteria | 6209 |
| 126 | Ga0075428_100293264 | 3300006844 | Bacteria | 1749 |
| 127 | Ga0075430_100097518 | 3300006846 | Bacteria | 2456 |
| 128 | Ga0075430_100440814 | 3300006846 | Bacteria | 1075 |
| 129 | Ga0075431_100031192 | 3300006847 | Bacteria | 5490 |
| 130 | Ga0075431_100106629 | 3300006847 | Bacteria | 2891 |
| 131 | Ga0075431_100528486 | 3300006847 | Bacteria | 1168 |
| 132 | Ga0075431_101731254 | 3300006847 | Unclassified | 582 |
| 133 | Ga0075434_100307384 | 3300006871 | Bacteria | 1606 |
| 134 | Ga0075429_100056506 | 3300006880 | Bacteria | 3416 |
| 135 | Ga0075429_100062203 | 3300006880 | Bacteria | 3252 |
| 136 | Ga0075429_100281391 | 3300006880 | Bacteria | 1457 |
| 137 | Ga0099826_10119588 | 3300006948 | Bacteria | 1554 |
| 138 | Ga0111539_10016185 | 3300009094 | Bacteria | 9252 |
| 139 | Ga0111539_10020676 | 3300009094 | Bacteria | 8107 |
| 140 | Ga0111539_10822873 | 3300009094 | Bacteria | 1080 |
| 141 | Ga0105247_10089674 | 3300009101 | Bacteria | 1950 |
| 142 | Ga0114129_10103116 | 3300009147 | Bacteria | 3944 |
| 143 | Ga0114129_10995028 | 3300009147 | Unclassified | 1056 |
| 144 | Ga0105243_10193043 | 3300009148 | Bacteria | 1780 |
| 145 | Ga0105241_10489399 | 3300009174 | Bacteria | 1095 |
| 146 | Ga0105241_11327529 | 3300009174 | Bacteria | 686 |
| 147 | Ga0105242_10184493 | 3300009176 | Bacteria | 1843 |
| 148 | Ga0105242_10184628 | 3300009176 | Bacteria | 1842 |
| 149 | Ga0105242_10526519 | 3300009176 | Unclassified | 1129 |
| 150 | Ga0105248_10702498 | 3300009177 | Unclassified | 1141 |
| 151 | Ga0105249_10026809 | 3300009553 | Bacteria | 5197 |
| 152 | Ga0105249_10070843 | 3300009553 | Bacteria | 3219 |
| 153 | Ga0105239_10225453 | 3300010375 | Bacteria | 2102 |
| 154 | Ga0105239_10559662 | 3300010375 | Bacteria | 1302 |
| 155 | Ga0105246_10356906 | 3300011119 | Unclassified | 1200 |
| 156 | Ga0157373_10552153 | 3300013100 | Bacteria | 835 |
| 157 | Ga0157369_11688253 | 3300013105 | Unclassified | 644 |
| 158 | Ga0157374_11178779 | 3300013296 | Unclassified | 787 |
| 159 | Ga0157378_10778675 | 3300013297 | Unclassified | 981 |
| 160 | Ga0163162_10298910 | 3300013306 | Bacteria | 1742 |
| 161 | Ga0163162_11537856 | 3300013306 | Bacteria | 758 |
| 162 | Ga0163162_12186199 | 3300013306 | Unclassified | 635 |
| 163 | Ga0157372_10597414 | 3300013307 | Bacteria | 1286 |
| 164 | Ga0157375_10048802 | 3300013308 | Bacteria | 4143 |
| 165 | Ga0157375_10375905 | 3300013308 | Unclassified | 1587 |
| 166 | Ga0157375_10532936 | 3300013308 | Bacteria | 1337 |
| 167 | Ga0163163_10083888 | 3300014325 | Bacteria | 3192 |
| 168 | Ga0163163_10362858 | 3300014325 | Bacteria | 1505 |
| 169 | Ga0163163_12109898 | 3300014325 | Bacteria | 623 |
| 170 | Ga0157380_10004477 | 3300014326 | Bacteria | 9682 |
| 171 | Ga0157380_10021556 | 3300014326 | Bacteria | 4834 |
| 172 | Ga0157380_11909195 | 3300014326 | Bacteria | 654 |
| 173 | Ga0182007_10143692 | 3300015262 | Unclassified | 808 |
| 174 | Ga0163161_10436326 | 3300017792 | Bacteria | 1056 |
| 175 | Ga0197907_10309475 | 3300020069 | Bacteria | 631 |
| 176 | Ga0197907_10481651 | 3300020069 | Bacteria | 1002 |
| 177 | Ga0197907_11305640 | 3300020069 | Unclassified | 922 |
| 178 | Ga0197907_11314326 | 3300020069 | Viruses | 887 |
| 179 | Ga0206356_10394661 | 3300020070 | Unclassified | 868 |
| 180 | Ga0206356_10506610 | 3300020070 | Bacteria | 684 |
| 181 | Ga0206356_10675169 | 3300020070 | Bacteria | 765 |
| 182 | Ga0206356_11895739 | 3300020070 | Viruses | 904 |
| 183 | Ga0206349_1894552 | 3300020075 | Bacteria | 643 |
| 184 | Ga0206349_1954048 | 3300020075 | Unclassified | 1346 |
| 185 | Ga0206355_1475349 | 3300020076 | Unclassified | 804 |
| 186 | Ga0206355_1678219 | 3300020076 | Bacteria | 946 |
| 187 | Ga0206351_10459302 | 3300020077 | Bacteria | 1049 |
| 188 | Ga0206351_10483349 | 3300020077 | Unclassified | 841 |
| 189 | Ga0206351_10672749 | 3300020077 | Unclassified | 973 |
| 190 | Ga0206352_10226561 | 3300020078 | Unclassified | 777 |
| 191 | Ga0206352_10909166 | 3300020078 | Bacteria | 2287 |
| 192 | Ga0206350_10195778 | 3300020080 | Unclassified | 1213 |
| 193 | Ga0206350_10421805 | 3300020080 | Viruses | 1115 |
| 194 | Ga0206350_10458104 | 3300020080 | Unclassified | 727 |
| 195 | Ga0206353_10550515 | 3300020082 | Bacteria | 673 |
| 196 | Ga0206353_11078394 | 3300020082 | Unclassified | 910 |
| 197 | Ga0206353_11677454 | 3300020082 | Unclassified | 734 |
| 198 | Ga0154015_1459979 | 3300020610 | Unclassified | 854 |
| 199 | Ga0224712_10061048 | 3300022467 | Viruses | 1502 |
| 200 | Ga0224712_10103935 | 3300022467 | Bacteria | 1209 |
| 201 | Ga0224712_10265370 | 3300022467 | Unclassified | 796 |
| 202 | Ga0209051_1018121 | 3300025303 | Bacteria | 3124 |
| 203 | Ga0207642_10353122 | 3300025899 | Bacteria | 868 |
| 204 | Ga0207699_10208510 | 3300025906 | Unclassified | 1328 |
| 205 | Ga0207645_10000790 | 3300025907 | Bacteria | 26451 |
| 206 | Ga0207643_10235253 | 3300025908 | Unclassified | 1125 |
| 207 | Ga0207684_10406901 | 3300025910 | Unclassified | 1170 |
| 208 | Ga0207654_10415312 | 3300025911 | Bacteria | 938 |
| 209 | Ga0207671_10184654 | 3300025914 | Bacteria | 1624 |
| 210 | Ga0207693_10110348 | 3300025915 | Unclassified | 2157 |
| 211 | Ga0207663_10059060 | 3300025916 | Unclassified | 2424 |
| 212 | Ga0207663_10857977 | 3300025916 | Unclassified | 725 |
| 213 | Ga0207660_10175300 | 3300025917 | Bacteria | 1662 |
| 214 | Ga0207662_10040975 | 3300025918 | Bacteria | 2725 |
| 215 | Ga0207657_10689408 | 3300025919 | Bacteria | 794 |
| 216 | Ga0207649_10711473 | 3300025920 | Bacteria | 779 |
| 217 | Ga0207652_10123016 | 3300025921 | Bacteria | 2310 |
| 218 | Ga0207652_11286815 | 3300025921 | Bacteria | 634 |
| 219 | Ga0207681_10029737 | 3300025923 | Bacteria | 3553 |
| 220 | Ga0207650_10034198 | 3300025925 | Bacteria | 3685 |
| 221 | Ga0207650_10080575 | 3300025925 | Bacteria | 2468 |
| 222 | Ga0207659_10384229 | 3300025926 | Unclassified | 1171 |
| 223 | Ga0207700_10025152 | 3300025928 | Bacteria | 4131 |
| 224 | Ga0207700_10065230 | 3300025928 | Unclassified | 2777 |
| 225 | Ga0207690_10023046 | 3300025932 | Bacteria | 3882 |
| 226 | Ga0207706_10000586 | 3300025933 | Bacteria | 38762 |
| 227 | Ga0207706_10004219 | 3300025933 | Bacteria | 13535 |
| 228 | Ga0207706_10093108 | 3300025933 | Bacteria | 2650 |
| 229 | Ga0207686_10248278 | 3300025934 | Bacteria | 1299 |
| 230 | Ga0207704_10129624 | 3300025938 | Bacteria | 1744 |
| 231 | Ga0207704_10728054 | 3300025938 | Bacteria | 823 |
| 232 | Ga0207665_10030972 | 3300025939 | Bacteria | 3539 |
| 233 | Ga0207691_10000872 | 3300025940 | Bacteria | 30019 |
| 234 | Ga0207691_10235538 | 3300025940 | Unclassified | 1584 |
| 235 | Ga0207711_10558283 | 3300025941 | Unclassified | 1068 |
| 236 | Ga0207689_10237986 | 3300025942 | Bacteria | 1505 |
| 237 | Ga0207679_11353717 | 3300025945 | Bacteria | 653 |
| 238 | Ga0207667_10028581 | 3300025949 | Bacteria | 6055 |
| 239 | Ga0207667_10246160 | 3300025949 | Bacteria | 1829 |
| 240 | Ga0207667_10306046 | 3300025949 | Bacteria | 1624 |
| 241 | Ga0207712_10458037 | 3300025961 | Unclassified | 1083 |
| 242 | Ga0207668_10030913 | 3300025972 | Bacteria | 3523 |
| 243 | Ga0207668_10053567 | 3300025972 | Bacteria | 2797 |
| 244 | Ga0207668_10294405 | 3300025972 | Bacteria | 1337 |
| 245 | Ga0207668_11066804 | 3300025972 | Bacteria | 723 |
| 246 | Ga0207640_10071376 | 3300025981 | Bacteria | 2339 |
| 247 | Ga0207640_11232687 | 3300025981 | Bacteria | 666 |
| 248 | Ga0207658_10064384 | 3300025986 | Bacteria | 2750 |
| 249 | Ga0207658_10128208 | 3300025986 | Bacteria | 2034 |
| 250 | Ga0207658_10483776 | 3300025986 | Unclassified | 1100 |
| 251 | Ga0207639_10000657 | 3300026041 | Bacteria | 23785 |
| 252 | Ga0207639_10003833 | 3300026041 | Bacteria | 10134 |
| 253 | Ga0207639_10256944 | 3300026041 | Bacteria | 1526 |
| 254 | Ga0207678_10042014 | 3300026067 | Bacteria | 3963 |
| 255 | Ga0207708_10041283 | 3300026075 | Bacteria | 3517 |
| 256 | Ga0207708_10187929 | 3300026075 | Bacteria | 1643 |
| 257 | Ga0207708_10198820 | 3300026075 | Bacteria | 1598 |
| 258 | Ga0207702_10058560 | 3300026078 | Bacteria | 3278 |
| 259 | Ga0207641_10140102 | 3300026088 | Bacteria | 2181 |
| 260 | Ga0207648_10000544 | 3300026089 | Bacteria | 42055 |
| 261 | Ga0207648_10086707 | 3300026089 | Unclassified | 2732 |
