F462162
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 547 | 322 | 531 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_16581_c1|nmdc:mga0k408_16581_c1_1450_2634 |
| Length | 394 |
| Sequence | MAGRLGSGPALGPPPIRPLLIPDPHKDRQKPSLDGCADLLSIRALSSNRQPTLPAAMFPILRSPVRRLLVAAAATLSLPAFAATTLLNVSYDVARELYKEINPAFQKSWKASTGEDLTINQSHGGSSKQARSVLDGLEADVVTMNQSSDIDVLATRGKLIPADWAKRLPNNAAPTTSVTVILVRKGNPKGIKDWPDLAKAGTSVVIPNPKITGNGRYTYVAAWGSAIKAGGTPAQARELVQKIFANVPVFDGGGRAATTTFAQRGIGDALATFESEVNLIKSEFGDHFDVVYPSSTILAENPVSVVDKVVDKKGTRKQAEAYLKFLWSDEAQEIAAKHQLRPRSAALLAKYTKDFPKVTTFTIDEVFGGWTQAQKEHFDDGAIYDQILAAGKKQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 5 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 6 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 7 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 10 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 11 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 12 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 13 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 14 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 15 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 16 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 190 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 192 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 211 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 226 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 227 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 228 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 229 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 230 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 231 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 293 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 294 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 298 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 299 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 300 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 302 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 309 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 310 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 311 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 312 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 313 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 314 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 315 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 316 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 317 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 318 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 319 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 320 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 321 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 322 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.16 |
| Metatranscriptomes | 0.91 |
| Isolates | 2.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.43 |
| Nodule | 0.37 |
| Rhizoplane | 4.57 |
| Rhizosphere | 75.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10009649 | 3300002077 | Bacteria | 1981 |
| 2 | JGI25156J39149_1010588 | 3300002705 | Bacteria | 2156 |
| 3 | JGI25153J46596_10001786 | 3300003215 | Bacteria | 12758 |
| 4 | rootH2_10029312 | 3300003320 | Bacteria | 9084 |
| 5 | rootL2_10019891 | 3300003322 | Bacteria | 13677 |
| 6 | rootL2_10131798 | 3300003322 | Bacteria | 3742 |
| 7 | rootH1_10012734 | 3300003323 | Bacteria | 15075 |
| 8 | rootH1_10185320 | 3300003323 | Bacteria | 4318 |
| 9 | Ga0055533_1000011 | 3300003756 | Bacteria | 467893 |
| 10 | Ga0055525_1000468 | 3300003759 | Bacteria | 22440 |
| 11 | Ga0055535_1000107 | 3300003761 | Bacteria | 89840 |
| 12 | Ga0055529_1000111 | 3300003763 | Bacteria | 118734 |
| 13 | Ga0055526_1000070 | 3300003771 | Bacteria | 96845 |
| 14 | Ga0055526_1003988 | 3300003771 | Bacteria | 9085 |
| 15 | Ga0055524_1000227 | 3300003775 | Bacteria | 59891 |
| 16 | Ga0055530_10008633 | 3300003791 | Bacteria | 4040 |
| 17 | Ga0055540_1000112 | 3300003792 | Bacteria | 88200 |
| 18 | Ga0055540_1011087 | 3300003792 | Bacteria | 2941 |
| 19 | Ga0055531_10000021 | 3300003794 | Bacteria | 167213 |
| 20 | Ga0055531_10021676 | 3300003794 | Bacteria | 2481 |
| 21 | Ga0065165_1000707 | 3300005262 | Bacteria | 47352 |
| 22 | Ga0065715_10009227 | 3300005293 | Bacteria | 4164 |
| 23 | Ga0070658_10087406 | 3300005327 | Bacteria | 2566 |
| 24 | Ga0070658_10253365 | 3300005327 | Bacteria | 1493 |
| 25 | Ga0070658_10370031 | 3300005327 | Bacteria | 1228 |
| 26 | Ga0070676_10008107 | 3300005328 | Bacteria | 5650 |
| 27 | Ga0070676_10040392 | 3300005328 | Bacteria | 2702 |
| 28 | Ga0070676_10041692 | 3300005328 | Bacteria | 2663 |
| 29 | Ga0070683_100064962 | 3300005329 | Bacteria | 3397 |
| 30 | Ga0070683_100088191 | 3300005329 | Bacteria | 2910 |
| 31 | Ga0070683_100198468 | 3300005329 | Bacteria | 1905 |
| 32 | Ga0070690_100057470 | 3300005330 | Bacteria | 2497 |
| 33 | Ga0070670_100006130 | 3300005331 | Bacteria | 10167 |
| 34 | Ga0070670_100015540 | 3300005331 | Bacteria | 6537 |
| 35 | Ga0070670_100077509 | 3300005331 | Bacteria | 2855 |
| 36 | Ga0070670_100081313 | 3300005331 | Bacteria | 2784 |
| 37 | Ga0070677_10017591 | 3300005333 | Bacteria | 2561 |
| 38 | Ga0068869_100003187 | 3300005334 | Bacteria | 10022 |
| 39 | Ga0068869_100042093 | 3300005334 | Bacteria | 3274 |
| 40 | Ga0068869_100045356 | 3300005334 | Bacteria | 3164 |
| 41 | Ga0070666_10001924 | 3300005335 | Bacteria | 12627 |
| 42 | Ga0070666_10221256 | 3300005335 | Bacteria | 1335 |
| 43 | Ga0070666_10233765 | 3300005335 | Bacteria | 1299 |
| 44 | Ga0070680_100005902 | 3300005336 | Bacteria | 9301 |
| 45 | Ga0068868_100001433 | 3300005338 | Bacteria | 16455 |
| 46 | Ga0068868_100003192 | 3300005338 | Bacteria | 11404 |
| 47 | Ga0070660_100243605 | 3300005339 | Bacteria | 1465 |
| 48 | Ga0070689_100346599 | 3300005340 | Bacteria | 1245 |
| 49 | Ga0070687_100054457 | 3300005343 | Bacteria | 2085 |
| 50 | Ga0070661_100012722 | 3300005344 | Bacteria | 5889 |
| 51 | Ga0070661_100128726 | 3300005344 | Bacteria | 1900 |
| 52 | Ga0070661_100141862 | 3300005344 | Bacteria | 1811 |
| 53 | Ga0070661_100322578 | 3300005344 | Bacteria | 1206 |
| 54 | Ga0070668_100019089 | 3300005347 | Bacteria | 5154 |
| 55 | Ga0070669_100030933 | 3300005353 | Bacteria | 3864 |
| 56 | Ga0070669_100193271 | 3300005353 | Bacteria | 1597 |
| 57 | Ga0070675_100004634 | 3300005354 | Bacteria | 10501 |
| 58 | Ga0070675_100012627 | 3300005354 | Bacteria | 6624 |
| 59 | Ga0070675_100018720 | 3300005354 | Bacteria | 5512 |
| 60 | Ga0070675_100196771 | 3300005354 | Bacteria | 1748 |
| 61 | Ga0070675_100236953 | 3300005354 | Bacteria | 1593 |
| 62 | Ga0070671_100028423 | 3300005355 | Bacteria | 4604 |
| 63 | Ga0070671_100325800 | 3300005355 | Bacteria | 1309 |
| 64 | Ga0070674_100010654 | 3300005356 | Bacteria | 5570 |
| 65 | Ga0070674_100147199 | 3300005356 | Bacteria | 1774 |
| 66 | Ga0070673_100015595 | 3300005364 | Bacteria | 5344 |
| 67 | Ga0070673_100034120 | 3300005364 | Bacteria | 3847 |
| 68 | Ga0070688_100010026 | 3300005365 | Bacteria | 5206 |
| 69 | Ga0070659_100002488 | 3300005366 | Bacteria | 13084 |
| 70 | Ga0070659_100015279 | 3300005366 | Bacteria | 5748 |
| 71 | Ga0070659_100263807 | 3300005366 | Bacteria | 1429 |
| 72 | Ga0070659_100339730 | 3300005366 | Bacteria | 1258 |
| 73 | Ga0070667_100003252 | 3300005367 | Bacteria | 13886 |
| 74 | Ga0070667_100011203 | 3300005367 | Bacteria | 7419 |
| 75 | Ga0070700_100021791 | 3300005441 | Bacteria | 3728 |
| 76 | Ga0070663_100267990 | 3300005455 | Bacteria | 1357 |
| 77 | Ga0070678_100013316 | 3300005456 | Bacteria | 5152 |
| 78 | Ga0070678_100064748 | 3300005456 | Bacteria | 2710 |
| 79 | Ga0070662_100001070 | 3300005457 | Bacteria | 16689 |
| 80 | Ga0070662_100002870 | 3300005457 | Bacteria | 10690 |
| 81 | Ga0070662_100045787 | 3300005457 | Bacteria | 3140 |
| 82 | Ga0070662_100165515 | 3300005457 | Bacteria | 1732 |
| 83 | Ga0068867_100000036 | 3300005459 | Bacteria | 81113 |
| 84 | Ga0068867_100015847 | 3300005459 | Bacteria | 5350 |
| 85 | Ga0068867_100046698 | 3300005459 | Bacteria | 3181 |
| 86 | Ga0070706_100355960 | 3300005467 | Bacteria | 1364 |
| 87 | Ga0070679_100017484 | 3300005530 | Bacteria | 6941 |
| 88 | Ga0070684_100129983 | 3300005535 | Bacteria | 2271 |
| 89 | Ga0068853_100003281 | 3300005539 | Bacteria | 12370 |
| 90 | Ga0068853_100090822 | 3300005539 | Bacteria | 2684 |
| 91 | Ga0068853_100307180 | 3300005539 | Bacteria | 1467 |
| 92 | Ga0070672_100001996 | 3300005543 | Bacteria | 12809 |
| 93 | Ga0070672_100036630 | 3300005543 | Bacteria | 3738 |
| 94 | Ga0070672_100105390 | 3300005543 | Bacteria | 2292 |
| 95 | Ga0070672_100108461 | 3300005543 | Bacteria | 2260 |
| 96 | Ga0070672_100230853 | 3300005543 | Bacteria | 1555 |
| 97 | Ga0070686_100061741 | 3300005544 | Bacteria | 2422 |
| 98 | Ga0070693_100018518 | 3300005547 | Bacteria | 3639 |
| 99 | Ga0068855_100007253 | 3300005563 | Bacteria | 13442 |
| 100 | Ga0068855_100079641 | 3300005563 | Bacteria | 3799 |
| 101 | Ga0070664_100190400 | 3300005564 | Bacteria | 1827 |
| 102 | Ga0070664_100208800 | 3300005564 | Bacteria | 1745 |
| 103 | Ga0068857_100039125 | 3300005577 | Bacteria | 4200 |
| 104 | Ga0068857_100144011 | 3300005577 | Bacteria | 2155 |
| 105 | Ga0068854_100022165 | 3300005578 | Bacteria | 4322 |
| 106 | Ga0068854_100220463 | 3300005578 | Bacteria | 1500 |
| 107 | Ga0068856_100470658 | 3300005614 | Bacteria | 1277 |
| 108 | Ga0070702_100069884 | 3300005615 | Bacteria | 2071 |
| 109 | Ga0070702_100123254 | 3300005615 | Bacteria | 1626 |
| 110 | Ga0068852_100045093 | 3300005616 | Bacteria | 3748 |
| 111 | Ga0068852_100082887 | 3300005616 | Bacteria | 2851 |
| 112 | Ga0068852_100116127 | 3300005616 | Bacteria | 2441 |
| 113 | Ga0068852_100199145 | 3300005616 | Bacteria | 1894 |
| 114 | Ga0068859_100003467 | 3300005617 | Bacteria | 16040 |
| 115 | Ga0068859_100021684 | 3300005617 | Bacteria | 6447 |
| 116 | Ga0068864_100001208 | 3300005618 | Bacteria | 21454 |
| 117 | Ga0068864_100011910 | 3300005618 | Bacteria | 7182 |
| 118 | Ga0068864_100032262 | 3300005618 | Bacteria | 4449 |
| 119 | Ga0068864_100036794 | 3300005618 | Bacteria | 4174 |
| 120 | Ga0068864_100058060 | 3300005618 | Bacteria | 3343 |
| 121 | Ga0068861_100008773 | 3300005719 | Bacteria | 6962 |
| 122 | Ga0068861_100011385 | 3300005719 | Bacteria | 6181 |
| 123 | Ga0068863_100002785 | 3300005841 | Bacteria | 17318 |
| 124 | Ga0068863_100022314 | 3300005841 | Bacteria | 6043 |
| 125 | Ga0068858_100000436 | 3300005842 | Bacteria | 43518 |
| 126 | Ga0068858_100016124 | 3300005842 | Bacteria | 7019 |
| 127 | Ga0068858_100027483 | 3300005842 | Bacteria | 5285 |
| 128 | Ga0068858_100063430 | 3300005842 | Bacteria | 3419 |
| 129 | Ga0068860_100001260 | 3300005843 | Bacteria | 27630 |
| 130 | Ga0068860_100022605 | 3300005843 | Bacteria | 6080 |
| 131 | Ga0068860_100280612 | 3300005843 | Bacteria | 1628 |
| 132 | Ga0068862_100030222 | 3300005844 | Bacteria | 4565 |
| 133 | Ga0075363_100033553 | 3300006048 | Bacteria | 2674 |
| 134 | Ga0075366_10000823 | 3300006195 | Bacteria | 14890 |
| 135 | Ga0075366_10030750 | 3300006195 | Bacteria | 3158 |
| 136 | Ga0075366_10055154 | 3300006195 | Bacteria | 2360 |
| 137 | Ga0075366_10140097 | 3300006195 | Bacteria | 1462 |
| 138 | Ga0075366_10146802 | 3300006195 | Bacteria | 1427 |
| 139 | Ga0097621_100010262 | 3300006237 | Bacteria | 6843 |
| 140 | Ga0097621_100041421 | 3300006237 | Bacteria | 3708 |
| 141 | Ga0097621_100167092 | 3300006237 | Bacteria | 1894 |
| 142 | Ga0097621_100287171 | 3300006237 | Bacteria | 1449 |
| 143 | Ga0075370_10031514 | 3300006353 | Bacteria | 2960 |
| 144 | Ga0068871_100078765 | 3300006358 | Bacteria | 2725 |
| 145 | Ga0075430_100100883 | 3300006846 | Bacteria | 2410 |
| 146 | Ga0075430_100208152 | 3300006846 | Bacteria | 1623 |
| 147 | Ga0075429_100000756 | 3300006880 | Bacteria | 25403 |
| 148 | Ga0097620_100003467 | 3300006931 | Bacteria | 16040 |
| 149 | Ga0097620_100021684 | 3300006931 | Bacteria | 6447 |
| 150 | Ga0079104_1000024 | 3300006946 | Bacteria | 219543 |
| 151 | Ga0105240_10068912 | 3300009093 | Bacteria | 4381 |
| 152 | Ga0105240_10209141 | 3300009093 | Bacteria | 2281 |
| 153 | Ga0111539_10423514 | 3300009094 | Bacteria | 1550 |
| 154 | Ga0105245_10363798 | 3300009098 | Bacteria | 1436 |
| 155 | Ga0105247_10047738 | 3300009101 | Bacteria | 2630 |
| 156 | Ga0105243_10001240 | 3300009148 | Bacteria | 22981 |
| 157 | Ga0105243_10022977 | 3300009148 | Bacteria | 4743 |
| 158 | Ga0105243_10118756 | 3300009148 | Bacteria | 2226 |
| 159 | Ga0105241_10067363 | 3300009174 | Bacteria | 2771 |
| 160 | Ga0105242_10194341 | 3300009176 | Bacteria | 1798 |
| 161 | Ga0105242_10207958 | 3300009176 | Bacteria | 1742 |
| 162 | Ga0105248_10006273 | 3300009177 | Bacteria | 13041 |
| 163 | Ga0105248_10024158 | 3300009177 | Bacteria | 6755 |
| 164 | Ga0105248_10047429 | 3300009177 | Bacteria | 4817 |
| 165 | Ga0105248_10102510 | 3300009177 | Bacteria | 3225 |
| 166 | Ga0105248_10247246 | 3300009177 | Bacteria | 2008 |
| 167 | Ga0105237_10586999 | 3300009545 | Bacteria | 1121 |
| 168 | Ga0105238_10216528 | 3300009551 | Bacteria | 1891 |
| 169 | Ga0105238_10260369 | 3300009551 | Bacteria | 1714 |
| 170 | Ga0105249_10008506 | 3300009553 | Bacteria | 8946 |
| 171 | Ga0105249_10257469 | 3300009553 | Bacteria | 1732 |
| 172 | Ga0105239_10146529 | 3300010375 | Bacteria | 2634 |
| 173 | Ga0157373_10030122 | 3300013100 | Bacteria | 3905 |
| 174 | Ga0157369_10188410 | 3300013105 | Bacteria | 2168 |
| 175 | Ga0157374_10345981 | 3300013296 | Bacteria | 1477 |
| 176 | Ga0163162_10007061 | 3300013306 | Bacteria | 10891 |
| 177 | Ga0163162_10039424 | 3300013306 | Bacteria | 4720 |
| 178 | Ga0163162_10069032 | 3300013306 | Bacteria | 3586 |
| 179 | Ga0163162_10487707 | 3300013306 | Bacteria | 1363 |
| 180 | Ga0157372_10267700 | 3300013307 | Bacteria | 1985 |
| 181 | Ga0157375_10079578 | 3300013308 | Bacteria | 3313 |
| 182 | Ga0157375_10108585 | 3300013308 | Bacteria | 2870 |
| 183 | Ga0157375_10184820 | 3300013308 | Bacteria | 2237 |
| 184 | Ga0157375_10869704 | 3300013308 | Bacteria | 1047 |
| 185 | Ga0163163_10104206 | 3300014325 | Bacteria | 2861 |
| 186 | Ga0163163_10335187 | 3300014325 | Bacteria | 1568 |
| 187 | Ga0157380_10033970 | 3300014326 | Bacteria | 3931 |
| 188 | Ga0157380_10071692 | 3300014326 | Bacteria | 2803 |
| 189 | Ga0157380_10103460 | 3300014326 | Bacteria | 2376 |
| 190 | Ga0157377_10000010 | 3300014745 | Bacteria | 380929 |
| 191 | Ga0157377_10002392 | 3300014745 | Bacteria | 8275 |
| 192 | Ga0157379_10008733 | 3300014968 | Bacteria | 8832 |