| 262 | Ga0207676_10030598 | 3300026095 | Bacteria | 4042 |
| 263 | Ga0207674_10196433 | 3300026116 | Bacteria | 1967 |
| 264 | Ga0207674_11443649 | 3300026116 | Bacteria | 657 |
| 265 | Ga0207675_100001615 | 3300026118 | Bacteria | 22586 |
| 266 | Ga0207675_100005250 | 3300026118 | Bacteria | 12468 |
| 267 | Ga0207675_100030331 | 3300026118 | Bacteria | 5036 |
| 268 | Ga0207675_100158259 | 3300026118 | Unclassified | 2159 |
| 269 | Ga0207675_100539425 | 3300026118 | Bacteria | 1165 |
| 270 | Ga0207683_10269776 | 3300026121 | Bacteria | 1554 |
| 271 | Ga0207683_10406873 | 3300026121 | Bacteria | 1252 |
| 272 | Ga0207698_10196466 | 3300026142 | Bacteria | 1803 |
| 273 | Ga0207698_11160280 | 3300026142 | Bacteria | 786 |
| 274 | Ga0209967_1004350 | 3300027364 | Bacteria | 1880 |
| 275 | Ga0209968_1014555 | 3300027526 | Bacteria | 1239 |
| 276 | Ga0209999_1003307 | 3300027543 | Bacteria | 2876 |
| 277 | Ga0209970_1005977 | 3300027614 | Bacteria | 1997 |
| 278 | Ga0210002_1017166 | 3300027617 | Bacteria | 1150 |
| 279 | Ga0209971_1000749 | 3300027682 | Bacteria | 8370 |
| 280 | Ga0209966_1003407 | 3300027695 | Bacteria | 2673 |
| 281 | Ga0209998_10004905 | 3300027717 | Bacteria | 2816 |
| 282 | Ga0209974_10000879 | 3300027876 | Bacteria | 10426 |
| 283 | Ga0207428_10365186 | 3300027907 | Bacteria | 1061 |
| 284 | Ga0207428_10590103 | 3300027907 | Bacteria | 801 |
| 285 | Ga0268266_10024952 | 3300028379 | Bacteria | 5087 |
| 286 | Ga0268266_10084991 | 3300028379 | Bacteria | 2764 |
| 287 | Ga0268265_10008849 | 3300028380 | Bacteria | 6804 |
| 288 | Ga0268265_10018036 | 3300028380 | Bacteria | 4886 |
| 289 | Ga0265334_10001494 | 3300028573 | Bacteria | 11284 |
| 290 | Ga0265318_10006068 | 3300028577 | Bacteria | 5599 |
| 291 | Ga0265338_10007423 | 3300028800 | Bacteria | 13605 |
| 292 | Ga0265338_10056298 | 3300028800 | Bacteria | 3488 |
| 293 | Ga0265324_10013594 | 3300029957 | Bacteria | 3031 |
| 294 | Ga0265330_10006083 | 3300031235 | Bacteria | 5979 |
| 295 | Ga0265332_10017482 | 3300031238 | Bacteria | 3165 |
| 296 | Ga0265328_10000585 | 3300031239 | Bacteria | 16880 |
| 297 | Ga0265328_10047118 | 3300031239 | Bacteria | 1584 |
| 298 | Ga0265320_10041365 | 3300031240 | Bacteria | 2291 |
| 299 | Ga0265325_10003461 | 3300031241 | Bacteria | 10299 |
| 300 | Ga0265329_10025194 | 3300031242 | Bacteria | 1970 |
| 301 | Ga0265340_10037163 | 3300031247 | Bacteria | 2413 |
| 302 | Ga0265339_10019067 | 3300031249 | Bacteria | 4032 |
| 303 | Ga0265339_10131736 | 3300031249 | Bacteria | 1278 |
| 304 | Ga0265331_10000065 | 3300031250 | Bacteria | 164724 |
| 305 | Ga0265331_10002811 | 3300031250 | Bacteria | 11539 |
| 306 | Ga0265331_10046620 | 3300031250 | Bacteria | 2088 |
| 307 | Ga0265327_10000123 | 3300031251 | Bacteria | 169532 |
| 308 | Ga0265327_10022091 | 3300031251 | Bacteria | 3818 |
| 309 | Ga0265316_10026444 | 3300031344 | Bacteria | 4826 |
| 310 | Ga0265316_10039529 | 3300031344 | Bacteria | 3788 |
| 311 | Ga0265316_10291822 | 3300031344 | Bacteria | 1190 |
| 312 | Ga0307509_10179837 | 3300031507 | Bacteria | 1982 |
| 313 | Ga0307408_100072024 | 3300031548 | Bacteria | 2557 |
| 314 | Ga0265313_10011808 | 3300031595 | Bacteria | 5400 |
| 315 | Ga0316575_10002443 | 3300031665 | Bacteria | 6236 |
| 316 | Ga0316579_10068379 | 3300031691 | Bacteria | 1680 |
| 317 | Ga0316579_10277867 | 3300031691 | Bacteria | 810 |
| 318 | Ga0265314_10007342 | 3300031711 | Bacteria | 9567 |
| 319 | Ga0265342_10055546 | 3300031712 | Bacteria | 2350 |
| 320 | Ga0316576_10245211 | 3300031727 | Bacteria | 1345 |
| 321 | Ga0316576_10468625 | 3300031727 | Unclassified | 929 |
| 322 | Ga0316578_10052983 | 3300031728 | Bacteria | 2377 |
| 323 | Ga0307405_11085284 | 3300031731 | Bacteria | 687 |
| 324 | Ga0307405_11424633 | 3300031731 | Bacteria | 607 |
| 325 | Ga0316577_10057893 | 3300031733 | Bacteria | 2163 |
| 326 | Ga0307413_10026221 | 3300031824 | Bacteria | 3209 |
| 327 | Ga0307413_10172904 | 3300031824 | Bacteria | 1531 |
| 328 | Ga0307410_10153496 | 3300031852 | Bacteria | 1717 |
| 329 | Ga0307410_10976166 | 3300031852 | Bacteria | 729 |
| 330 | Ga0307406_10059362 | 3300031901 | Bacteria | 2462 |
| 331 | Ga0307407_10968748 | 3300031903 | Bacteria | 656 |
| 332 | Ga0307412_10584315 | 3300031911 | Bacteria | 943 |
| 333 | Ga0307412_10705395 | 3300031911 | Bacteria | 866 |
| 334 | Ga0307409_100215727 | 3300031995 | Bacteria | 1728 |
| 335 | Ga0307416_100120789 | 3300032002 | Bacteria | 2334 |
| 336 | Ga0307416_100293929 | 3300032002 | Bacteria | 1610 |
| 337 | Ga0307416_100465755 | 3300032002 | Bacteria | 1320 |
| 338 | Ga0307416_100980025 | 3300032002 | Bacteria | 948 |
| 339 | Ga0307414_11684778 | 3300032004 | Bacteria | 591 |
| 340 | Ga0307411_10056689 | 3300032005 | Bacteria | 2584 |
| 341 | Ga0307411_11130923 | 3300032005 | Bacteria | 707 |
| 342 | Ga0307415_100070741 | 3300032126 | Bacteria | 2451 |
| 343 | Ga0307415_100142688 | 3300032126 | Bacteria | 1832 |
| 344 | Ga0316583_10295778 | 3300032133 | Bacteria | 560 |
| 345 | Ga0316585_10028006 | 3300032137 | Bacteria | 1761 |
| 346 | Ga0316580_10011023 | 3300032139 | Bacteria | 2739 |
| 347 | Ga0373946_0045631 | 3300035171 | Bacteria | 1814 |
| 348 | Ga0316574_0000470 | 3300035398 | Bacteria | 16292 |
| 349 | Ga0316574_0165276 | 3300035398 | Bacteria | 1425 |
| 350 | Ga0373947_0051879 | 3300035725 | Unclassified | 2469 |
| 351 | Ga0316582_0001306 | 3300036647 | Bacteria | 10788 |
| 352 | Ga0316582_0065153 | 3300036647 | Unclassified | 2345 |
| 353 | Ga0316582_0854790 | 3300036647 | Unclassified | 623 |
| 354 | Ga0316584_0006760 | 3300036712 | Bacteria | 7780 |
| 355 | Ga0316584_0387305 | 3300036712 | Bacteria | 998 |
| 356 | Ga0373925_0021595 | 3300037068 | Unclassified | 4692 |
| 357 | Ga0400490_60992 | 3300038726 | Plasmid | 3472 |
| 358 | Ga0400488_55436 | 3300038741 | Bacteria | 1834 |
| 359 | Ga0451807_1641010 | 3300041486 | Bacteria | 1325 |
| 360 | Ga0451833_1240965 | 3300041491 | Bacteria | 570 |
| 361 | Ga0451835_0658749 | 3300041492 | Bacteria | 573 |
| 362 | Ga0451841_0183847 | 3300041498 | Bacteria | 884 |
| 363 | Ga0451847_0549916 | 3300041503 | Bacteria | 986 |
| 364 | Ga0451851_0917330 | 3300041507 | Bacteria | 944 |
| 365 | Ga0451853_1060211 | 3300041512 | Bacteria | 1911 |
| 366 | Ga0451853_1956397 | 3300041512 | Bacteria | 740 |
| 367 | Ga0450923_000521 | 3300042125 | Bacteria | 4298 |
| 368 | Ga0450896_005791 | 3300042133 | Bacteria | 1690 |
| 369 | Ga0439460_0019273 | 3300042461 | Bacteria | 1846 |
| 370 | Ga0450893_0009053 | 3300042532 | Bacteria | 1626 |
| 371 | Ga0451577_0002503 | 3300042876 | Bacteria | 21799 |
| 372 | Ga0451577_0813029 | 3300042876 | Unclassified | 844 |
| 373 | Ga0453683_0773639 | 3300044673 | Unclassified | 631 |
| 374 | Ga0466965_0157928 | 3300044683 | Bacteria | 1188 |
| 375 | Ga0453684_0000581 | 3300044712 | Bacteria | 136088 |
| 376 | Ga0453684_0010306 | 3300044712 | Bacteria | 16006 |
| 377 | Ga0453684_0072380 | 3300044712 | Bacteria | 4352 |
| 378 | Ga0453684_0154565 | 3300044712 | Bacteria | 2722 |
| 379 | Ga0453684_0665998 | 3300044712 | Bacteria | 1134 |
| 380 | Ga0453684_0919594 | 3300044712 | Unclassified | 936 |
| 381 | Ga0453684_1599998 | 3300044712 | Unclassified | 669 |
| 382 | Ga0466957_0488259 | 3300044842 | Bacteria | 853 |
| 383 | Ga0451576_0235056 | 3300045051 | Bacteria | 1914 |
| 384 | Ga0451576_0479912 | 3300045051 | Bacteria | 1306 |
| 385 | Ga0466967_0978070 | 3300045976 | Bacteria | 842 |
| 386 | Ga0495629_0047965 | 3300046459 | Bacteria | 2995 |
| 387 | Ga0495638_0009952 | 3300046460 | Bacteria | 6629 |
| 388 | Ga0495638_0020533 | 3300046460 | Bacteria | 4363 |
| 389 | Ga0495580_0002689 | 3300046472 | Bacteria | 15387 |
| 390 | Ga0495580_0010461 | 3300046472 | Bacteria | 7230 |
| 391 | Ga0495580_0017921 | 3300046472 | Bacteria | 5281 |
| 392 | Ga0495582_0006361 | 3300046473 | Bacteria | 6567 |
| 393 | Ga0495586_0291870 | 3300046535 | Bacteria | 934 |
| 394 | Ga0495668_0095532 | 3300046616 | Bacteria | 1627 |
| 395 | Ga0495625_0004733 | 3300046660 | Bacteria | 12745 |
| 396 | Ga0495625_0272752 | 3300046660 | Bacteria | 1091 |
| 397 | Ga0495613_0116569 | 3300046689 | Unclassified | 1921 |
| 398 | Ga0495674_0202994 | 3300047319 | Bacteria | 1644 |
| 399 | Ga0495674_0907076 | 3300047319 | Bacteria | 680 |
| 400 | Ga0495686_0133702 | 3300047472 | Bacteria | 1469 |