| 193 | Ga0157379_10008941 | 3300014968 | Bacteria | 8731 |
| 194 | Ga0157379_10016132 | 3300014968 | Bacteria | 6570 |
| 195 | Ga0157379_10021355 | 3300014968 | Bacteria | 5729 |
| 196 | Ga0157376_10077274 | 3300014969 | Bacteria | 2847 |
| 197 | Ga0157376_10189434 | 3300014969 | Bacteria | 1885 |
| 198 | Ga0163161_10084417 | 3300017792 | Bacteria | 2342 |
| 199 | Ga0163161_10094822 | 3300017792 | Bacteria | 2213 |
| 200 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 201 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 202 | Ga0207427_100869 | 3300025231 | Bacteria | 13370 |
| 203 | Ga0209258_100267 | 3300025242 | Bacteria | 89896 |
| 204 | Ga0207425_1000328 | 3300025245 | Bacteria | 33571 |
| 205 | Ga0209677_100068 | 3300025253 | Bacteria | 146135 |
| 206 | Ga0209677_103116 | 3300025253 | Bacteria | 5635 |
| 207 | Ga0209759_1000847 | 3300025256 | Bacteria | 23854 |
| 208 | Ga0209759_1001246 | 3300025256 | Bacteria | 15442 |
| 209 | Ga0209759_1002289 | 3300025256 | Bacteria | 8640 |
| 210 | Ga0209759_1011814 | 3300025256 | Bacteria | 2456 |
| 211 | Ga0209129_1000035 | 3300025258 | Bacteria | 329303 |
| 212 | Ga0209565_1014805 | 3300025263 | Bacteria | 1779 |
| 213 | Ga0209455_1000158 | 3300025272 | Bacteria | 118973 |
| 214 | Ga0209673_1003283 | 3300025273 | Bacteria | 9734 |
| 215 | Ga0209675_1011720 | 3300025291 | Bacteria | 2888 |
| 216 | Ga0209564_1000024 | 3300025295 | Bacteria | 535041 |
| 217 | Ga0209758_1000066 | 3300025297 | Bacteria | 298620 |
| 218 | Ga0209758_1000213 | 3300025297 | Bacteria | 126745 |
| 219 | Ga0209050_1000178 | 3300025298 | Bacteria | 145314 |
| 220 | Ga0209050_1004228 | 3300025298 | Bacteria | 9879 |
| 221 | Ga0209050_1004728 | 3300025298 | Bacteria | 9009 |
| 222 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 223 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 224 | Ga0209051_1009600 | 3300025303 | Bacteria | 4969 |
| 225 | Ga0209257_1000032 | 3300025304 | Bacteria | 680354 |
| 226 | Ga0209257_1000510 | 3300025304 | Bacteria | 67777 |
| 227 | Ga0209257_1017020 | 3300025304 | Bacteria | 2893 |
| 228 | Ga0207697_10082366 | 3300025315 | Bacteria | 1357 |
| 229 | Ga0207682_10048335 | 3300025893 | Bacteria | 1753 |
| 230 | Ga0207642_10038849 | 3300025899 | Bacteria | 2063 |
| 231 | Ga0207688_10081050 | 3300025901 | Bacteria | 1853 |
| 232 | Ga0207680_10014016 | 3300025903 | Bacteria | 4134 |
| 233 | Ga0207647_10137730 | 3300025904 | Bacteria | 1431 |
| 234 | Ga0207685_10033492 | 3300025905 | Bacteria | 1857 |
| 235 | Ga0207645_10016926 | 3300025907 | Bacteria | 4817 |
| 236 | Ga0207645_10108134 | 3300025907 | Bacteria | 1799 |
| 237 | Ga0207705_10237955 | 3300025909 | Bacteria | 1386 |
| 238 | Ga0207695_10055277 | 3300025913 | Bacteria | 4138 |
| 239 | Ga0207695_10117379 | 3300025913 | Bacteria | 2634 |
| 240 | Ga0207695_10437014 | 3300025913 | Bacteria | 1192 |
| 241 | Ga0207671_10001444 | 3300025914 | Bacteria | 27486 |
| 242 | Ga0207660_10008400 | 3300025917 | Bacteria | 6680 |
| 243 | Ga0207657_10022586 | 3300025919 | Bacteria | 5882 |
| 244 | Ga0207649_10005583 | 3300025920 | Bacteria | 6803 |
| 245 | Ga0207649_10160956 | 3300025920 | Bacteria | 1555 |
| 246 | Ga0207652_10033780 | 3300025921 | Bacteria | 4308 |
| 247 | Ga0207681_10004364 | 3300025923 | Bacteria | 8718 |
| 248 | Ga0207681_10022723 | 3300025923 | Bacteria | 4003 |
| 249 | Ga0207681_10063833 | 3300025923 | Bacteria | 2541 |
| 250 | Ga0207694_10091166 | 3300025924 | Bacteria | 2405 |
| 251 | Ga0207694_10096331 | 3300025924 | Bacteria | 2340 |
| 252 | Ga0207650_10001175 | 3300025925 | Bacteria | 19267 |
| 253 | Ga0207650_10092072 | 3300025925 | Bacteria | 2318 |
| 254 | Ga0207659_10001653 | 3300025926 | Bacteria | 13245 |
| 255 | Ga0207659_10004285 | 3300025926 | Bacteria | 8626 |
| 256 | Ga0207659_10007056 | 3300025926 | Bacteria | 6893 |
| 257 | Ga0207644_10006285 | 3300025931 | Bacteria | 7739 |
| 258 | Ga0207644_10143772 | 3300025931 | Bacteria | 1839 |
| 259 | Ga0207690_10007581 | 3300025932 | Bacteria | 6439 |
| 260 | Ga0207690_10041443 | 3300025932 | Bacteria | 3017 |
| 261 | Ga0207690_10045373 | 3300025932 | Bacteria | 2903 |
| 262 | Ga0207690_10082677 | 3300025932 | Bacteria | 2246 |
| 263 | Ga0207706_10007806 | 3300025933 | Bacteria | 9877 |
| 264 | Ga0207706_10021986 | 3300025933 | Bacteria | 5725 |
| 265 | Ga0207706_10030321 | 3300025933 | Bacteria | 4825 |
| 266 | Ga0207706_10191472 | 3300025933 | Bacteria | 1795 |
| 267 | Ga0207686_10152492 | 3300025934 | Bacteria | 1610 |
| 268 | Ga0207686_10288811 | 3300025934 | Bacteria | 1213 |
| 269 | Ga0207709_10001721 | 3300025935 | Bacteria | 14755 |
| 270 | Ga0207709_10031240 | 3300025935 | Bacteria | 3108 |
| 271 | Ga0207709_10059906 | 3300025935 | Bacteria | 2371 |
| 272 | Ga0207670_10008723 | 3300025936 | Bacteria | 5741 |
| 273 | Ga0207669_10025495 | 3300025937 | Bacteria | 3197 |
| 274 | Ga0207669_10111422 | 3300025937 | Bacteria | 1835 |
| 275 | Ga0207669_10123838 | 3300025937 | Bacteria | 1761 |
| 276 | Ga0207669_10227133 | 3300025937 | Bacteria | 1375 |
| 277 | Ga0207691_10070596 | 3300025940 | Bacteria | 3153 |
| 278 | Ga0207691_10082895 | 3300025940 | Bacteria | 2879 |
| 279 | Ga0207711_10044076 | 3300025941 | Bacteria | 3807 |
| 280 | Ga0207711_10065978 | 3300025941 | Bacteria | 3129 |
| 281 | Ga0207711_10113253 | 3300025941 | Bacteria | 2415 |
| 282 | Ga0207711_10176853 | 3300025941 | Bacteria | 1939 |
| 283 | Ga0207689_10007748 | 3300025942 | Bacteria | 9399 |
| 284 | Ga0207689_10018156 | 3300025942 | Bacteria | 5939 |
| 285 | Ga0207689_10043151 | 3300025942 | Bacteria | 3728 |
| 286 | Ga0207689_10140581 | 3300025942 | Bacteria | 1988 |
| 287 | Ga0207661_10059056 | 3300025944 | Bacteria | 3089 |
| 288 | Ga0207679_10007653 | 3300025945 | Bacteria | 6862 |
| 289 | Ga0207679_10011113 | 3300025945 | Bacteria | 5813 |
| 290 | Ga0207679_10168631 | 3300025945 | Bacteria | 1800 |
| 291 | Ga0207679_10238516 | 3300025945 | Bacteria | 1539 |
| 292 | Ga0207667_10005517 | 3300025949 | Bacteria | 15432 |
| 293 | Ga0207667_10343829 | 3300025949 | Bacteria | 1522 |
| 294 | Ga0207651_10015996 | 3300025960 | Bacteria | 4378 |
| 295 | Ga0207651_10270416 | 3300025960 | Bacteria | 1399 |
| 296 | Ga0207712_10019737 | 3300025961 | Bacteria | 4405 |
| 297 | Ga0207668_10017174 | 3300025972 | Bacteria | 4529 |
| 298 | Ga0207668_10030692 | 3300025972 | Bacteria | 3534 |
| 299 | Ga0207640_10039484 | 3300025981 | Bacteria | 2988 |
| 300 | Ga0207658_10000458 | 3300025986 | Bacteria | 38200 |
| 301 | Ga0207658_10114517 | 3300025986 | Bacteria | 2138 |
| 302 | Ga0207677_10006505 | 3300026023 | Bacteria | 6418 |
| 303 | Ga0207677_10067696 | 3300026023 | Bacteria | 2503 |
| 304 | Ga0207677_10127528 | 3300026023 | Bacteria | 1926 |
| 305 | Ga0207677_10137769 | 3300026023 | Bacteria | 1864 |
| 306 | Ga0207703_10004646 | 3300026035 | Bacteria | 11216 |
| 307 | Ga0207703_10016146 | 3300026035 | Bacteria | 5820 |
| 308 | Ga0207703_10021127 | 3300026035 | Bacteria | 5095 |
| 309 | Ga0207703_10081579 | 3300026035 | Bacteria | 2696 |
| 310 | Ga0207639_10010143 | 3300026041 | Bacteria | 6517 |
| 311 | Ga0207639_10107749 | 3300026041 | Bacteria | 2264 |
| 312 | Ga0207678_10000924 | 3300026067 | Bacteria | 26847 |
| 313 | Ga0207678_10078251 | 3300026067 | Bacteria | 2832 |
| 314 | Ga0207708_10023923 | 3300026075 | Bacteria | 4619 |
| 315 | Ga0207702_10013557 | 3300026078 | Bacteria | 6771 |
| 316 | Ga0207702_10253805 | 3300026078 | Bacteria | 1653 |
| 317 | Ga0207641_10012454 | 3300026088 | Bacteria | 6973 |
| 318 | Ga0207641_10104424 | 3300026088 | Bacteria | 2501 |
| 319 | Ga0207641_10169855 | 3300026088 | Bacteria | 1989 |
| 320 | Ga0207648_10000037 | 3300026089 | Bacteria | 120856 |
| 321 | Ga0207676_10000221 | 3300026095 | Bacteria | 49106 |
| 322 | Ga0207676_10009712 | 3300026095 | Bacteria | 6841 |
| 323 | Ga0207676_10036213 | 3300026095 | Bacteria | 3752 |
| 324 | Ga0207676_10076456 | 3300026095 | Bacteria | 2705 |
| 325 | Ga0207676_10459123 | 3300026095 | Bacteria | 1202 |
| 326 | Ga0207674_10033930 | 3300026116 | Bacteria | 5339 |
| 327 | Ga0207674_10227592 | 3300026116 | Bacteria | 1813 |
| 328 | Ga0207674_10255040 | 3300026116 | Bacteria | 1701 |
| 329 | Ga0207675_100001459 | 3300026118 | Bacteria | 23702 |
| 330 | Ga0207675_100008112 | 3300026118 | Bacteria | 9895 |
| 331 | Ga0207683_10025002 | 3300026121 | Bacteria | 5149 |
| 332 | Ga0207683_10128341 | 3300026121 | Bacteria | 2280 |
| 333 | Ga0207683_10191247 | 3300026121 | Bacteria | 1858 |
| 334 | Ga0207698_10006139 | 3300026142 | Bacteria | 7478 |
| 335 | Ga0207698_10045436 | 3300026142 | Bacteria | 3309 |
| 336 | Ga0209281_1000104 | 3300027111 | Bacteria | 221056 |
| 337 | Ga0209974_10002408 | 3300027876 | Bacteria | 6779 |
| 338 | Ga0268266_10220107 | 3300028379 | Bacteria | 1745 |
| 339 | Ga0268265_10200089 | 3300028380 | Bacteria | 1732 |
| 340 | Ga0268265_10284748 | 3300028380 | Bacteria | 1480 |
| 341 | Ga0268264_10000963 | 3300028381 | Bacteria | 29539 |
| 342 | Ga0268264_10037911 | 3300028381 | Bacteria | 3976 |
| 343 | Ga0307515_10005576 | 3300028794 | Bacteria | 25454 |
| 344 | Ga0307515_10013844 | 3300028794 | Bacteria | 15023 |
| 345 | Ga0307515_10054018 | 3300028794 | Bacteria | 5908 |
| 346 | Ga0307515_10066151 | 3300028794 | Bacteria | 5012 |
| 347 | Ga0307515_10174440 | 3300028794 | Bacteria | 2126 |
| 348 | Ga0265324_10000232 | 3300029957 | Bacteria | 42039 |
| 349 | Ga0307512_10060993 | 3300030522 | Bacteria | 2910 |
| 350 | Ga0265332_10000030 | 3300031238 | Bacteria | 175141 |
| 351 | Ga0265328_10008511 | 3300031239 | Bacteria | 4226 |
| 352 | Ga0265331_10007217 | 3300031250 | Bacteria | 6451 |
| 353 | Ga0265327_10026013 | 3300031251 | Bacteria | 3398 |
| 354 | Ga0265316_10000180 | 3300031344 | Bacteria | 71764 |
| 355 | Ga0307513_10026447 | 3300031456 | Bacteria | 6689 |
| 356 | Ga0307513_10164049 | 3300031456 | Bacteria | 2109 |
| 357 | Ga0307408_100000056 | 3300031548 | Bacteria | 140709 |
| 358 | Ga0307408_100098777 | 3300031548 | Bacteria | 2220 |
| 359 | Ga0307508_10000142 | 3300031616 | Bacteria | 85288 |
| 360 | Ga0307514_10025162 | 3300031649 | Bacteria | 4813 |
| 361 | Ga0307516_10000517 | 3300031730 | Bacteria | 51613 |
| 362 | Ga0307516_10007360 | 3300031730 | Bacteria | 12668 |
| 363 | Ga0307516_10217260 | 3300031730 | Bacteria | 1623 |
| 364 | Ga0307413_10219676 | 3300031824 | Bacteria | 1387 |
| 365 | Ga0307410_10271308 | 3300031852 | Bacteria | 1327 |
| 366 | Ga0307412_10236148 | 3300031911 | Bacteria | 1411 |
| 367 | Ga0307409_100006655 | 3300031995 | Bacteria | 6822 |
| 368 | Ga0307416_100019732 | 3300032002 | Bacteria | 4788 |
| 369 | Ga0307416_100073360 | 3300032002 | Bacteria | 2853 |
| 370 | Ga0307414_10006110 | 3300032004 | Bacteria | 6687 |
| 371 | Ga0307411_10000184 | 3300032005 | Bacteria | 20004 |
| 372 | Ga0307411_10004105 | 3300032005 | Bacteria | 6908 |
| 373 | Ga0307415_100042363 | 3300032126 | Bacteria | 3029 |
| 374 | Ga0307507_10141672 | 3300033179 | Bacteria | 1841 |
| 375 | Ga0373959_0021180 | 3300034820 | Bacteria | 1246 |
| 376 | Ga0373939_0000063 | 3300035114 | Bacteria | 36084 |
| 377 | Ga0373945_0087807 | 3300035116 | Bacteria | 1200 |
| 378 | Ga0373960_0000294 | 3300035121 | Bacteria | 9505 |
| 379 | Ga0373960_0005051 | 3300035121 | Bacteria | 3040 |
| 380 | Ga0373946_0034374 | 3300035171 | Bacteria | 2047 |
| 381 | Ga0373931_0000870 | 3300035691 | Bacteria | 12748 |
| 382 | Ga0373931_0003270 | 3300035691 | Bacteria | 7251 |
| 383 | Ga0373931_0094987 | 3300035691 | Bacteria | 1668 |
| 384 | Ga0373927_0043918 | 3300035695 | Bacteria | 2893 |
| 385 | Ga0373947_0113054 | 3300035725 | Bacteria | 1718 |
| 386 | Ga0373937_0123177 | 3300036401 | Bacteria | 2417 |
| 387 | Ga0373937_0190646 | 3300036401 | Bacteria | 1926 |
| 388 | Ga0395905_0001528 | 3300037471 | Bacteria | 27686 |
| 389 | Ga0395905_0004284 | 3300037471 | Bacteria | 14874 |
| 390 | Ga0395905_0012063 | 3300037471 | Bacteria | 8328 |
| 391 | Ga0395905_0053882 | 3300037471 | Bacteria | 3764 |
| 392 | Ga0395905_0265972 | 3300037471 | Bacteria | 1600 |
| 393 | Ga0436361_0050220 | 3300039447 | Bacteria | 22165 |
| 394 | Ga0436363_1083478 | 3300039450 | Bacteria | 2645 |
| 395 | Ga0451793_1867563 | 3300041452 | Bacteria | 3436 |
| 396 | Ga0451853_2247177 | 3300041512 | Bacteria | 1147 |
| 397 | Ga0439437_000891 | 3300042000 | Bacteria | 3111 |
| 398 | Ga0439455_0008313 | 3300042012 | Bacteria | 2220 |
| 399 | Ga0450888_000764 | 3300042126 | Bacteria | 3080 |
| 400 | Ga0450891_000139 | 3300042129 | Bacteria | 6631 |
| 401 | Ga0450892_000941 | 3300042130 | Bacteria | 3136 |
| 402 | Ga0450899_005450 | 3300042135 | Bacteria | 1368 |
| 403 | Ga0439464_0001824 | 3300042439 | Bacteria | 5139 |
| 404 | Ga0451577_0216782 | 3300042876 | Bacteria | 1730 |
| 405 | Ga0466969_0000157 | 3300044656 | Bacteria | 36880 |
| 406 | Ga0466969_0037501 | 3300044656 | Bacteria | 2444 |
| 407 | Ga0466972_0010902 | 3300044658 | Bacteria | 4561 |
| 408 | Ga0466965_0003866 | 3300044683 | Bacteria | 6618 |
| 409 | Ga0466965_0083787 | 3300044683 | Bacteria | 1614 |
| 410 | Ga0466966_0010737 | 3300044684 | Bacteria | 6089 |
| 411 | Ga0466966_0015258 | 3300044684 | Bacteria | 5080 |
| 412 | Ga0466961_0061275 | 3300044693 | Bacteria | 2391 |
| 413 | Ga0453684_0008823 | 3300044712 | Bacteria | 17877 |
| 414 | Ga0466971_0011291 | 3300044719 | Bacteria | 3913 |
| 415 | Ga0466971_0040395 | 3300044719 | Bacteria | 2095 |
| 416 | Ga0466968_0082237 | 3300044735 | Bacteria | 1417 |
| 417 | Ga0466970_0007109 | 3300044765 | Bacteria | 5602 |
| 418 | Ga0466960_0070087 | 3300044901 | Bacteria | 1743 |
| 419 | Ga0466959_0011523 | 3300045049 | Bacteria | 6356 |
| 420 | Ga0466959_0075544 | 3300045049 | Bacteria | 2434 |
| 421 | Ga0466959_0085138 | 3300045049 | Bacteria | 2275 |
| 422 | Ga0451576_0001435 | 3300045051 | Bacteria | 40749 |
| 423 | Ga0451576_0032586 | 3300045051 | Bacteria | 5546 |
| 424 | Ga0451576_0081201 | 3300045051 | Bacteria | 3372 |
| 425 | Ga0451576_0167851 | 3300045051 | Bacteria | 2290 |
| 426 | Ga0466958_0028498 | 3300045836 | Bacteria | 3311 |
| 427 | Ga0495590_0003984 | 3300046457 | Bacteria | 5998 |
| 428 | Ga0495629_0060333 | 3300046459 | Bacteria | 2651 |
| 429 | Ga0495638_0049107 | 3300046460 | Bacteria | 2639 |
| 430 | Ga0495650_0000329 | 3300046471 | Bacteria | 84971 |
| 431 | Ga0495639_0017217 | 3300046475 | Bacteria | 3139 |
| 432 | Ga0495585_0008761 | 3300046492 | Bacteria | 6116 |
| 433 | Ga0495607_0128902 | 3300046501 | Bacteria | 1319 |
| 434 | Ga0495583_0000628 | 3300046506 | Bacteria | 47247 |
| 435 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 436 | Ga0495606_0001339 | 3300046507 | Bacteria | 33542 |
| 437 | Ga0495610_0001848 | 3300046512 | Bacteria | 18355 |