| 401 | Ga0495686_0533742 | 3300047472 | Bacteria | 614 |
| 402 | Ga0496101_0130241 | 3300048904 | Unclassified | 1910 |
| 403 | Ga0496104_0031420 | 3300048907 | Bacteria | 4938 |
| 404 | Ga0496104_1116467 | 3300048907 | Unclassified | 692 |
| 405 | Ga0496106_0040094 | 3300048909 | Bacteria | 3506 |
| 406 | Ga0496107_0249814 | 3300048910 | Bacteria | 1320 |
| 407 | Ga0496108_0005390 | 3300048911 | Bacteria | 10339 |
| 408 | Ga0496109_0005268 | 3300048912 | Bacteria | 10803 |
| 409 | Ga0496109_1595980 | 3300048912 | Bacteria | 587 |
| 410 | Ga0496110_0463184 | 3300048913 | Unclassified | 1155 |
| 411 | Ga0496110_0918631 | 3300048913 | Unclassified | 781 |
| 412 | Ga0496111_0515985 | 3300048914 | Unclassified | 879 |
| 413 | Ga0496112_0001381 | 3300048915 | Bacteria | 18527 |
| 414 | Ga0496112_0307382 | 3300048915 | Unclassified | 1531 |
| 415 | Ga0496113_0057849 | 3300048916 | Bacteria | 2915 |
| 416 | Ga0496114_0418507 | 3300048917 | Unclassified | 1187 |
| 417 | Ga0496121_0193920 | 3300048924 | Bacteria | 1454 |
| 418 | Ga0501031_0005224 | 3300049568 | Bacteria | 8462 |
| 419 | Ga0501031_0109242 | 3300049568 | Bacteria | 1806 |
| 420 | Ga0501032_0001719 | 3300049569 | Bacteria | 17319 |
| 421 | Ga0501033_0006165 | 3300049570 | Bacteria | 9401 |
| 422 | Ga0501034_0003806 | 3300049571 | Bacteria | 17014 |
| 423 | Ga0501034_0123201 | 3300049571 | Bacteria | 2578 |
| 424 | Ga0501036_0028440 | 3300049572 | Bacteria | 4724 |
| 425 | Ga0501036_0679887 | 3300049572 | Bacteria | 851 |
| 426 | Ga0501036_0938561 | 3300049572 | Bacteria | 709 |
| 427 | Ga0501037_0001849 | 3300049573 | Bacteria | 15361 |
| 428 | Ga0501037_0272127 | 3300049573 | Bacteria | 1182 |
| 429 | Ga0501037_0785526 | 3300049573 | Bacteria | 629 |
| 430 | Ga0501038_0010417 | 3300049574 | Bacteria | 8501 |
| 431 | Ga0501038_0993482 | 3300049574 | Bacteria | 616 |
| 432 | Ga0501039_0055013 | 3300049575 | Bacteria | 3081 |
| 433 | Ga0501039_0491004 | 3300049575 | Bacteria | 964 |
| 434 | Ga0501040_0013337 | 3300049576 | Bacteria | 5401 |
| 435 | Ga0501040_0078339 | 3300049576 | Bacteria | 2287 |
| 436 | Ga0501041_0059303 | 3300049577 | Bacteria | 2342 |
| 437 | Ga0501041_0818963 | 3300049577 | Bacteria | 597 |
| 438 | Ga0501042_0003484 | 3300049578 | Bacteria | 9891 |
| 439 | Ga0501043_0024125 | 3300049579 | Bacteria | 4772 |
| 440 | Ga0501046_0039267 | 3300049580 | Bacteria | 3792 |
| 441 | Ga0501046_0052981 | 3300049580 | Bacteria | 3196 |
| 442 | Ga0501046_0109126 | 3300049580 | Bacteria | 2116 |
| 443 | Ga0501046_1260325 | 3300049580 | Bacteria | 506 |
| 444 | Ga0501047_0004284 | 3300049581 | Bacteria | 13428 |
| 445 | Ga0501047_0012877 | 3300049581 | Bacteria | 7924 |
| 446 | Ga0501048_0785714 | 3300049582 | Bacteria | 684 |
| 447 | Ga0501067_0363108 | 3300049583 | Bacteria | 807 |
| 448 | Ga0501068_0040096 | 3300049584 | Bacteria | 2810 |
| 449 | Ga0501068_0243405 | 3300049584 | Bacteria | 1145 |
| 450 | Ga0501070_0026300 | 3300049586 | Bacteria | 4884 |
| 451 | Ga0501070_0223234 | 3300049586 | Bacteria | 1545 |
| 452 | Ga0501071_0012726 | 3300049587 | Bacteria | 5720 |
| 453 | Ga0501072_0020521 | 3300049588 | Bacteria | 5121 |
| 454 | Ga0501072_0138106 | 3300049588 | Bacteria | 1944 |
| 455 | Ga0501073_0028945 | 3300049589 | Bacteria | 3958 |
| 456 | Ga0501073_0080656 | 3300049589 | Bacteria | 2263 |
| 457 | Ga0501073_0239141 | 3300049589 | Bacteria | 1254 |
| 458 | Ga0501074_0067503 | 3300049590 | Bacteria | 2572 |
| 459 | Ga0501074_1183195 | 3300049590 | Bacteria | 536 |
| 460 | Ga0501075_0006371 | 3300049591 | Bacteria | 8122 |
| 461 | Ga0501076_0082269 | 3300049592 | Bacteria | 2584 |
| 462 | Ga0501076_0160903 | 3300049592 | Bacteria | 1829 |
| 463 | Ga0501077_0042260 | 3300049593 | Bacteria | 2899 |
| 464 | Ga0501079_0033421 | 3300049741 | Bacteria | 3956 |
| 465 | Ga0501079_0375122 | 3300049741 | Bacteria | 1115 |
| 466 | Ga0501080_0016690 | 3300049742 | Bacteria | 6780 |
| 467 | Ga0501080_0276183 | 3300049742 | Bacteria | 1528 |
| 468 | Ga0501080_0735305 | 3300049742 | Bacteria | 868 |
| 469 | Ga0501081_0041085 | 3300049743 | Bacteria | 3166 |
| 470 | Ga0501083_0323068 | 3300049744 | Bacteria | 1004 |
| 471 | Ga0501035_0017998 | 3300049822 | Bacteria | 6514 |
| 472 | Ga0501035_0023646 | 3300049822 | Bacteria | 5638 |
| 473 | Ga0501035_1436358 | 3300049822 | Bacteria | 528 |
| 474 | Ga0501044_0043013 | 3300049823 | Bacteria | 4694 |
| 475 | Ga0501044_0183337 | 3300049823 | Bacteria | 2059 |
| 476 | Ga0501045_0445588 | 3300049824 | Bacteria | 963 |
| 477 | nmdc:mga05p37_209785_c1 | 3300050507 | Bacteria | 2355 |
| 478 | nmdc:mga05p37_916190_c1 | 3300050507 | Unclassified | 943 |
| 479 | nmdc:mga09592_114852_c1 | 3300050508 | Bacteria | 2311 |
| 480 | nmdc:mga09592_273690_c1 | 3300050508 | Bacteria | 1465 |
| 481 | nmdc:mga09592_284269_c1 | 3300050508 | Bacteria | 1434 |
| 482 | nmdc:mga09592_347831_c1 | 3300050508 | Bacteria | 1283 |
| 483 | nmdc:mga0qj67_185092_c1 | 3300050509 | Bacteria | 1692 |
| 484 | nmdc:mga0qj67_3864_c1 | 3300050509 | Bacteria | 10824 |
| 485 | nmdc:mga06r32_117975_c1 | 3300050510 | Bacteria | 2616 |
| 486 | nmdc:mga06r32_46293_c1 | 3300050510 | Bacteria | 4151 |
| 487 | nmdc:mga06r32_534471_c1 | 3300050510 | Bacteria | 1147 |
| 488 | nmdc:mga06r32_64504_c1 | 3300050510 | Bacteria | 3532 |
| 489 | nmdc:mga06r32_92012_c1 | 3300050510 | Bacteria | 2964 |
| 490 | nmdc:mga08y16_157573_c1 | 3300050511 | Bacteria | 2360 |
| 491 | nmdc:mga08y16_363509_c1 | 3300050511 | Bacteria | 1486 |
| 492 | nmdc:mga08y16_736736_c1 | 3300050511 | Bacteria | 983 |
| 493 | nmdc:mga0n895_1522552_c1 | 3300050512 | Bacteria | 635 |
| 494 | Ga0500610_0454064 | 3300053079 | Bacteria | 501 |
| 495 | Ga0500644_0016504 | 3300053088 | Bacteria | 2127 |
| 496 | Ga0500583_0011885 | 3300053092 | Bacteria | 3301 |
| 497 | Ga0500654_168831 | 3300053099 | Bacteria | 724 |
| 498 | Ga0500562_000033 | 3300053108 | Bacteria | 86295 |
| 499 | Ga0500562_127286 | 3300053108 | Bacteria | 694 |
| 500 | Ga0500594_0073161 | 3300053118 | Bacteria | 1011 |
| 501 | Ga0500568_0021082 | 3300053139 | Bacteria | 2809 |
| 502 | Ga0500568_0056455 | 3300053139 | Bacteria | 1530 |
| 503 | Ga0500568_0222447 | 3300053139 | Bacteria | 689 |
| 504 | Ga0500589_144486 | 3300053147 | Bacteria | 976 |
| 505 | Ga0500616_0042300 | 3300053153 | Bacteria | 2440 |
| 506 | Ga0500616_0191690 | 3300053153 | Bacteria | 912 |
| 507 | Ga0500622_0002345 | 3300053156 | Bacteria | 13779 |
| 508 | Ga0500622_0003964 | 3300053156 | Bacteria | 9557 |
| 509 | Ga0500622_0004622 | 3300053156 | Bacteria | 8542 |
| 510 | Ga0500637_0050333 | 3300053178 | Bacteria | 2373 |
| 511 | Ga0501084_0061838 | 3300054114 | Bacteria | 3135 |
| 512 | Ga0501084_0149738 | 3300054114 | Bacteria | 1967 |
| 513 | Ga0501084_0675890 | 3300054114 | Bacteria | 871 |
| 514 | Ga0500661_003241 | 3300055283 | Bacteria | 3063 |
| 515 | Ga0587084_028212 | 3300059477 | Bacteria | 887 |
| 516 | Ga0587070_052120 | 3300059491 | Bacteria | 820 |
| 517 | Ga0587070_100421 | 3300059491 | Unclassified | 665 |
| 518 | Ga0587073_0092752 | 3300059492 | Bacteria | 771 |
| 519 | Ga0587073_0221606 | 3300059492 | Unclassified | 578 |
| 520 | Ga0587077_075263 | 3300059493 | Unclassified | 763 |
| 521 | Ga0587080_088856 | 3300059503 | Unclassified | 645 |
| 522 | Ga0587082_063225 | 3300059504 | Bacteria | 735 |
| 523 | Ga0587082_145969 | 3300059504 | Unclassified | 556 |
| 524 | Ga0587086_019149 | 3300059507 | Bacteria | 918 |
| 525 | Ga0587088_143373 | 3300059508 | Unclassified | 572 |
| 526 | Ga0587089_055916 | 3300059509 | Unclassified | 643 |
| 527 | Ga0587091_077885 | 3300059511 | Unclassified | 738 |
| 528 | Ga0587092_104395 | 3300059512 | Bacteria | 588 |
| 529 | Ga0587094_021068 | 3300059513 | Bacteria | 948 |
| 530 | Ga0587101_044416 | 3300059623 | Bacteria | 744 |
| 531 | Ga0587067_158127 | 3300059640 | Unclassified | 574 |
| 532 | Ga0587072_046345 | 3300059643 | Unclassified | 859 |
| 533 | Ga0587072_074849 | 3300059643 | Bacteria | 722 |
| 534 | Ga0587075_097617 | 3300059644 | Bacteria | 582 |
| 535 | Ga0587078_026124 | 3300059646 | Bacteria | 765 |
| 536 | Ga0587107_034871 | 3300059652 | Unclassified | 785 |
| 537 | Ga0587071_042241 | 3300060344 | Unclassified | 917 |
| 538 | Ga0587071_111903 | 3300060344 | Unclassified | 643 |
| 539 | Ga0501082_0028417 | 3300060353 | Bacteria | 4818 |
| 540 | Ga0501082_0030265 | 3300060353 | Bacteria | 4665 |
| 541 | Ga0501082_0168989 | 3300060353 | Bacteria | 1901 |
| 542 | Ga0530510_0336796 | 3300061734 | Bacteria | 1132 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005467 | Ga0070706_100532570 | Ga0070706_1005325702 | 116 |
| 2 | 3300036712 | Ga0316584_0387305 | Ga0316584_0387305_597_962 | 119 |
| 3 | 3300046460 | Ga0495638_0020533 | Ga0495638_0020533_3932_4303 | 120 |
| 4 | 3300047319 | Ga0495674_0907076 | Ga0495674_0907076_232_630 | 128 |
| 5 | 3300020070 | Ga0206356_10506610 | Ga0206356_105066101 | 133 |
| 6 | 3300027695 | Ga0209966_1003407 | Ga0209966_10034072 | 135 |
| 7 | 3300049584 | Ga0501068_0243405 | Ga0501068_0243405_137_544 | 135 |
| 8 | 3300049586 | Ga0501070_0223234 | Ga0501070_0223234_682_1089 | 135 |
| 9 | 3300049589 | Ga0501073_0239141 | Ga0501073_0239141_673_1080 | 135 |
| 10 | 3300049590 | Ga0501074_1183195 | Ga0501074_1183195_16_423 | 135 |
| 11 | 3300049741 | Ga0501079_0375122 | Ga0501079_0375122_676_1083 | 135 |
| 12 | 3300049744 | Ga0501083_0323068 | Ga0501083_0323068_327_734 | 135 |
| 13 | 3300054114 | Ga0501084_0149738 | Ga0501084_0149738_633_1040 | 135 |
| 14 | iso_pu_bacteria | 2501025502 | 2501082062 | 138 |
| 15 | iso_pu_bacteria | 2510917013 | 2511088721 | 138 |
| 16 | iso_pu_bacteria | 2929154850 | 2929157991 | 138 |
| 17 | iso_pu_bacteria | 2808606384 | 2808969211 | 139 |
| 18 | iso_pu_bacteria | 2808606390 | 2809004042 | 139 |
| 19 | iso_pu_bacteria | 2808606391 | 2809012761 | 139 |
| 20 | 2162886011 | MRS1b_contig_8124326 | MRS1b_0845.00001140 | 141 |
| 21 | 3300002076 | JGI24749J21850_1051909 | JGI24749J21850_10519091 | 141 |
| 22 | 3300004799 | Ga0058863_11560427 | Ga0058863_115604271 | 141 |
| 23 | 3300004799 | Ga0058863_11906289 | Ga0058863_119062891 | 141 |
| 24 | 3300004800 | Ga0058861_10005562 | Ga0058861_100055622 | 141 |
| 25 | 3300004800 | Ga0058861_10019033 | Ga0058861_100190331 | 141 |
| 26 | 3300004800 | Ga0058861_11584140 | Ga0058861_115841401 | 141 |
| 27 | 3300004800 | Ga0058861_12059346 | Ga0058861_120593461 | 141 |
| 28 | 3300004801 | Ga0058860_11534087 | Ga0058860_115340871 | 141 |
| 29 | 3300004803 | Ga0058862_10006799 | Ga0058862_100067991 | 141 |
| 30 | 3300004803 | Ga0058862_10013143 | Ga0058862_100131431 | 141 |
| 31 | 3300004803 | Ga0058862_10086714 | Ga0058862_100867141 | 141 |
| 32 | 3300004803 | Ga0058862_12368229 | Ga0058862_123682291 | 141 |
| 33 | 3300005290 | Ga0065712_10000676 | Ga0065712_100006761 | 141 |
| 34 | 3300005293 | Ga0065715_10002561 | Ga0065715_100025616 | 141 |
| 35 | 3300005327 | Ga0070658_11004615 | Ga0070658_110046152 | 141 |
| 36 | 3300005330 | Ga0070690_100437048 | Ga0070690_1004370481 | 141 |
| 37 | 3300005331 | Ga0070670_100004678 | Ga0070670_10000467812 | 141 |
| 38 | 3300005334 | Ga0068869_100970778 | Ga0068869_1009707782 | 141 |
| 39 | 3300005336 | Ga0070680_101574566 | Ga0070680_1015745661 | 141 |
| 40 | 3300005337 | Ga0070682_101714201 | Ga0070682_1017142011 | 141 |
| 41 | 3300005347 | Ga0070668_100106265 | Ga0070668_1001062652 | 141 |
| 42 | 3300005354 | Ga0070675_100024043 | Ga0070675_1000240432 | 141 |
| 43 | 3300005355 | Ga0070671_100697594 | Ga0070671_1006975942 | 141 |
| 44 | 3300005364 | Ga0070673_100113317 | Ga0070673_1001133171 | 141 |
| 45 | 3300005365 | Ga0070688_100000341 | Ga0070688_10000034112 | 141 |
| 46 | 3300005436 | Ga0070713_100831828 | Ga0070713_1008318282 | 141 |
| 47 | 3300005456 | Ga0070678_100227194 | Ga0070678_1002271941 | 141 |
| 48 | 3300005459 | Ga0068867_100010417 | Ga0068867_1000104177 | 141 |
| 49 | 3300005466 | Ga0070685_10369240 | Ga0070685_103692402 | 141 |
| 50 | 3300005467 | Ga0070706_100890552 | Ga0070706_1008905521 | 141 |
| 51 | 3300005539 | Ga0068853_100343267 | Ga0068853_1003432672 | 141 |
| 52 | 3300005543 | Ga0070672_100451828 | Ga0070672_1004518282 | 141 |
| 53 | 3300005544 | Ga0070686_100431732 | Ga0070686_1004317321 | 141 |
| 54 | 3300005548 | Ga0070665_100050891 | Ga0070665_1000508912 | 141 |
| 55 | 3300005563 | Ga0068855_100742650 | Ga0068855_1007426502 | 141 |
| 56 | 3300005615 | Ga0070702_100256889 | Ga0070702_1002568891 | 141 |
| 57 | 3300005618 | Ga0068864_100003339 | Ga0068864_10000333912 | 141 |
| 58 | 3300005719 | Ga0068861_100370490 | Ga0068861_1003704902 | 141 |
| 59 | 3300005840 | Ga0068870_10272159 | Ga0068870_102721592 | 141 |
| 60 | 3300005841 | Ga0068863_100120870 | Ga0068863_1001208702 | 141 |
| 61 | 3300005983 | Ga0081540_1040780 | Ga0081540_10407802 | 141 |
| 62 | 3300006237 | Ga0097621_100361887 | Ga0097621_1003618872 | 141 |
| 63 | 3300006358 | Ga0068871_100636493 | Ga0068871_1006364932 | 141 |
| 64 | 3300009176 | Ga0105242_10526519 | Ga0105242_105265192 | 141 |
| 65 | 3300009177 | Ga0105248_10702498 | Ga0105248_107024982 | 141 |
| 66 | 3300009553 | Ga0105249_10026809 | Ga0105249_100268093 | 141 |
| 67 | 3300011119 | Ga0105246_10356906 | Ga0105246_103569061 | 141 |
| 68 | 3300013105 | Ga0157369_11688253 | Ga0157369_116882531 | 141 |
| 69 | 3300013297 | Ga0157378_10778675 | Ga0157378_107786752 | 141 |
| 70 | 3300013306 | Ga0163162_10298910 | Ga0163162_102989101 | 141 |
| 71 | 3300013308 | Ga0157375_10048802 | Ga0157375_100488024 | 141 |
| 72 | 3300013308 | Ga0157375_10375905 | Ga0157375_103759052 | 141 |
| 73 | 3300014325 | Ga0163163_10083888 | Ga0163163_100838882 | 141 |
| 74 | 3300014325 | Ga0163163_10362858 | Ga0163163_103628582 | 141 |
| 75 | 3300020069 | Ga0197907_10309475 | Ga0197907_103094751 | 141 |
| 76 | 3300020069 | Ga0197907_10481651 | Ga0197907_104816512 | 141 |
| 77 | 3300020069 | Ga0197907_11305640 | Ga0197907_113056401 | 141 |
| 78 | 3300020069 | Ga0197907_11314326 | Ga0197907_113143261 | 141 |
| 79 | 3300020070 | Ga0206356_10394661 | Ga0206356_103946611 | 141 |
| 80 | 3300020070 | Ga0206356_10675169 | Ga0206356_106751691 | 141 |
| 81 | 3300020070 | Ga0206356_11895739 | Ga0206356_118957391 | 141 |
| 82 | 3300020075 | Ga0206349_1894552 | Ga0206349_18945521 | 141 |
| 83 | 3300020075 | Ga0206349_1954048 | Ga0206349_19540482 | 141 |
| 84 | 3300020076 | Ga0206355_1475349 | Ga0206355_14753492 | 141 |
| 85 | 3300020076 | Ga0206355_1678219 | Ga0206355_16782191 | 141 |
| 86 | 3300020077 | Ga0206351_10459302 | Ga0206351_104593022 | 141 |
| 87 | 3300020077 | Ga0206351_10483349 | Ga0206351_104833491 | 141 |
| 88 | 3300020077 | Ga0206351_10672749 | Ga0206351_106727492 | 141 |
| 89 | 3300020078 | Ga0206352_10226561 | Ga0206352_102265611 | 141 |
| 90 | 3300020078 | Ga0206352_10909166 | Ga0206352_109091662 | 141 |
| 91 | 3300020080 | Ga0206350_10195778 | Ga0206350_101957781 | 141 |
| 92 | 3300020080 | Ga0206350_10421805 | Ga0206350_104218052 | 141 |
| 93 | 3300020080 | Ga0206350_10458104 | Ga0206350_104581041 | 141 |
| 94 | 3300020082 | Ga0206353_10550515 | Ga0206353_105505152 | 141 |
| 95 | 3300020082 | Ga0206353_11078394 | Ga0206353_110783941 | 141 |
| 96 | 3300020082 | Ga0206353_11677454 | Ga0206353_116774541 | 141 |
| 97 | 3300020610 | Ga0154015_1459979 | Ga0154015_14599791 | 141 |
| 98 | 3300022467 | Ga0224712_10061048 | Ga0224712_100610482 | 141 |
| 99 | 3300022467 | Ga0224712_10103935 | Ga0224712_101039352 | 141 |
| 100 | 3300022467 | Ga0224712_10265370 | Ga0224712_102653702 | 141 |
| 101 | 3300025899 | Ga0207642_10353122 | Ga0207642_103531221 | 141 |
| 102 | 3300025908 | Ga0207643_10235253 | Ga0207643_102352532 | 141 |
| 103 | 3300025916 | Ga0207663_10857977 | Ga0207663_108579771 | 141 |
| 104 | 3300025918 | Ga0207662_10040975 | Ga0207662_100409753 | 141 |
| 105 | 3300025925 | Ga0207650_10034198 | Ga0207650_100341981 | 141 |
| 106 | 3300025926 | Ga0207659_10384229 | Ga0207659_103842292 | 141 |
| 107 | 3300025938 | Ga0207704_10129624 | Ga0207704_101296241 | 141 |
| 108 | 3300025940 | Ga0207691_10235538 | Ga0207691_102355382 | 141 |
| 109 | 3300025941 | Ga0207711_10558283 | Ga0207711_105582833 | 141 |
| 110 | 3300025949 | Ga0207667_10306046 | Ga0207667_103060461 | 141 |
| 111 | 3300025961 | Ga0207712_10458037 | Ga0207712_104580372 | 141 |
| 112 | 3300025972 | Ga0207668_10053567 | Ga0207668_100535672 | 141 |
| 113 | 3300025986 | Ga0207658_10483776 | Ga0207658_104837762 | 141 |
| 114 | 3300026088 | Ga0207641_10140102 | Ga0207641_101401022 | 141 |
| 115 | 3300026089 | Ga0207648_10086707 | Ga0207648_100867072 | 141 |
| 116 | 3300026095 | Ga0207676_10030598 | Ga0207676_100305983 | 141 |