| 438 | Ga0495610_0016504 | 3300046512 | Bacteria | 4246 |
| 439 | Ga0495620_0035573 | 3300046515 | Bacteria | 2237 |
| 440 | Ga0495632_0003423 | 3300046519 | Bacteria | 11276 |
| 441 | Ga0495632_0019378 | 3300046519 | Bacteria | 3708 |
| 442 | Ga0495643_0042463 | 3300046522 | Bacteria | 2477 |
| 443 | Ga0495648_0057782 | 3300046524 | Bacteria | 2324 |
| 444 | Ga0495621_0000904 | 3300046539 | Bacteria | 7543 |
| 445 | Ga0495645_0061193 | 3300046543 | Bacteria | 2728 |
| 446 | Ga0495668_0000474 | 3300046616 | Bacteria | 50676 |
| 447 | Ga0495668_0033330 | 3300046616 | Bacteria | 2894 |
| 448 | Ga0495625_0003318 | 3300046660 | Bacteria | 16212 |
| 449 | Ga0495647_0006716 | 3300046681 | Bacteria | 3828 |
| 450 | Ga0495647_0018493 | 3300046681 | Bacteria | 2482 |
| 451 | Ga0495658_0006191 | 3300046683 | Bacteria | 5875 |
| 452 | Ga0495670_0078754 | 3300046691 | Bacteria | 1677 |
| 453 | Ga0495649_0000386 | 3300046694 | Bacteria | 38357 |
| 454 | Ga0495589_0019325 | 3300046794 | Bacteria | 3495 |
| 455 | Ga0495600_0060720 | 3300046809 | Bacteria | 2469 |
| 456 | Ga0495684_0092413 | 3300047471 | Bacteria | 2292 |
| 457 | Ga0495686_0005405 | 3300047472 | Bacteria | 10088 |
| 458 | Ga0496100_0051032 | 3300048903 | Bacteria | 2683 |
| 459 | Ga0496101_0052358 | 3300048904 | Bacteria | 2943 |
| 460 | Ga0496101_0291367 | 3300048904 | Bacteria | 1277 |
| 461 | Ga0496102_0007022 | 3300048905 | Bacteria | 9615 |
| 462 | Ga0496102_0008369 | 3300048905 | Bacteria | 8859 |
| 463 | Ga0496102_0518629 | 3300048905 | Bacteria | 1114 |
| 464 | Ga0496104_0002996 | 3300048907 | Bacteria | 14561 |
| 465 | Ga0496104_0031621 | 3300048907 | Bacteria | 4923 |
| 466 | Ga0496105_0019359 | 3300048908 | Bacteria | 5490 |
| 467 | Ga0496105_0079723 | 3300048908 | Bacteria | 2704 |
| 468 | Ga0496105_0087831 | 3300048908 | Bacteria | 2569 |
| 469 | Ga0496108_0056190 | 3300048911 | Bacteria | 3306 |
| 470 | Ga0496108_0147745 | 3300048911 | Bacteria | 2027 |
| 471 | Ga0496108_0195435 | 3300048911 | Bacteria | 1754 |
| 472 | Ga0496110_0078442 | 3300048913 | Bacteria | 2940 |
| 473 | Ga0496110_0359809 | 3300048913 | Bacteria | 1326 |
| 474 | Ga0496112_0109434 | 3300048915 | Bacteria | 2733 |
| 475 | Ga0496113_0038115 | 3300048916 | Bacteria | 3532 |
| 476 | Ga0496113_0080078 | 3300048916 | Bacteria | 2501 |
| 477 | Ga0496114_0015736 | 3300048917 | Bacteria | 6087 |
| 478 | Ga0496114_0103021 | 3300048917 | Bacteria | 2439 |
| 479 | Ga0496114_0137482 | 3300048917 | Bacteria | 2113 |
| 480 | Ga0496114_0408678 | 3300048917 | Bacteria | 1202 |
| 481 | Ga0496115_0003633 | 3300048918 | Bacteria | 11100 |
| 482 | Ga0496124_0073642 | 3300048927 | Bacteria | 2826 |
| 483 | Ga0501309_004053 | 3300049129 | Bacteria | 1691 |
| 484 | Ga0501310_002776 | 3300049130 | Bacteria | 1678 |
| 485 | Ga0501310_010318 | 3300049130 | Bacteria | 1040 |
| 486 | Ga0501305_005422 | 3300049161 | Bacteria | 1545 |
| 487 | Ga0501311_002816 | 3300049527 | Bacteria | 1707 |
| 488 | Ga0501043_0000024 | 3300049579 | Bacteria | 154045 |
| 489 | Ga0501046_0000173 | 3300049580 | Bacteria | 65571 |
| 490 | Ga0501047_0000051 | 3300049581 | Bacteria | 154281 |
| 491 | Ga0501048_0005127 | 3300049582 | Bacteria | 9981 |
| 492 | Ga0501198_000003 | 3300049649 | Bacteria | 175301 |
| 493 | Ga0501222_000001 | 3300049662 | Bacteria | 307689 |
| 494 | Ga0501222_000413 | 3300049662 | Bacteria | 6442 |
| 495 | Ga0501233_006681 | 3300049668 | Bacteria | 2174 |
| 496 | Ga0501235_014643 | 3300049669 | Bacteria | 1728 |
| 497 | Ga0501249_002043 | 3300049679 | Bacteria | 4107 |
| 498 | Ga0501221_001265 | 3300049704 | Bacteria | 4182 |
| 499 | Ga0501262_001963 | 3300049759 | Bacteria | 2318 |
| 500 | Ga0501268_023687 | 3300049765 | Bacteria | 1068 |
| 501 | Ga0501045_0083239 | 3300049824 | Bacteria | 2360 |
| 502 | nmdc:mga0k408_16581_c1 | 3300050493 | Bacteria | 4090 |
| 503 | nmdc:mga0k408_31648_c1 | 3300050493 | Bacteria | 2493 |
| 504 | nmdc:mga0k408_36237_c1 | 3300050493 | Bacteria | 2831 |
| 505 | nmdc:mga0k408_4394_c2 | 3300050493 | Bacteria | 5891 |
| 506 | nmdc:mga0k408_54126_c1 | 3300050493 | Bacteria | 2326 |
| 507 | nmdc:mga0k408_54981_c1 | 3300050493 | Bacteria | 2307 |
| 508 | nmdc:mga0k408_93357_c1 | 3300050493 | Bacteria | 1769 |
| 509 | nmdc:mga07m45_23934_c1 | 3300050496 | Bacteria | 3341 |
| 510 | nmdc:mga09592_1348_c1 | 3300050508 | Bacteria | 19609 |
| 511 | nmdc:mga0qj67_16850_c1 | 3300050509 | Bacteria | 5549 |
| 512 | nmdc:mga0qj67_337087_c1 | 3300050509 | Bacteria | 1220 |
| 513 | nmdc:mga08y16_274380_c1 | 3300050511 | Bacteria | 1740 |
| 514 | nmdc:mga08y16_439885_c1 | 3300050511 | Bacteria | 1331 |
| 515 | Ga0500635_0000330 | 3300053080 | Bacteria | 16279 |
| 516 | Ga0495619_0055920 | 3300053085 | Bacteria | 2615 |
| 517 | Ga0500578_0000182 | 3300053086 | Bacteria | 75873 |
| 518 | Ga0500646_0007684 | 3300053090 | Bacteria | 2753 |
| 519 | Ga0500583_0057760 | 3300053092 | Bacteria | 1823 |
| 520 | Ga0500651_0004839 | 3300053093 | Bacteria | 7604 |
| 521 | Ga0500650_0013775 | 3300053098 | Bacteria | 3401 |
| 522 | Ga0500593_016373 | 3300053117 | Bacteria | 3211 |
| 523 | Ga0500642_0066834 | 3300053130 | Bacteria | 1628 |
| 524 | Ga0500652_000309 | 3300053131 | Bacteria | 17694 |
| 525 | Ga0500655_005748 | 3300053133 | Bacteria | 2231 |
| 526 | Ga0500577_0007374 | 3300053142 | Bacteria | 3080 |
| 527 | Ga0500590_004896 | 3300053148 | Bacteria | 6393 |
| 528 | Ga0500619_000134 | 3300053154 | Bacteria | 19056 |
| 529 | Ga0500622_0001582 | 3300053156 | Bacteria | 17915 |
| 530 | Ga0500636_0059034 | 3300053177 | Bacteria | 2242 |
| 531 | Ga0466962_0022161 | 3300061719 | Bacteria | 3050 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005457 | Ga0070662_100002870 | Ga0070662_1000028703 | 312 |
| 2 | 3300025933 | Ga0207706_10030321 | Ga0207706_100303213 | 312 |
| 3 | 3300025935 | Ga0207709_10001721 | Ga0207709_100017217 | 313 |
| 4 | 3300026089 | Ga0207648_10000037 | Ga0207648_100000379 | 313 |
| 5 | 3300031238 | Ga0265332_10000030 | Ga0265332_10000030120 | 313 |
| 6 | 3300046492 | Ga0495585_0008761 | Ga0495585_0008761_1118_2134 | 314 |
| 7 | 3300048917 | Ga0496114_0015736 | Ga0496114_0015736_851_1879 | 314 |
| 8 | 3300035695 | Ga0373927_0043918 | Ga0373927_0043918_1556_2575 | 315 |
| 9 | 3300039450 | Ga0436363_1083478 | Ga0436363_1083478_792_1808 | 315 |
| 10 | 3300046475 | Ga0495639_0017217 | Ga0495639_0017217_992_2011 | 315 |
| 11 | 3300036401 | Ga0373937_0123177 | Ga0373937_0123177_119_1147 | 316 |
| 12 | 3300044683 | Ga0466965_0003866 | Ga0466965_0003866_1007_2008 | 316 |
| 13 | 3300044693 | Ga0466961_0061275 | Ga0466961_0061275_705_1706 | 316 |
| 14 | 3300045049 | Ga0466959_0011523 | Ga0466959_0011523_1521_2522 | 316 |
| 15 | 3300045836 | Ga0466958_0028498 | Ga0466958_0028498_730_1731 | 316 |
| 16 | 3300049130 | Ga0501310_002776 | Ga0501310_002776_27_998 | 316 |
| 17 | 3300014325 | Ga0163163_10335187 | Ga0163163_103351872 | 317 |
| 18 | 3300026023 | Ga0207677_10127528 | Ga0207677_101275282 | 317 |
| 19 | 3300035725 | Ga0373947_0113054 | Ga0373947_0113054_320_1348 | 317 |
| 20 | 3300046459 | Ga0495629_0060333 | Ga0495629_0060333_247_1275 | 317 |
| 21 | 3300046683 | Ga0495658_0006191 | Ga0495658_0006191_1606_2634 | 317 |
| 22 | 3300053080 | Ga0500635_0000330 | Ga0500635_0000330_4028_5035 | 317 |
| 23 | 3300053085 | Ga0495619_0055920 | Ga0495619_0055920_435_1463 | 317 |