| 117 | 3300026118 | Ga0207675_100158259 | Ga0207675_1001582592 | 141 |
| 118 | 3300026121 | Ga0207683_10269776 | Ga0207683_102697761 | 141 |
| 119 | 3300028379 | Ga0268266_10084991 | Ga0268266_100849913 | 141 |
| 120 | 3300031344 | Ga0265316_10291822 | Ga0265316_102918222 | 141 |
| 121 | 3300044712 | Ga0453684_0665998 | Ga0453684_0665998_415_858 | 141 |
| 122 | 3300044842 | Ga0466957_0488259 | Ga0466957_0488259_291_773 | 141 |
| 123 | 3300048904 | Ga0496101_0130241 | Ga0496101_0130241_939_1367 | 141 |
| 124 | 3300048907 | Ga0496104_0031420 | Ga0496104_0031420_499_927 | 141 |
| 125 | 3300048907 | Ga0496104_1116467 | Ga0496104_1116467_168_647 | 141 |
| 126 | 3300048909 | Ga0496106_0040094 | Ga0496106_0040094_2070_2498 | 141 |
| 127 | 3300048910 | Ga0496107_0249814 | Ga0496107_0249814_58_486 | 141 |
| 128 | 3300048911 | Ga0496108_0005390 | Ga0496108_0005390_7461_7889 | 141 |
| 129 | 3300048912 | Ga0496109_0005268 | Ga0496109_0005268_348_776 | 141 |
| 130 | 3300048913 | Ga0496110_0463184 | Ga0496110_0463184_82_561 | 141 |
| 131 | 3300048913 | Ga0496110_0918631 | Ga0496110_0918631_223_651 | 141 |
| 132 | 3300048914 | Ga0496111_0515985 | Ga0496111_0515985_334_813 | 141 |
| 133 | 3300048915 | Ga0496112_0001381 | Ga0496112_0001381_2627_3055 | 141 |
| 134 | 3300048916 | Ga0496113_0057849 | Ga0496113_0057849_2266_2694 | 141 |
| 135 | 3300048917 | Ga0496114_0418507 | Ga0496114_0418507_449_928 | 141 |
| 136 | 3300049571 | Ga0501034_0123201 | Ga0501034_0123201_1230_1679 | 141 |
| 137 | 3300049573 | Ga0501037_0272127 | Ga0501037_0272127_378_827 | 141 |
| 138 | 3300049580 | Ga0501046_0109126 | Ga0501046_0109126_705_1154 | 141 |
| 139 | 3300049581 | Ga0501047_0004284 | Ga0501047_0004284_6136_6585 | 141 |
| 140 | 3300049582 | Ga0501048_0785714 | Ga0501048_0785714_158_607 | 141 |
| 141 | 3300049586 | Ga0501070_0026300 | Ga0501070_0026300_2375_2824 | 141 |
| 142 | 3300049742 | Ga0501080_0735305 | Ga0501080_0735305_327_776 | 141 |
| 143 | 3300049822 | Ga0501035_0023646 | Ga0501035_0023646_1010_1459 | 141 |
| 144 | 3300049822 | Ga0501035_1436358 | Ga0501035_1436358_43_492 | 141 |
| 145 | 3300049823 | Ga0501044_0183337 | Ga0501044_0183337_485_934 | 141 |
| 146 | 3300059477 | Ga0587084_028212 | Ga0587084_028212_172_621 | 141 |
| 147 | 3300059491 | Ga0587070_052120 | Ga0587070_052120_173_622 | 141 |
| 148 | 3300059491 | Ga0587070_100421 | Ga0587070_100421_65_514 | 141 |
| 149 | 3300059492 | Ga0587073_0092752 | Ga0587073_0092752_174_623 | 141 |
| 150 | 3300059492 | Ga0587073_0221606 | Ga0587073_0221606_37_486 | 141 |
| 151 | 3300059493 | Ga0587077_075263 | Ga0587077_075263_166_615 | 141 |
| 152 | 3300059503 | Ga0587080_088856 | Ga0587080_088856_126_575 | 141 |
| 153 | 3300059504 | Ga0587082_063225 | Ga0587082_063225_114_563 | 141 |
| 154 | 3300059504 | Ga0587082_145969 | Ga0587082_145969_34_483 | 141 |
| 155 | 3300059507 | Ga0587086_019149 | Ga0587086_019149_171_620 | 141 |
| 156 | 3300059508 | Ga0587088_143373 | Ga0587088_143373_109_558 | 141 |
| 157 | 3300059509 | Ga0587089_055916 | Ga0587089_055916_178_627 | 141 |
| 158 | 3300059511 | Ga0587091_077885 | Ga0587091_077885_127_576 | 141 |
| 159 | 3300059512 | Ga0587092_104395 | Ga0587092_104395_127_576 | 141 |
| 160 | 3300059513 | Ga0587094_021068 | Ga0587094_021068_174_623 | 141 |
| 161 | 3300059623 | Ga0587101_044416 | Ga0587101_044416_152_601 | 141 |
| 162 | 3300059640 | Ga0587067_158127 | Ga0587067_158127_26_475 | 141 |
| 163 | 3300059643 | Ga0587072_046345 | Ga0587072_046345_256_705 | 141 |
| 164 | 3300059643 | Ga0587072_074849 | Ga0587072_074849_166_615 | 141 |
| 165 | 3300059644 | Ga0587075_097617 | Ga0587075_097617_15_491 | 141 |
| 166 | 3300059646 | Ga0587078_026124 | Ga0587078_026124_168_617 | 141 |
| 167 | 3300059652 | Ga0587107_034871 | Ga0587107_034871_158_607 | 141 |
| 168 | 3300060344 | Ga0587071_042241 | Ga0587071_042241_176_625 | 141 |
| 169 | 3300060344 | Ga0587071_111903 | Ga0587071_111903_68_517 | 141 |
| 170 | 2162886007 | SwRhRL2b_contig_975409 | SwRhRL2b_0585.00006800 | 142 |
| 171 | 3300003911 | JGI25405J52794_10048972 | JGI25405J52794_100489722 | 142 |
| 172 | 3300005295 | Ga0065707_10083877 | Ga0065707_100838772 | 142 |
| 173 | 3300005295 | Ga0065707_10157251 | Ga0065707_101572512 | 142 |
| 174 | 3300005295 | Ga0065707_10834947 | Ga0065707_108349471 | 142 |
| 175 | 3300005327 | Ga0070658_10630277 | Ga0070658_106302772 | 142 |
| 176 | 3300005328 | Ga0070676_10010484 | Ga0070676_100104845 | 142 |
| 177 | 3300005328 | Ga0070676_10317201 | Ga0070676_103172011 | 142 |
| 178 | 3300005329 | Ga0070683_100240127 | Ga0070683_1002401272 | 142 |
| 179 | 3300005331 | Ga0070670_100199823 | Ga0070670_1001998232 | 142 |
| 180 | 3300005331 | Ga0070670_101179778 | Ga0070670_1011797782 | 142 |
| 181 | 3300005333 | Ga0070677_10293776 | Ga0070677_102937761 | 142 |
| 182 | 3300005336 | Ga0070680_100068243 | Ga0070680_1000682434 | 142 |
| 183 | 3300005336 | Ga0070680_100224295 | Ga0070680_1002242952 | 142 |
| 184 | 3300005338 | Ga0068868_100812565 | Ga0068868_1008125651 | 142 |
| 185 | 3300005338 | Ga0068868_100983754 | Ga0068868_1009837542 | 142 |
| 186 | 3300005341 | Ga0070691_10071163 | Ga0070691_100711632 | 142 |
| 187 | 3300005344 | Ga0070661_100575211 | Ga0070661_1005752111 | 142 |
| 188 | 3300005345 | Ga0070692_10157251 | Ga0070692_101572512 | 142 |
| 189 | 3300005347 | Ga0070668_100063770 | Ga0070668_1000637701 | 142 |
| 190 | 3300005347 | Ga0070668_100097381 | Ga0070668_1000973812 | 142 |
| 191 | 3300005347 | Ga0070668_100432869 | Ga0070668_1004328692 | 142 |
| 192 | 3300005353 | Ga0070669_100030601 | Ga0070669_1000306015 | 142 |
| 193 | 3300005353 | Ga0070669_100207557 | Ga0070669_1002075572 | 142 |
| 194 | 3300005356 | Ga0070674_100059987 | Ga0070674_1000599875 | 142 |
| 195 | 3300005364 | Ga0070673_100595282 | Ga0070673_1005952821 | 142 |
| 196 | 3300005366 | Ga0070659_100092857 | Ga0070659_1000928572 | 142 |
| 197 | 3300005367 | Ga0070667_100069926 | Ga0070667_1000699262 | 142 |
| 198 | 3300005434 | Ga0070709_10867111 | Ga0070709_108671111 | 142 |
| 199 | 3300005435 | Ga0070714_100907904 | Ga0070714_1009079042 | 142 |
| 200 | 3300005436 | Ga0070713_100009620 | Ga0070713_1000096208 | 142 |
| 201 | 3300005436 | Ga0070713_100094102 | Ga0070713_1000941022 | 142 |
| 202 | 3300005438 | Ga0070701_10224366 | Ga0070701_102243662 | 142 |
| 203 | 3300005438 | Ga0070701_11020721 | Ga0070701_110207211 | 142 |
| 204 | 3300005439 | Ga0070711_100292340 | Ga0070711_1002923402 | 142 |
| 205 | 3300005444 | Ga0070694_100034090 | Ga0070694_1000340901 | 142 |
| 206 | 3300005455 | Ga0070663_100021366 | Ga0070663_1000213662 | 142 |
| 207 | 3300005455 | Ga0070663_100428518 | Ga0070663_1004285181 | 142 |
| 208 | 3300005456 | Ga0070678_100532010 | Ga0070678_1005320102 | 142 |
| 209 | 3300005456 | Ga0070678_100618041 | Ga0070678_1006180411 | 142 |
| 210 | 3300005457 | Ga0070662_100010273 | Ga0070662_1000102735 | 142 |
| 211 | 3300005457 | Ga0070662_100014291 | Ga0070662_1000142915 | 142 |
| 212 | 3300005457 | Ga0070662_100208496 | Ga0070662_1002084962 | 142 |
| 213 | 3300005458 | Ga0070681_10926054 | Ga0070681_109260541 | 142 |
| 214 | 3300005471 | Ga0070698_100368703 | Ga0070698_1003687032 | 142 |
| 215 | 3300005530 | Ga0070679_100276021 | Ga0070679_1002760212 | 142 |
| 216 | 3300005530 | Ga0070679_101344822 | Ga0070679_1013448221 | 142 |
| 217 | 3300005536 | Ga0070697_100635832 | Ga0070697_1006358322 | 142 |
| 218 | 3300005539 | Ga0068853_100000762 | Ga0068853_10000076213 | 142 |
| 219 | 3300005539 | Ga0068853_100000975 | Ga0068853_10000097510 | 142 |
| 220 | 3300005539 | Ga0068853_100123692 | Ga0068853_1001236922 | 142 |
| 221 | 3300005543 | Ga0070672_100000775 | Ga0070672_1000007757 | 142 |
| 222 | 3300005547 | Ga0070693_100722774 | Ga0070693_1007227741 | 142 |
| 223 | 3300005548 | Ga0070665_100004227 | Ga0070665_1000042272 | 142 |
| 224 | 3300005549 | Ga0070704_100107970 | Ga0070704_1001079703 | 142 |
| 225 | 3300005549 | Ga0070704_100492752 | Ga0070704_1004927521 | 142 |
| 226 | 3300005563 | Ga0068855_100006801 | Ga0068855_1000068015 | 142 |
| 227 | 3300005563 | Ga0068855_100096416 | Ga0068855_1000964162 | 142 |
| 228 | 3300005577 | Ga0068857_101556843 | Ga0068857_1015568431 | 142 |
| 229 | 3300005577 | Ga0068857_102239616 | Ga0068857_1022396161 | 142 |
| 230 | 3300005614 | Ga0068856_100039388 | Ga0068856_1000393883 | 142 |
| 231 | 3300005616 | Ga0068852_100708746 | Ga0068852_1007087461 | 142 |
| 232 | 3300005718 | Ga0068866_10010001 | Ga0068866_100100012 | 142 |
| 233 | 3300005718 | Ga0068866_10030257 | Ga0068866_100302572 | 142 |
| 234 | 3300005719 | Ga0068861_100000924 | Ga0068861_10000092410 | 142 |
| 235 | 3300005719 | Ga0068861_100496088 | Ga0068861_1004960881 | 142 |
| 236 | 3300005834 | Ga0068851_10194597 | Ga0068851_101945972 | 142 |
| 237 | 3300005841 | Ga0068863_100018888 | Ga0068863_1000188882 | 142 |
| 238 | 3300005844 | Ga0068862_100011962 | Ga0068862_1000119623 | 142 |
| 239 | 3300005844 | Ga0068862_100021863 | Ga0068862_1000218636 | 142 |
| 240 | 3300005937 | Ga0081455_10006436 | Ga0081455_100064367 | 142 |
| 241 | 3300006028 | Ga0070717_10265681 | Ga0070717_102656812 | 142 |
| 242 | 3300006028 | Ga0070717_10670210 | Ga0070717_106702101 | 142 |
| 243 | 3300006173 | Ga0070716_100017128 | Ga0070716_1000171283 | 142 |
| 244 | 3300006173 | Ga0070716_100035731 | Ga0070716_1000357313 | 142 |
| 245 | 3300006175 | Ga0070712_100004652 | Ga0070712_1000046525 | 142 |
| 246 | 3300006175 | Ga0070712_100537675 | Ga0070712_1005376753 | 142 |
| 247 | 3300006358 | Ga0068871_101269525 | Ga0068871_1012695251 | 142 |
| 248 | 3300006844 | Ga0075428_100006966 | Ga0075428_10000696613 | 142 |
| 249 | 3300006844 | Ga0075428_100028202 | Ga0075428_1000282024 | 142 |
| 250 | 3300006844 | Ga0075428_100293264 | Ga0075428_1002932642 | 142 |
| 251 | 3300006846 | Ga0075430_100097518 | Ga0075430_1000975183 | 142 |
| 252 | 3300006846 | Ga0075430_100440814 | Ga0075430_1004408142 | 142 |
| 253 | 3300006847 | Ga0075431_100031192 | Ga0075431_1000311926 | 142 |
| 254 | 3300006847 | Ga0075431_100106629 | Ga0075431_1001066294 | 142 |
| 255 | 3300006847 | Ga0075431_100528486 | Ga0075431_1005284862 | 142 |
| 256 | 3300006847 | Ga0075431_101731254 | Ga0075431_1017312541 | 142 |
| 257 | 3300006871 | Ga0075434_100307384 | Ga0075434_1003073841 | 142 |
| 258 | 3300006880 | Ga0075429_100056506 | Ga0075429_1000565063 | 142 |
| 259 | 3300006880 | Ga0075429_100062203 | Ga0075429_1000622033 | 142 |
| 260 | 3300006880 | Ga0075429_100281391 | Ga0075429_1002813912 | 142 |
| 261 | 3300006948 | Ga0099826_10119588 | Ga0099826_101195883 | 142 |
| 262 | 3300009094 | Ga0111539_10016185 | Ga0111539_100161857 | 142 |
| 263 | 3300009094 | Ga0111539_10020676 | Ga0111539_100206766 | 142 |
| 264 | 3300009094 | Ga0111539_10822873 | Ga0111539_108228732 | 142 |
| 265 | 3300009101 | Ga0105247_10089674 | Ga0105247_100896742 | 142 |
| 266 | 3300009147 | Ga0114129_10103116 | Ga0114129_101031162 | 142 |
| 267 | 3300009147 | Ga0114129_10995028 | Ga0114129_109950282 | 142 |
| 268 | 3300009148 | Ga0105243_10193043 | Ga0105243_101930431 | 142 |
| 269 | 3300009174 | Ga0105241_10489399 | Ga0105241_104893992 | 142 |
| 270 | 3300009174 | Ga0105241_11327529 | Ga0105241_113275292 | 142 |
| 271 | 3300009176 | Ga0105242_10184493 | Ga0105242_101844932 | 142 |
| 272 | 3300009176 | Ga0105242_10184628 | Ga0105242_101846282 | 142 |
| 273 | 3300009553 | Ga0105249_10070843 | Ga0105249_100708432 | 142 |
| 274 | 3300010375 | Ga0105239_10225453 | Ga0105239_102254533 | 142 |
| 275 | 3300010375 | Ga0105239_10559662 | Ga0105239_105596622 | 142 |
| 276 | 3300013100 | Ga0157373_10552153 | Ga0157373_105521531 | 142 |
| 277 | 3300013296 | Ga0157374_11178779 | Ga0157374_111787792 | 142 |
| 278 | 3300013306 | Ga0163162_11537856 | Ga0163162_115378561 | 142 |
| 279 | 3300013306 | Ga0163162_12186199 | Ga0163162_121861991 | 142 |
| 280 | 3300013307 | Ga0157372_10597414 | Ga0157372_105974142 | 142 |
| 281 | 3300013308 | Ga0157375_10532936 | Ga0157375_105329362 | 142 |
| 282 | 3300014325 | Ga0163163_12109898 | Ga0163163_121098982 | 142 |
| 283 | 3300014326 | Ga0157380_10004477 | Ga0157380_1000447710 | 142 |
| 284 | 3300014326 | Ga0157380_10021556 | Ga0157380_100215562 | 142 |
| 285 | 3300014326 | Ga0157380_11909195 | Ga0157380_119091951 | 142 |
| 286 | 3300015262 | Ga0182007_10143692 | Ga0182007_101436922 | 142 |
| 287 | 3300017792 | Ga0163161_10436326 | Ga0163161_104363262 | 142 |
| 288 | 3300025303 | Ga0209051_1018121 | Ga0209051_10181213 | 142 |
| 289 | 3300025906 | Ga0207699_10208510 | Ga0207699_102085101 | 142 |
| 290 | 3300025907 | Ga0207645_10000790 | Ga0207645_100007909 | 142 |
| 291 | 3300025910 | Ga0207684_10406901 | Ga0207684_104069012 | 142 |
| 292 | 3300025911 | Ga0207654_10415312 | Ga0207654_104153122 | 142 |
| 293 | 3300025914 | Ga0207671_10184654 | Ga0207671_101846543 | 142 |
| 294 | 3300025915 | Ga0207693_10110348 | Ga0207693_101103482 | 142 |
| 295 | 3300025916 | Ga0207663_10059060 | Ga0207663_100590602 | 142 |
| 296 | 3300025917 | Ga0207660_10175300 | Ga0207660_101753002 | 142 |
| 297 | 3300025919 | Ga0207657_10689408 | Ga0207657_106894081 | 142 |
| 298 | 3300025920 | Ga0207649_10711473 | Ga0207649_107114732 | 142 |
| 299 | 3300025921 | Ga0207652_10123016 | Ga0207652_101230161 | 142 |
| 300 | 3300025921 | Ga0207652_11286815 | Ga0207652_112868151 | 142 |
| 301 | 3300025923 | Ga0207681_10029737 | Ga0207681_100297372 | 142 |
| 302 | 3300025925 | Ga0207650_10080575 | Ga0207650_100805752 | 142 |
| 303 | 3300025928 | Ga0207700_10025152 | Ga0207700_100251522 | 142 |
| 304 | 3300025928 | Ga0207700_10065230 | Ga0207700_100652302 | 142 |
| 305 | 3300025932 | Ga0207690_10023046 | Ga0207690_100230462 | 142 |
| 306 | 3300025933 | Ga0207706_10000586 | Ga0207706_1000058621 | 142 |
| 307 | 3300025933 | Ga0207706_10004219 | Ga0207706_1000421913 | 142 |
| 308 | 3300025933 | Ga0207706_10093108 | Ga0207706_100931084 | 142 |
| 309 | 3300025934 | Ga0207686_10248278 | Ga0207686_102482782 | 142 |
| 310 | 3300025938 | Ga0207704_10728054 | Ga0207704_107280542 | 142 |
| 311 | 3300025939 | Ga0207665_10030972 | Ga0207665_100309725 | 142 |
| 312 | 3300025940 | Ga0207691_10000872 | Ga0207691_1000087214 | 142 |
| 313 | 3300025942 | Ga0207689_10237986 | Ga0207689_102379861 | 142 |
| 314 | 3300025945 | Ga0207679_11353717 | Ga0207679_113537171 | 142 |
| 315 | 3300025949 | Ga0207667_10028581 | Ga0207667_100285815 | 142 |
| 316 | 3300025949 | Ga0207667_10246160 | Ga0207667_102461603 | 142 |
| 317 | 3300025972 | Ga0207668_10030913 | Ga0207668_100309133 | 142 |
| 318 | 3300025972 | Ga0207668_10294405 | Ga0207668_102944052 | 142 |
| 319 | 3300025972 | Ga0207668_11066804 | Ga0207668_110668041 | 142 |
| 320 | 3300025981 | Ga0207640_10071376 | Ga0207640_100713761 | 142 |
| 321 | 3300025981 | Ga0207640_11232687 | Ga0207640_112326871 | 142 |
| 322 | 3300025986 | Ga0207658_10064384 | Ga0207658_100643842 | 142 |
| 323 | 3300025986 | Ga0207658_10128208 | Ga0207658_101282083 | 142 |
| 324 | 3300026041 | Ga0207639_10000657 | Ga0207639_100006577 | 142 |
| 325 | 3300026041 | Ga0207639_10003833 | Ga0207639_1000383310 | 142 |
| 326 | 3300026041 | Ga0207639_10256944 | Ga0207639_102569442 | 142 |
| 327 | 3300026067 | Ga0207678_10042014 | Ga0207678_100420142 | 142 |
| 328 | 3300026075 | Ga0207708_10041283 | Ga0207708_100412834 | 142 |
| 329 | 3300026075 | Ga0207708_10187929 | Ga0207708_101879292 | 142 |
| 330 | 3300026075 | Ga0207708_10198820 | Ga0207708_101988202 | 142 |
| 331 | 3300026078 | Ga0207702_10058560 | Ga0207702_100585601 | 142 |
| 332 | 3300026089 | Ga0207648_10000544 | Ga0207648_1000054424 | 142 |
| 333 | 3300026116 | Ga0207674_10196433 | Ga0207674_101964333 | 142 |
| 334 | 3300026116 | Ga0207674_11443649 | Ga0207674_114436491 | 142 |
| 335 | 3300026118 | Ga0207675_100001615 | Ga0207675_1000016159 | 142 |
| 336 | 3300026118 | Ga0207675_100005250 | Ga0207675_1000052506 | 142 |
| 337 | 3300026118 | Ga0207675_100030331 | Ga0207675_1000303316 | 142 |
| 338 | 3300026118 | Ga0207675_100539425 | Ga0207675_1005394252 | 142 |
| 339 | 3300026121 | Ga0207683_10406873 | Ga0207683_104068732 | 142 |
| 340 | 3300026142 | Ga0207698_10196466 | Ga0207698_101964662 | 142 |
| 341 | 3300026142 | Ga0207698_11160280 | Ga0207698_111602801 | 142 |
| 342 | 3300027364 | Ga0209967_1004350 | Ga0209967_10043502 | 142 |
| 343 | 3300027526 | Ga0209968_1014555 | Ga0209968_10145552 | 142 |
| 344 | 3300027543 | Ga0209999_1003307 | Ga0209999_10033075 | 142 |
| 345 | 3300027614 | Ga0209970_1005977 | Ga0209970_10059771 | 142 |
| 346 | 3300027617 | Ga0210002_1017166 | Ga0210002_10171662 | 142 |
| 347 | 3300027682 | Ga0209971_1000749 | Ga0209971_10007498 | 142 |
| 348 | 3300027717 | Ga0209998_10004905 | Ga0209998_100049053 | 142 |