| 24 | 3300005344 | Ga0070661_100012722 | Ga0070661_1000127225 | 318 |
| 25 | 3300005366 | Ga0070659_100002488 | Ga0070659_1000024887 | 318 |
| 26 | 3300005455 | Ga0070663_100267990 | Ga0070663_1002679901 | 318 |
| 27 | 3300025920 | Ga0207649_10005583 | Ga0207649_100055835 | 318 |
| 28 | 3300025932 | Ga0207690_10007581 | Ga0207690_100075816 | 318 |
| 29 | 3300025945 | Ga0207679_10011113 | Ga0207679_100111132 | 318 |
| 30 | 3300026095 | Ga0207676_10076456 | Ga0207676_100764562 | 318 |
| 31 | 3300041512 | Ga0451853_2247177 | Ga0451853_2247177_98_1108 | 318 |
| 32 | 3300005535 | Ga0070684_100129983 | Ga0070684_1001299833 | 319 |
| 33 | 3300009177 | Ga0105248_10102510 | Ga0105248_101025102 | 319 |
| 34 | 3300025913 | Ga0207695_10117379 | Ga0207695_101173793 | 319 |
| 35 | 3300005331 | Ga0070670_100081313 | Ga0070670_1000813132 | 320 |
| 36 | 3300005618 | Ga0068864_100058060 | Ga0068864_1000580602 | 320 |
| 37 | 3300006237 | Ga0097621_100167092 | Ga0097621_1001670922 | 320 |
| 38 | 3300026095 | Ga0207676_10459123 | Ga0207676_104591232 | 320 |
| 39 | 3300031239 | Ga0265328_10008511 | Ga0265328_100085113 | 320 |
| 40 | 3300031250 | Ga0265331_10007217 | Ga0265331_100072173 | 320 |
| 41 | 3300031251 | Ga0265327_10026013 | Ga0265327_100260132 | 320 |
| 42 | 3300048904 | Ga0496101_0291367 | Ga0496101_0291367_49_1068 | 320 |
| 43 | 3300048913 | Ga0496110_0359809 | Ga0496110_0359809_272_1291 | 320 |
| 44 | 3300005328 | Ga0070676_10041692 | Ga0070676_100416923 | 321 |
| 45 | 3300005334 | Ga0068869_100003187 | Ga0068869_1000031872 | 321 |
| 46 | 3300005335 | Ga0070666_10233765 | Ga0070666_102337651 | 321 |
| 47 | 3300005338 | Ga0068868_100001433 | Ga0068868_1000014337 | 321 |
| 48 | 3300005366 | Ga0070659_100015279 | Ga0070659_1000152796 | 321 |
| 49 | 3300005457 | Ga0070662_100001070 | Ga0070662_10000107014 | 321 |
| 50 | 3300005539 | Ga0068853_100003281 | Ga0068853_1000032817 | 321 |
| 51 | 3300005547 | Ga0070693_100018518 | Ga0070693_1000185182 | 321 |
| 52 | 3300005578 | Ga0068854_100022165 | Ga0068854_1000221653 | 321 |
| 53 | 3300005615 | Ga0070702_100069884 | Ga0070702_1000698843 | 321 |
| 54 | 3300005616 | Ga0068852_100045093 | Ga0068852_1000450934 | 321 |
| 55 | 3300005618 | Ga0068864_100001208 | Ga0068864_1000012087 | 321 |
| 56 | 3300005719 | Ga0068861_100011385 | Ga0068861_1000113857 | 321 |
| 57 | 3300005842 | Ga0068858_100027483 | Ga0068858_1000274832 | 321 |
| 58 | 3300006237 | Ga0097621_100041421 | Ga0097621_1000414214 | 321 |
| 59 | 3300009174 | Ga0105241_10067363 | Ga0105241_100673633 | 321 |
| 60 | 3300009177 | Ga0105248_10006273 | Ga0105248_1000627314 | 321 |
| 61 | 3300009551 | Ga0105238_10216528 | Ga0105238_102165282 | 321 |
| 62 | 3300010375 | Ga0105239_10146529 | Ga0105239_101465293 | 321 |
| 63 | 3300013306 | Ga0163162_10039424 | Ga0163162_100394244 | 321 |
| 64 | 3300013307 | Ga0157372_10267700 | Ga0157372_102677001 | 321 |
| 65 | 3300014745 | Ga0157377_10002392 | Ga0157377_1000239211 | 321 |
| 66 | 3300014968 | Ga0157379_10016132 | Ga0157379_100161324 | 321 |
| 67 | 3300025907 | Ga0207645_10016926 | Ga0207645_100169263 | 321 |
| 68 | 3300025923 | Ga0207681_10022723 | Ga0207681_100227234 | 321 |
| 69 | 3300025924 | Ga0207694_10091166 | Ga0207694_100911663 | 321 |
| 70 | 3300025932 | Ga0207690_10041443 | Ga0207690_100414433 | 321 |
| 71 | 3300025933 | Ga0207706_10007806 | Ga0207706_100078067 | 321 |
| 72 | 3300025942 | Ga0207689_10007748 | Ga0207689_1000774811 | 321 |
| 73 | 3300025981 | Ga0207640_10039484 | Ga0207640_100394844 | 321 |
| 74 | 3300026035 | Ga0207703_10081579 | Ga0207703_100815792 | 321 |
| 75 | 3300026041 | Ga0207639_10010143 | Ga0207639_100101433 | 321 |
| 76 | 3300026078 | Ga0207702_10253805 | Ga0207702_102538051 | 321 |
| 77 | 3300026088 | Ga0207641_10104424 | Ga0207641_101044242 | 321 |
| 78 | 3300026095 | Ga0207676_10009712 | Ga0207676_100097124 | 321 |
| 79 | 3300026118 | Ga0207675_100001459 | Ga0207675_1000014597 | 321 |
| 80 | 3300026142 | Ga0207698_10006139 | Ga0207698_100061395 | 321 |
| 81 | 3300035121 | Ga0373960_0005051 | Ga0373960_0005051_1199_2206 | 321 |
| 82 | 3300035691 | Ga0373931_0000870 | Ga0373931_0000870_3125_4132 | 321 |
| 83 | 3300042135 | Ga0450899_005450 | Ga0450899_005450_290_1285 | 321 |
| 84 | 3300045051 | Ga0451576_0167851 | Ga0451576_0167851_514_1521 | 321 |
| 85 | 3300048903 | Ga0496100_0051032 | Ga0496100_0051032_1265_2272 | 321 |
| 86 | 3300048904 | Ga0496101_0052358 | Ga0496101_0052358_1501_2508 | 321 |
| 87 | 3300048905 | Ga0496102_0008369 | Ga0496102_0008369_4754_5761 | 321 |
| 88 | 3300048907 | Ga0496104_0031621 | Ga0496104_0031621_938_1945 | 321 |
| 89 | 3300048908 | Ga0496105_0079723 | Ga0496105_0079723_123_1130 | 321 |
| 90 | 3300048911 | Ga0496108_0056190 | Ga0496108_0056190_1405_2412 | 321 |
| 91 | 3300048913 | Ga0496110_0078442 | Ga0496110_0078442_594_1601 | 321 |
| 92 | 3300048916 | Ga0496113_0038115 | Ga0496113_0038115_1630_2637 | 321 |
| 93 | 3300048917 | Ga0496114_0137482 | Ga0496114_0137482_1085_2092 | 321 |
| 94 | 3300048918 | Ga0496115_0003633 | Ga0496115_0003633_7334_8341 | 321 |
| 95 | 3300003775 | Ga0055524_1000227 | Ga0055524_100022739 | 322 |
| 96 | 3300005467 | Ga0070706_100355960 | Ga0070706_1003559602 | 322 |
| 97 | 3300006946 | Ga0079104_1000024 | Ga0079104_1000024169 | 322 |
| 98 | 3300025291 | Ga0209675_1011720 | Ga0209675_10117203 | 322 |
| 99 | 3300025299 | Ga0209256_1000011 | Ga0209256_1000011297 | 322 |
| 100 | 3300025913 | Ga0207695_10437014 | Ga0207695_104370141 | 322 |
| 101 | 3300027111 | Ga0209281_1000104 | Ga0209281_100010433 | 322 |
| 102 | 3300039447 | Ga0436361_0050220 | Ga0436361_0050220_3468_4460 | 322 |
| 103 | 3300050493 | nmdc:mga0k408_31648_c1 | nmdc:mga0k408_31648_c1_798_1808 | 322 |
| 104 | 3300053117 | Ga0500593_016373 | Ga0500593_016373_1443_2456 | 322 |
| 105 | 3300003792 | Ga0055540_1011087 | Ga0055540_10110871 | 323 |
| 106 | 3300009148 | Ga0105243_10022977 | Ga0105243_100229772 | 323 |
| 107 | 3300025253 | Ga0209677_103116 | Ga0209677_1031163 | 323 |
| 108 | 3300025935 | Ga0207709_10059906 | Ga0207709_100599061 | 323 |
| 109 | 3300042876 | Ga0451577_0216782 | Ga0451577_0216782_213_1217 | 323 |
| 110 | 3300044684 | Ga0466966_0015258 | Ga0466966_0015258_464_1465 | 323 |
| 111 | 3300044719 | Ga0466971_0040395 | Ga0466971_0040395_790_1791 | 323 |
| 112 | 3300044765 | Ga0466970_0007109 | Ga0466970_0007109_1439_2440 | 323 |
| 113 | 3300045051 | Ga0451576_0032586 | Ga0451576_0032586_1498_2523 | 323 |
| 114 | 3300061719 | Ga0466962_0022161 | Ga0466962_0022161_1139_2140 | 323 |
| 115 | iso_pu_bacteria | 2643221544 | 2643746038 | 323 |
| 116 | iso_pu_bacteria | 2643221585 | 2643937003 | 323 |
| 117 | iso_pu_bacteria | 2643221639 | 2644218031 | 323 |
| 118 | iso_pu_bacteria | 2643221646 | 2644258228 | 323 |
| 119 | iso_pu_bacteria | 2643221656 | 2644318168 | 323 |
| 120 | iso_pu_bacteria | 2738541337 | 2739057166 | 323 |
| 121 | 3300005327 | Ga0070658_10370031 | Ga0070658_103700311 | 324 |
| 122 | 3300005331 | Ga0070670_100006130 | Ga0070670_1000061307 | 324 |
| 123 | 3300005354 | Ga0070675_100018720 | Ga0070675_1000187205 | 324 |
| 124 | 3300005356 | Ga0070674_100147199 | Ga0070674_1001471992 | 324 |
| 125 | 3300005456 | Ga0070678_100064748 | Ga0070678_1000647481 | 324 |
| 126 | 3300005543 | Ga0070672_100036630 | Ga0070672_1000366304 | 324 |
| 127 | 3300005618 | Ga0068864_100036794 | Ga0068864_1000367944 | 324 |
| 128 | 3300006195 | Ga0075366_10000823 | Ga0075366_1000082310 | 324 |
| 129 | 3300009094 | Ga0111539_10423514 | Ga0111539_104235142 | 324 |
| 130 | 3300009148 | Ga0105243_10118756 | Ga0105243_101187563 | 324 |
| 131 | 3300009553 | Ga0105249_10257469 | Ga0105249_102574692 | 324 |
| 132 | 3300013308 | Ga0157375_10184820 | Ga0157375_101848204 | 324 |
| 133 | 3300025298 | Ga0209050_1004228 | Ga0209050_100422812 | 324 |
| 134 | 3300025909 | Ga0207705_10237955 | Ga0207705_102379551 | 324 |
| 135 | 3300025923 | Ga0207681_10063833 | Ga0207681_100638332 | 324 |
| 136 | 3300025926 | Ga0207659_10007056 | Ga0207659_100070563 | 324 |
| 137 | 3300025937 | Ga0207669_10111422 | Ga0207669_101114222 | 324 |
| 138 | 3300026116 | Ga0207674_10033930 | Ga0207674_100339303 | 324 |
| 139 | 3300026121 | Ga0207683_10128341 | Ga0207683_101283412 | 324 |
| 140 | 3300031344 | Ga0265316_10000180 | Ga0265316_1000018016 | 324 |
| 141 | 3300037471 | Ga0395905_0001528 | Ga0395905_0001528_17798_18805 | 324 |
| 142 | 3300042012 | Ga0439455_0008313 | Ga0439455_0008313_241_1248 | 324 |
| 143 | 3300046539 | Ga0495621_0000904 | Ga0495621_0000904_5146_6162 | 324 |
| 144 | 3300050511 | nmdc:mga08y16_439885_c1 | nmdc:mga08y16_439885_c1_263_1279 | 324 |
| 145 | 3300003322 | rootL2_10019891 | rootL2_100198913 | 325 |
| 146 | 3300003761 | Ga0055535_1000107 | Ga0055535_100010722 | 325 |
| 147 | 3300003763 | Ga0055529_1000111 | Ga0055529_100011155 | 325 |
| 148 | 3300003794 | Ga0055531_10000021 | Ga0055531_1000002171 | 325 |
| 149 | 3300005563 | Ga0068855_100007253 | Ga0068855_1000072537 | 325 |
| 150 | 3300006195 | Ga0075366_10146802 | Ga0075366_101468021 | 325 |
| 151 | 3300006353 | Ga0075370_10031514 | Ga0075370_100315144 | 325 |
| 152 | 3300006846 | Ga0075430_100208152 | Ga0075430_1002081522 | 325 |
| 153 | 3300025242 | Ga0209258_100267 | Ga0209258_10026722 | 325 |
| 154 | 3300025256 | Ga0209759_1001246 | Ga0209759_100124611 | 325 |
| 155 | 3300025256 | Ga0209759_1011814 | Ga0209759_10118142 | 325 |
| 156 | 3300025272 | Ga0209455_1000158 | Ga0209455_100015840 | 325 |
| 157 | 3300025303 | Ga0209051_1009600 | Ga0209051_10096005 | 325 |
| 158 | 3300025304 | Ga0209257_1000032 | Ga0209257_1000032449 | 325 |
| 159 | 3300025304 | Ga0209257_1017020 | Ga0209257_10170203 | 325 |
| 160 | 3300025949 | Ga0207667_10005517 | Ga0207667_100055178 | 325 |
| 161 | 3300026116 | Ga0207674_10255040 | Ga0207674_102550402 | 325 |
| 162 | 3300028794 | Ga0307515_10174440 | Ga0307515_101744401 | 325 |
| 163 | 3300031548 | Ga0307408_100000056 | Ga0307408_100000056117 | 325 |
| 164 | 3300031548 | Ga0307408_100098777 | Ga0307408_1000987772 | 325 |
| 165 | 3300032004 | Ga0307414_10006110 | Ga0307414_100061102 | 325 |
| 166 | 3300032005 | Ga0307411_10000184 | Ga0307411_100001847 | 325 |
| 167 | 3300035114 | Ga0373939_0000063 | Ga0373939_0000063_26236_27246 | 325 |
| 168 | 3300035121 | Ga0373960_0000294 | Ga0373960_0000294_8447_9457 | 325 |
| 169 | 3300035691 | Ga0373931_0003270 | Ga0373931_0003270_1692_2702 | 325 |
| 170 | 3300042000 | Ga0439437_000891 | Ga0439437_000891_65_1075 | 325 |
| 171 | 3300042126 | Ga0450888_000764 | Ga0450888_000764_965_1975 | 325 |
| 172 | 3300042129 | Ga0450891_000139 | Ga0450891_000139_3646_4656 | 325 |
| 173 | 3300042130 | Ga0450892_000941 | Ga0450892_000941_1461_2471 | 325 |
| 174 | 3300045051 | Ga0451576_0001435 | Ga0451576_0001435_29947_30969 | 325 |
| 175 | 3300045051 | Ga0451576_0081201 | Ga0451576_0081201_1135_2145 | 325 |
| 176 | 3300049129 | Ga0501309_004053 | Ga0501309_004053_658_1668 | 325 |
| 177 | 3300049161 | Ga0501305_005422 | Ga0501305_005422_90_1100 | 325 |
| 178 | 3300049527 | Ga0501311_002816 | Ga0501311_002816_687_1697 | 325 |
| 179 | 3300049662 | Ga0501222_000413 | Ga0501222_000413_2552_3562 | 325 |
| 180 | 3300049668 | Ga0501233_006681 | Ga0501233_006681_461_1471 | 325 |
| 181 | 3300049669 | Ga0501235_014643 | Ga0501235_014643_85_1095 | 325 |
| 182 | 3300049704 | Ga0501221_001265 | Ga0501221_001265_2406_3416 | 325 |
| 183 | 3300049765 | Ga0501268_023687 | Ga0501268_023687_38_1048 | 325 |
| 184 | 3300050493 | nmdc:mga0k408_54981_c1 | nmdc:mga0k408_54981_c1_510_1520 | 325 |
| 185 | 3300050496 | nmdc:mga07m45_23934_c1 | nmdc:mga07m45_23934_c1_1486_2496 | 325 |
| 186 | 3300050509 | nmdc:mga0qj67_337087_c1 | nmdc:mga0qj67_337087_c1_201_1199 | 325 |
| 187 | iso_pu_bacteria | 2585428058 | 2587733676 | 325 |
| 188 | iso_pu_bacteria | 2643221660 | 2644339643 | 325 |
| 189 | 3300003320 | rootH2_10029312 | rootH2_100293129 | 326 |
| 190 | 3300003322 | rootL2_10131798 | rootL2_101317983 | 326 |
| 191 | 3300003323 | rootH1_10012734 | rootH1_100127342 | 326 |
| 192 | 3300003756 | Ga0055533_1000011 | Ga0055533_100001172 | 326 |
| 193 | 3300003759 | Ga0055525_1000468 | Ga0055525_100046810 | 326 |
| 194 | 3300005327 | Ga0070658_10087406 | Ga0070658_100874062 | 326 |
| 195 | 3300005334 | Ga0068869_100042093 | Ga0068869_1000420932 | 326 |
| 196 | 3300005339 | Ga0070660_100243605 | Ga0070660_1002436052 | 326 |
| 197 | 3300005344 | Ga0070661_100141862 | Ga0070661_1001418622 | 326 |
| 198 | 3300006195 | Ga0075366_10140097 | Ga0075366_101400972 | 326 |
| 199 | 3300009093 | Ga0105240_10068912 | Ga0105240_100689123 | 326 |
| 200 | 3300009093 | Ga0105240_10209141 | Ga0105240_102091412 | 326 |
| 201 | 3300009098 | Ga0105245_10363798 | Ga0105245_103637982 | 326 |
| 202 | 3300009545 | Ga0105237_10586999 | Ga0105237_105869991 | 326 |
| 203 | 3300009551 | Ga0105238_10260369 | Ga0105238_102603692 | 326 |
| 204 | 3300013308 | Ga0157375_10869704 | Ga0157375_108697041 | 326 |
| 205 | 3300025226 | Ga0209674_100003 | Ga0209674_100003373 | 326 |
| 206 | 3300025230 | Ga0209563_100010 | Ga0209563_100010102 | 326 |
| 207 | 3300025231 | Ga0207427_100869 | Ga0207427_10086911 | 326 |
| 208 | 3300025253 | Ga0209677_100068 | Ga0209677_10006820 | 326 |
| 209 | 3300025256 | Ga0209759_1002289 | Ga0209759_10022895 | 326 |
| 210 | 3300025913 | Ga0207695_10055277 | Ga0207695_100552772 | 326 |
| 211 | 3300025920 | Ga0207649_10160956 | Ga0207649_101609562 | 326 |
| 212 | 3300025942 | Ga0207689_10140581 | Ga0207689_101405812 | 326 |
| 213 | 3300025949 | Ga0207667_10343829 | Ga0207667_103438292 | 326 |
| 214 | 3300026116 | Ga0207674_10227592 | Ga0207674_102275921 | 326 |
| 215 | 3300031730 | Ga0307516_10000517 | Ga0307516_1000051738 | 326 |
| 216 | 3300044656 | Ga0466969_0000157 | Ga0466969_0000157_33084_34103 | 326 |
| 217 | 3300044658 | Ga0466972_0010902 | Ga0466972_0010902_3121_4131 | 326 |
| 218 | 3300044684 | Ga0466966_0010737 | Ga0466966_0010737_3873_4892 | 326 |
| 219 | 3300045049 | Ga0466959_0075544 | Ga0466959_0075544_1132_2151 | 326 |
| 220 | 3300046506 | Ga0495583_0000628 | Ga0495583_0000628_33427_34446 | 326 |
| 221 | 3300046507 | Ga0495606_0001339 | Ga0495606_0001339_8634_9653 | 326 |
| 222 | 3300046524 | Ga0495648_0057782 | Ga0495648_0057782_755_1774 | 326 |
| 223 | 3300046694 | Ga0495649_0000386 | Ga0495649_0000386_13967_14986 | 326 |
| 224 | 3300046794 | Ga0495589_0019325 | Ga0495589_0019325_1060_2079 | 326 |
| 225 | 3300048915 | Ga0496112_0109434 | Ga0496112_0109434_597_1619 | 326 |
| 226 | 3300050493 | nmdc:mga0k408_93357_c1 | nmdc:mga0k408_93357_c1_435_1451 | 326 |
| 227 | 3300053177 | Ga0500636_0059034 | Ga0500636_0059034_516_1535 | 326 |
| 228 | iso_pu_bacteria | 2547132512 | 2548848492 | 326 |