| 349 | 3300027876 | Ga0209974_10000879 | Ga0209974_100008793 | 142 |
| 350 | 3300027907 | Ga0207428_10365186 | Ga0207428_103651862 | 142 |
| 351 | 3300027907 | Ga0207428_10590103 | Ga0207428_105901031 | 142 |
| 352 | 3300028379 | Ga0268266_10024952 | Ga0268266_100249525 | 142 |
| 353 | 3300028380 | Ga0268265_10008849 | Ga0268265_100088493 | 142 |
| 354 | 3300028380 | Ga0268265_10018036 | Ga0268265_100180366 | 142 |
| 355 | 3300028573 | Ga0265334_10001494 | Ga0265334_100014944 | 142 |
| 356 | 3300028577 | Ga0265318_10006068 | Ga0265318_100060687 | 142 |
| 357 | 3300028800 | Ga0265338_10007423 | Ga0265338_100074239 | 142 |
| 358 | 3300028800 | Ga0265338_10056298 | Ga0265338_100562982 | 142 |
| 359 | 3300029957 | Ga0265324_10013594 | Ga0265324_100135943 | 142 |
| 360 | 3300031235 | Ga0265330_10006083 | Ga0265330_100060834 | 142 |
| 361 | 3300031238 | Ga0265332_10017482 | Ga0265332_100174822 | 142 |
| 362 | 3300031239 | Ga0265328_10000585 | Ga0265328_1000058514 | 142 |
| 363 | 3300031239 | Ga0265328_10047118 | Ga0265328_100471181 | 142 |
| 364 | 3300031240 | Ga0265320_10041365 | Ga0265320_100413652 | 142 |
| 365 | 3300031241 | Ga0265325_10003461 | Ga0265325_100034616 | 142 |
| 366 | 3300031242 | Ga0265329_10025194 | Ga0265329_100251941 | 142 |
| 367 | 3300031247 | Ga0265340_10037163 | Ga0265340_100371631 | 142 |
| 368 | 3300031249 | Ga0265339_10019067 | Ga0265339_100190674 | 142 |
| 369 | 3300031249 | Ga0265339_10131736 | Ga0265339_101317361 | 142 |
| 370 | 3300031250 | Ga0265331_10000065 | Ga0265331_10000065133 | 142 |
| 371 | 3300031250 | Ga0265331_10002811 | Ga0265331_100028115 | 142 |
| 372 | 3300031250 | Ga0265331_10046620 | Ga0265331_100466203 | 142 |
| 373 | 3300031251 | Ga0265327_10000123 | Ga0265327_1000012345 | 142 |
| 374 | 3300031251 | Ga0265327_10022091 | Ga0265327_100220912 | 142 |
| 375 | 3300031344 | Ga0265316_10026444 | Ga0265316_100264443 | 142 |
| 376 | 3300031344 | Ga0265316_10039529 | Ga0265316_100395292 | 142 |
| 377 | 3300031507 | Ga0307509_10179837 | Ga0307509_101798372 | 142 |
| 378 | 3300031548 | Ga0307408_100072024 | Ga0307408_1000720242 | 142 |
| 379 | 3300031595 | Ga0265313_10011808 | Ga0265313_100118084 | 142 |
| 380 | 3300031665 | Ga0316575_10002443 | Ga0316575_100024432 | 142 |
| 381 | 3300031691 | Ga0316579_10068379 | Ga0316579_100683792 | 142 |
| 382 | 3300031691 | Ga0316579_10277867 | Ga0316579_102778672 | 142 |
| 383 | 3300031711 | Ga0265314_10007342 | Ga0265314_100073427 | 142 |
| 384 | 3300031712 | Ga0265342_10055546 | Ga0265342_100555462 | 142 |
| 385 | 3300031727 | Ga0316576_10245211 | Ga0316576_102452112 | 142 |
| 386 | 3300031727 | Ga0316576_10468625 | Ga0316576_104686252 | 142 |
| 387 | 3300031728 | Ga0316578_10052983 | Ga0316578_100529832 | 142 |
| 388 | 3300031731 | Ga0307405_11085284 | Ga0307405_110852841 | 142 |
| 389 | 3300031731 | Ga0307405_11424633 | Ga0307405_114246332 | 142 |
| 390 | 3300031733 | Ga0316577_10057893 | Ga0316577_100578932 | 142 |
| 391 | 3300031824 | Ga0307413_10026221 | Ga0307413_100262212 | 142 |
| 392 | 3300031824 | Ga0307413_10172904 | Ga0307413_101729042 | 142 |
| 393 | 3300031852 | Ga0307410_10153496 | Ga0307410_101534963 | 142 |
| 394 | 3300031852 | Ga0307410_10976166 | Ga0307410_109761662 | 142 |
| 395 | 3300031901 | Ga0307406_10059362 | Ga0307406_100593622 | 142 |
| 396 | 3300031903 | Ga0307407_10968748 | Ga0307407_109687481 | 142 |
| 397 | 3300031911 | Ga0307412_10584315 | Ga0307412_105843152 | 142 |
| 398 | 3300031911 | Ga0307412_10705395 | Ga0307412_107053951 | 142 |
| 399 | 3300031995 | Ga0307409_100215727 | Ga0307409_1002157272 | 142 |
| 400 | 3300032002 | Ga0307416_100120789 | Ga0307416_1001207892 | 142 |
| 401 | 3300032002 | Ga0307416_100293929 | Ga0307416_1002939292 | 142 |
| 402 | 3300032002 | Ga0307416_100465755 | Ga0307416_1004657552 | 142 |
| 403 | 3300032002 | Ga0307416_100980025 | Ga0307416_1009800251 | 142 |
| 404 | 3300032004 | Ga0307414_11684778 | Ga0307414_116847781 | 142 |
| 405 | 3300032005 | Ga0307411_10056689 | Ga0307411_100566893 | 142 |
| 406 | 3300032005 | Ga0307411_11130923 | Ga0307411_111309231 | 142 |
| 407 | 3300032126 | Ga0307415_100070741 | Ga0307415_1000707412 | 142 |
| 408 | 3300032126 | Ga0307415_100142688 | Ga0307415_1001426883 | 142 |
| 409 | 3300032133 | Ga0316583_10295778 | Ga0316583_102957781 | 142 |
| 410 | 3300032137 | Ga0316585_10028006 | Ga0316585_100280062 | 142 |
| 411 | 3300032139 | Ga0316580_10011023 | Ga0316580_100110232 | 142 |
| 412 | 3300035171 | Ga0373946_0045631 | Ga0373946_0045631_113_565 | 142 |
| 413 | 3300035398 | Ga0316574_0000470 | Ga0316574_0000470_14403_14831 | 142 |
| 414 | 3300035398 | Ga0316574_0165276 | Ga0316574_0165276_518_955 | 142 |
| 415 | 3300035725 | Ga0373947_0051879 | Ga0373947_0051879_17_469 | 142 |
| 416 | 3300036647 | Ga0316582_0001306 | Ga0316582_0001306_9288_9716 | 142 |
| 417 | 3300036647 | Ga0316582_0065153 | Ga0316582_0065153_1448_1879 | 142 |
| 418 | 3300036647 | Ga0316582_0854790 | Ga0316582_0854790_56_493 | 142 |
| 419 | 3300036712 | Ga0316584_0006760 | Ga0316584_0006760_3312_3740 | 142 |
| 420 | 3300037068 | Ga0373925_0021595 | Ga0373925_0021595_1927_2379 | 142 |
| 421 | 3300038726 | Ga0400490_60992 | Ga0400490_60992_628_1065 | 142 |
| 422 | 3300038741 | Ga0400488_55436 | Ga0400488_55436_1223_1660 | 142 |
| 423 | 3300041486 | Ga0451807_1641010 | Ga0451807_1641010_99_527 | 142 |
| 424 | 3300041491 | Ga0451833_1240965 | Ga0451833_1240965_51_479 | 142 |
| 425 | 3300041492 | Ga0451835_0658749 | Ga0451835_0658749_21_449 | 142 |
| 426 | 3300041498 | Ga0451841_0183847 | Ga0451841_0183847_145_573 | 142 |
| 427 | 3300041503 | Ga0451847_0549916 | Ga0451847_0549916_24_452 | 142 |
| 428 | 3300041507 | Ga0451851_0917330 | Ga0451851_0917330_91_519 | 142 |
| 429 | 3300041512 | Ga0451853_1060211 | Ga0451853_1060211_834_1262 | 142 |
| 430 | 3300041512 | Ga0451853_1956397 | Ga0451853_1956397_41_469 | 142 |
| 431 | 3300042125 | Ga0450923_000521 | Ga0450923_000521_2635_3066 | 142 |
| 432 | 3300042133 | Ga0450896_005791 | Ga0450896_005791_457_888 | 142 |
| 433 | 3300042461 | Ga0439460_0019273 | Ga0439460_0019273_1402_1836 | 142 |
| 434 | 3300042532 | Ga0450893_0009053 | Ga0450893_0009053_322_753 | 142 |
| 435 | 3300042876 | Ga0451577_0002503 | Ga0451577_0002503_14406_14834 | 142 |
| 436 | 3300042876 | Ga0451577_0813029 | Ga0451577_0813029_133_573 | 142 |
| 437 | 3300044673 | Ga0453683_0773639 | Ga0453683_0773639_133_570 | 142 |
| 438 | 3300044683 | Ga0466965_0157928 | Ga0466965_0157928_19_447 | 142 |
| 439 | 3300044712 | Ga0453684_0000581 | Ga0453684_0000581_131293_131787 | 142 |
| 440 | 3300044712 | Ga0453684_0010306 | Ga0453684_0010306_11046_11477 | 142 |
| 441 | 3300044712 | Ga0453684_0072380 | Ga0453684_0072380_2328_2768 | 142 |
| 442 | 3300044712 | Ga0453684_0154565 | Ga0453684_0154565_449_889 | 142 |
| 443 | 3300044712 | Ga0453684_0919594 | Ga0453684_0919594_17_454 | 142 |
| 444 | 3300044712 | Ga0453684_1599998 | Ga0453684_1599998_159_608 | 142 |
| 445 | 3300045051 | Ga0451576_0235056 | Ga0451576_0235056_433_861 | 142 |
| 446 | 3300045051 | Ga0451576_0479912 | Ga0451576_0479912_386_820 | 142 |
| 447 | 3300045976 | Ga0466967_0978070 | Ga0466967_0978070_28_489 | 142 |
| 448 | 3300046459 | Ga0495629_0047965 | Ga0495629_0047965_1146_1598 | 142 |
| 449 | 3300046460 | Ga0495638_0009952 | Ga0495638_0009952_2669_3097 | 142 |
| 450 | 3300046472 | Ga0495580_0002689 | Ga0495580_0002689_13269_13721 | 142 |
| 451 | 3300046472 | Ga0495580_0010461 | Ga0495580_0010461_4249_4701 | 142 |
| 452 | 3300046472 | Ga0495580_0017921 | Ga0495580_0017921_4315_4767 | 142 |
| 453 | 3300046473 | Ga0495582_0006361 | Ga0495582_0006361_3727_4179 | 142 |
| 454 | 3300046535 | Ga0495586_0291870 | Ga0495586_0291870_253_681 | 142 |
| 455 | 3300046616 | Ga0495668_0095532 | Ga0495668_0095532_465_893 | 142 |
| 456 | 3300046660 | Ga0495625_0004733 | Ga0495625_0004733_1872_2300 | 142 |
| 457 | 3300046660 | Ga0495625_0272752 | Ga0495625_0272752_206_634 | 142 |
| 458 | 3300046689 | Ga0495613_0116569 | Ga0495613_0116569_397_849 | 142 |
| 459 | 3300047319 | Ga0495674_0202994 | Ga0495674_0202994_1030_1482 | 142 |
| 460 | 3300047472 | Ga0495686_0133702 | Ga0495686_0133702_35_463 | 142 |
| 461 | 3300047472 | Ga0495686_0533742 | Ga0495686_0533742_16_459 | 142 |
| 462 | 3300048912 | Ga0496109_1595980 | Ga0496109_1595980_30_458 | 142 |