| 229 | iso_pu_bacteria | 2891633521 | 2891633833 | 326 |
| 230 | 3300005366 | Ga0070659_100339730 | Ga0070659_1003397301 | 327 |
| 231 | 3300025932 | Ga0207690_10082677 | Ga0207690_100826772 | 327 |
| 232 | 3300026023 | Ga0207677_10067696 | Ga0207677_100676962 | 327 |
| 233 | 3300035691 | Ga0373931_0094987 | Ga0373931_0094987_87_1103 | 327 |
| 234 | 3300049130 | Ga0501310_010318 | Ga0501310_010318_15_1016 | 327 |
| 235 | 3300002705 | JGI25156J39149_1010588 | JGI25156J39149_10105883 | 328 |
| 236 | 3300025256 | Ga0209759_1000847 | Ga0209759_10008473 | 328 |
| 237 | 3300028794 | Ga0307515_10054018 | Ga0307515_100540184 | 328 |
| 238 | 3300003771 | Ga0055526_1000070 | Ga0055526_100007061 | 329 |
| 239 | 3300005355 | Ga0070671_100028423 | Ga0070671_1000284234 | 329 |
| 240 | 3300006048 | Ga0075363_100033553 | Ga0075363_1000335532 | 329 |
| 241 | 3300009177 | Ga0105248_10024158 | Ga0105248_100241587 | 329 |
| 242 | 3300014969 | Ga0157376_10189434 | Ga0157376_101894342 | 329 |
| 243 | 3300026041 | Ga0207639_10107749 | Ga0207639_101077492 | 329 |
| 244 | 3300046471 | Ga0495650_0000329 | Ga0495650_0000329_67149_68165 | 329 |
| 245 | 3300046501 | Ga0495607_0128902 | Ga0495607_0128902_180_1196 | 329 |
| 246 | 3300046507 | Ga0495606_0000001 | Ga0495606_0000001_416039_417055 | 329 |
| 247 | 3300046512 | Ga0495610_0001848 | Ga0495610_0001848_5932_6948 | 329 |
| 248 | 3300046616 | Ga0495668_0000474 | Ga0495668_0000474_17056_18072 | 329 |
| 249 | 3300046616 | Ga0495668_0033330 | Ga0495668_0033330_373_1389 | 329 |
| 250 | 3300047472 | Ga0495686_0005405 | Ga0495686_0005405_1287_2303 | 329 |
| 251 | iso_pu_bacteria | 2585428057 | 2587729101 | 329 |
| 252 | iso_pu_bacteria | 2588253510 | 2588294061 | 329 |
| 253 | iso_pu_bacteria | 2643221592 | 2643967162 | 329 |
| 254 | iso_pu_bacteria | 2643221625 | 2644139993 | 329 |
| 255 | iso_pu_bacteria | 2643221648 | 2644271233 | 329 |
| 256 | 3300003323 | rootH1_10185320 | rootH1_101853202 | 330 |
| 257 | 3300005327 | Ga0070658_10253365 | Ga0070658_102533652 | 330 |
| 258 | 3300005328 | Ga0070676_10008107 | Ga0070676_100081072 | 330 |
| 259 | 3300005329 | Ga0070683_100088191 | Ga0070683_1000881912 | 330 |
| 260 | 3300005331 | Ga0070670_100015540 | Ga0070670_1000155407 | 330 |
| 261 | 3300005333 | Ga0070677_10017591 | Ga0070677_100175914 | 330 |
| 262 | 3300005334 | Ga0068869_100045356 | Ga0068869_1000453563 | 330 |
| 263 | 3300005335 | Ga0070666_10221256 | Ga0070666_102212562 | 330 |
| 264 | 3300005336 | Ga0070680_100005902 | Ga0070680_1000059026 | 330 |
| 265 | 3300005343 | Ga0070687_100054457 | Ga0070687_1000544572 | 330 |
| 266 | 3300005344 | Ga0070661_100322578 | Ga0070661_1003225781 | 330 |
| 267 | 3300005347 | Ga0070668_100019089 | Ga0070668_1000190891 | 330 |
| 268 | 3300005353 | Ga0070669_100030933 | Ga0070669_1000309334 | 330 |
| 269 | 3300005353 | Ga0070669_100193271 | Ga0070669_1001932712 | 330 |
| 270 | 3300005354 | Ga0070675_100012627 | Ga0070675_1000126276 | 330 |
| 271 | 3300005354 | Ga0070675_100236953 | Ga0070675_1002369531 | 330 |
| 272 | 3300005355 | Ga0070671_100325800 | Ga0070671_1003258001 | 330 |
| 273 | 3300005356 | Ga0070674_100010654 | Ga0070674_1000106542 | 330 |
| 274 | 3300005366 | Ga0070659_100263807 | Ga0070659_1002638072 | 330 |
| 275 | 3300005367 | Ga0070667_100003252 | Ga0070667_10000325214 | 330 |
| 276 | 3300005441 | Ga0070700_100021791 | Ga0070700_1000217912 | 330 |
| 277 | 3300005457 | Ga0070662_100165515 | Ga0070662_1001655151 | 330 |
| 278 | 3300005459 | Ga0068867_100015847 | Ga0068867_1000158476 | 330 |
| 279 | 3300005530 | Ga0070679_100017484 | Ga0070679_1000174844 | 330 |
| 280 | 3300005539 | Ga0068853_100307180 | Ga0068853_1003071802 | 330 |
| 281 | 3300005543 | Ga0070672_100001996 | Ga0070672_1000019966 | 330 |
| 282 | 3300005543 | Ga0070672_100108461 | Ga0070672_1001084612 | 330 |
| 283 | 3300005544 | Ga0070686_100061741 | Ga0070686_1000617414 | 330 |
| 284 | 3300005564 | Ga0070664_100190400 | Ga0070664_1001904001 | 330 |
| 285 | 3300005578 | Ga0068854_100220463 | Ga0068854_1002204632 | 330 |
| 286 | 3300005616 | Ga0068852_100199145 | Ga0068852_1001991452 | 330 |
| 287 | 3300005617 | Ga0068859_100021684 | Ga0068859_1000216842 | 330 |
| 288 | 3300005618 | Ga0068864_100032262 | Ga0068864_1000322623 | 330 |
| 289 | 3300005719 | Ga0068861_100008773 | Ga0068861_1000087733 | 330 |
| 290 | 3300005841 | Ga0068863_100002785 | Ga0068863_10000278519 | 330 |
| 291 | 3300005842 | Ga0068858_100016124 | Ga0068858_1000161243 | 330 |
| 292 | 3300005843 | Ga0068860_100001260 | Ga0068860_10000126021 | 330 |
| 293 | 3300005844 | Ga0068862_100030222 | Ga0068862_1000302224 | 330 |
| 294 | 3300006237 | Ga0097621_100287171 | Ga0097621_1002871711 | 330 |
| 295 | 3300006931 | Ga0097620_100021684 | Ga0097620_1000216847 | 330 |
| 296 | 3300009101 | Ga0105247_10047738 | Ga0105247_100477382 | 330 |
| 297 | 3300009176 | Ga0105242_10194341 | Ga0105242_101943412 | 330 |
| 298 | 3300009177 | Ga0105248_10047429 | Ga0105248_100474293 | 330 |
| 299 | 3300009177 | Ga0105248_10247246 | Ga0105248_102472461 | 330 |
| 300 | 3300009553 | Ga0105249_10008506 | Ga0105249_1000850611 | 330 |
| 301 | 3300013306 | Ga0163162_10007061 | Ga0163162_100070617 | 330 |
| 302 | 3300013308 | Ga0157375_10108585 | Ga0157375_101085854 | 330 |
| 303 | 3300014326 | Ga0157380_10033970 | Ga0157380_100339703 | 330 |
| 304 | 3300014968 | Ga0157379_10008941 | Ga0157379_100089415 | 330 |
| 305 | 3300017792 | Ga0163161_10094822 | Ga0163161_100948222 | 330 |
| 306 | 3300025315 | Ga0207697_10082366 | Ga0207697_100823662 | 330 |
| 307 | 3300025899 | Ga0207642_10038849 | Ga0207642_100388492 | 330 |
| 308 | 3300025901 | Ga0207688_10081050 | Ga0207688_100810501 | 330 |
| 309 | 3300025904 | Ga0207647_10137730 | Ga0207647_101377302 | 330 |
| 310 | 3300025914 | Ga0207671_10001444 | Ga0207671_100014449 | 330 |
| 311 | 3300025917 | Ga0207660_10008400 | Ga0207660_100084006 | 330 |
| 312 | 3300025921 | Ga0207652_10033780 | Ga0207652_100337802 | 330 |
| 313 | 3300025923 | Ga0207681_10004364 | Ga0207681_100043649 | 330 |
| 314 | 3300025925 | Ga0207650_10001175 | Ga0207650_100011757 | 330 |
| 315 | 3300025926 | Ga0207659_10001653 | Ga0207659_100016537 | 330 |
| 316 | 3300025931 | Ga0207644_10143772 | Ga0207644_101437722 | 330 |
| 317 | 3300025933 | Ga0207706_10021986 | Ga0207706_100219866 | 330 |
| 318 | 3300025934 | Ga0207686_10152492 | Ga0207686_101524922 | 330 |
| 319 | 3300025935 | Ga0207709_10031240 | Ga0207709_100312402 | 330 |
| 320 | 3300025937 | Ga0207669_10025495 | Ga0207669_100254954 | 330 |
| 321 | 3300025940 | Ga0207691_10070596 | Ga0207691_100705964 | 330 |
| 322 | 3300025941 | Ga0207711_10044076 | Ga0207711_100440762 | 330 |
| 323 | 3300025941 | Ga0207711_10065978 | Ga0207711_100659783 | 330 |
| 324 | 3300025941 | Ga0207711_10113253 | Ga0207711_101132534 | 330 |
| 325 | 3300025942 | Ga0207689_10018156 | Ga0207689_100181563 | 330 |
| 326 | 3300025960 | Ga0207651_10270416 | Ga0207651_102704161 | 330 |
| 327 | 3300025961 | Ga0207712_10019737 | Ga0207712_100197372 | 330 |
| 328 | 3300025972 | Ga0207668_10017174 | Ga0207668_100171744 | 330 |
| 329 | 3300025986 | Ga0207658_10000458 | Ga0207658_1000045820 | 330 |
| 330 | 3300026023 | Ga0207677_10137769 | Ga0207677_101377693 | 330 |
| 331 | 3300026035 | Ga0207703_10021127 | Ga0207703_100211273 | 330 |
| 332 | 3300026067 | Ga0207678_10078251 | Ga0207