| 463 | 3300048915 | Ga0496112_0307382 | Ga0496112_0307382_1006_1458 | 142 |
| 464 | 3300048924 | Ga0496121_0193920 | Ga0496121_0193920_26_454 | 142 |
| 465 | 3300049568 | Ga0501031_0005224 | Ga0501031_0005224_3546_3974 | 142 |
| 466 | 3300049568 | Ga0501031_0109242 | Ga0501031_0109242_1354_1782 | 142 |
| 467 | 3300049569 | Ga0501032_0001719 | Ga0501032_0001719_6221_6649 | 142 |
| 468 | 3300049570 | Ga0501033_0006165 | Ga0501033_0006165_1926_2354 | 142 |
| 469 | 3300049571 | Ga0501034_0003806 | Ga0501034_0003806_12831_13259 | 142 |
| 470 | 3300049572 | Ga0501036_0028440 | Ga0501036_0028440_61_489 | 142 |
| 471 | 3300049572 | Ga0501036_0679887 | Ga0501036_0679887_322_750 | 142 |
| 472 | 3300049572 | Ga0501036_0938561 | Ga0501036_0938561_247_675 | 142 |
| 473 | 3300049573 | Ga0501037_0001849 | Ga0501037_0001849_10286_10714 | 142 |
| 474 | 3300049573 | Ga0501037_0785526 | Ga0501037_0785526_122_550 | 142 |
| 475 | 3300049574 | Ga0501038_0010417 | Ga0501038_0010417_6015_6443 | 142 |
| 476 | 3300049574 | Ga0501038_0993482 | Ga0501038_0993482_12_440 | 142 |
| 477 | 3300049575 | Ga0501039_0055013 | Ga0501039_0055013_232_660 | 142 |
| 478 | 3300049575 | Ga0501039_0491004 | Ga0501039_0491004_84_512 | 142 |
| 479 | 3300049576 | Ga0501040_0013337 | Ga0501040_0013337_2957_3385 | 142 |
| 480 | 3300049576 | Ga0501040_0078339 | Ga0501040_0078339_326_754 | 142 |
| 481 | 3300049577 | Ga0501041_0059303 | Ga0501041_0059303_274_702 | 142 |
| 482 | 3300049577 | Ga0501041_0818963 | Ga0501041_0818963_100_528 | 142 |
| 483 | 3300049578 | Ga0501042_0003484 | Ga0501042_0003484_6685_7113 | 142 |
| 484 | 3300049579 | Ga0501043_0024125 | Ga0501043_0024125_2047_2475 | 142 |
| 485 | 3300049580 | Ga0501046_0039267 | Ga0501046_0039267_3304_3732 | 142 |
| 486 | 3300049580 | Ga0501046_0052981 | Ga0501046_0052981_233_661 | 142 |
| 487 | 3300049580 | Ga0501046_1260325 | Ga0501046_1260325_39_467 | 142 |
| 488 | 3300049581 | Ga0501047_0012877 | Ga0501047_0012877_105_533 | 142 |
| 489 | 3300049583 | Ga0501067_0363108 | Ga0501067_0363108_52_480 | 142 |
| 490 | 3300049584 | Ga0501068_0040096 | Ga0501068_0040096_223_651 | 142 |
| 491 | 3300049587 | Ga0501071_0012726 | Ga0501071_0012726_3178_3606 | 142 |
| 492 | 3300049588 | Ga0501072_0020521 | Ga0501072_0020521_2374_2802 | 142 |
| 493 | 3300049588 | Ga0501072_0138106 | Ga0501072_0138106_947_1375 | 142 |
| 494 | 3300049589 | Ga0501073_0028945 | Ga0501073_0028945_1390_1818 | 142 |
| 495 | 3300049589 | Ga0501073_0080656 | Ga0501073_0080656_67_495 | 142 |
| 496 | 3300049590 | Ga0501074_0067503 | Ga0501074_0067503_1953_2381 | 142 |
| 497 | 3300049591 | Ga0501075_0006371 | Ga0501075_0006371_6017_6445 | 142 |
| 498 | 3300049592 | Ga0501076_0082269 | Ga0501076_0082269_1806_2234 | 142 |
| 499 | 3300049592 | Ga0501076_0160903 | Ga0501076_0160903_866_1294 | 142 |
| 500 | 3300049593 | Ga0501077_0042260 | Ga0501077_0042260_352_780 | 142 |
| 501 | 3300049741 | Ga0501079_0033421 | Ga0501079_0033421_734_1162 | 142 |
| 502 | 3300049742 | Ga0501080_0016690 | Ga0501080_0016690_4574_5002 | 142 |
| 503 | 3300049742 | Ga0501080_0276183 | Ga0501080_0276183_367_795 | 142 |
| 504 | 3300049743 | Ga0501081_0041085 | Ga0501081_0041085_740_1168 | 142 |
| 505 | 3300049822 | Ga0501035_0017998 | Ga0501035_0017998_3582_4010 | 142 |
| 506 | 3300049823 | Ga0501044_0043013 | Ga0501044_0043013_2130_2558 | 142 |
| 507 | 3300049824 | Ga0501045_0445588 | Ga0501045_0445588_84_512 | 142 |
| 508 | 3300050507 | nmdc:mga05p37_209785_c1 | nmdc:mga05p37_209785_c1_223_654 | 142 |
| 509 | 3300050507 | nmdc:mga05p37_916190_c1 | nmdc:mga05p37_916190_c1_133_561 | 142 |
| 510 | 3300050508 | nmdc:mga09592_114852_c1 | nmdc:mga09592_114852_c1_875_1303 | 142 |
| 511 | 3300050508 | nmdc:mga09592_273690_c1 | nmdc:mga09592_273690_c1_236_667 | 142 |
| 512 | 3300050508 | nmdc:mga09592_284269_c1 | nmdc:mga09592_284269_c1_891_1319 | 142 |
| 513 | 3300050508 | nmdc:mga09592_347831_c1 | nmdc:mga09592_347831_c1_774_1202 | 142 |
| 514 | 3300050509 | nmdc:mga0qj67_185092_c1 | nmdc:mga0qj67_185092_c1_1150_1581 | 142 |
| 515 | 3300050509 | nmdc:mga0qj67_3864_c1 | nmdc:mga0qj67_3864_c1_4907_5338 | 142 |
| 516 | 3300050510 | nmdc:mga06r32_117975_c1 | nmdc:mga06r32_117975_c1_1283_1714 | 142 |
| 517 | 3300050510 | nmdc:mga06r32_46293_c1 | nmdc:mga06r32_46293_c1_3377_3808 | 142 |
| 518 | 3300050510 | nmdc:mga06r32_534471_c1 | nmdc:mga06r32_534471_c1_55_483 | 142 |
| 519 | 3300050510 | nmdc:mga06r32_64504_c1 | nmdc:mga06r32_64504_c1_1280_1708 | 142 |
| 520 | 3300050510 | nmdc:mga06r32_92012_c1 | nmdc:mga06r32_92012_c1_75_503 | 142 |
| 521 | 3300050511 | nmdc:mga08y16_157573_c1 | nmdc:mga08y16_157573_c1_1772_2200 | 142 |
| 522 | 3300050511 | nmdc:mga08y16_363509_c1 | nmdc:mga08y16_363509_c1_381_812 | 142 |
| 523 | 3300050511 | nmdc:mga08y16_736736_c1 | nmdc:mga08y16_736736_c1_331_759 | 142 |
| 524 | 3300050512 | nmdc:mga0n895_1522552_c1 | nmdc:mga0n895_1522552_c1_44_472 | 142 |
| 525 | 3300053079 | Ga0500610_0454064 | Ga0500610_0454064_44_472 | 142 |
| 526 | 3300053088 | Ga0500644_0016504 | Ga0500644_0016504_179_610 | 142 |
| 527 | 3300053092 | Ga0500583_0011885 | Ga0500583_0011885_501_929 | 142 |
| 528 | 3300053099 | Ga0500654_168831 | Ga0500654_168831_156_584 | 142 |
| 529 | 3300053108 | Ga0500562_000033 | Ga0500562_000033_21831_22262 | 142 |
| 530 | 3300053108 | Ga0500562_127286 | Ga0500562_127286_29_457 | 142 |
| 531 | 3300053118 | Ga0500594_0073161 | Ga0500594_0073161_474_905 | 142 |
| 532 | 3300053139 | Ga0500568_0021082 | Ga0500568_0021082_873_1301 | 142 |
| 533 | 3300053139 | Ga0500568_0056455 | Ga0500568_0056455_479_907 | 142 |
| 534 | 3300053139 | Ga0500568_0222447 | Ga0500568_0222447_29_457 | 142 |
| 535 | 3300053147 | Ga0500589_144486 | Ga0500589_144486_70_498 | 142 |
| 536 | 3300053153 | Ga0500616_0042300 | Ga0500616_0042300_1333_1761 | 142 |
| 537 | 3300053153 | Ga0500616_0191690 | Ga0500616_0191690_434_862 | 142 |
| 538 | 3300053156 | Ga0500622_0002345 | Ga0500622_0002345_6111_6539 | 142 |
| 539 | 3300053156 | Ga0500622_0003964 | Ga0500622_0003964_2961_3404 | 142 |
| 540 | 3300053156 | Ga0500622_0004622 | Ga0500622_0004622_3371_3799 | 142 |
| 541 | 3300053178 | Ga0500637_0050333 | Ga0500637_0050333_1218_1646 | 142 |
| 542 | 3300054114 | Ga0501084_0061838 | Ga0501084_0061838_2051_2479 | 142 |
| 543 | 3300054114 | Ga0501084_0675890 | Ga0501084_0675890_384_812 | 142 |
| 544 | 3300055283 | Ga0500661_003241 | Ga0500661_003241_2205_2636 | 142 |
| 545 | 3300060353 | Ga0501082_0028417 | Ga0501082_0028417_4160_4588 | 142 |
| 546 | 3300060353 | Ga0501082_0030265 | Ga0501082_0030265_1924_2352 | 142 |
| 547 | 3300060353 | Ga0501082_0168989 | Ga0501082_0168989_793_1221 | 142 |
| 548 | 3300061734 | Ga0530510_0336796 | Ga0530510_0336796_143_571 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4fry-assembly1.cif.gz_A | the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 | 0.9645 | 2 | 129 |
| 2rc3-assembly2.cif.gz_B | crystal structure of cbs domain, ne2398 | 0.962 | 2 | 126 |
| 3fhm-assembly2.cif.gz_B | crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens | 0.9502 | 2 | 124 |
| 2rc3-assembly1.cif.gz_D | crystal structure of cbs domain, ne2398 | 0.948 | 1 | 126 |
| 3fhm-assembly2.cif.gz_C | crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens | 0.9446 | 3 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fryA00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9645 | 2 | 129 | 3.10.580.10 |
| af_P71737_1_141_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.963 | 2 | 142 | 3.10.580.10 |
| af_O13965_237_391_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9587 | 2 | 125 | 3.10.580.10 |
| af_P71737_1_141_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9564 | 2 | 142 | 3.10.580.10 |
| af_A0A1D6Q1S7_52_188_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.956 | 3 | 123 | 3.10.580.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4BV57-F1-model_v4 | CBS domain-containing protein | 0.9898 | 2 | 131 |
|
| AF-A0A7W7YAX3-F1-model_v4 | CBS domain-containing protein | 0.9884 | 2 | 122 |
|
| AF-A0A838FTB4-F1-model_v4 | CBS domain-containing protein | 0.9861 | 2 | 130 |
|
| AF-A0A7V7DYX7-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9858 | 1 | 130 |
GO:0016772
|
| AF-T1B6V4-F1-model_v4 | Signal-transduction protein with CBS domain protein | 0.9842 | 1 | 117 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar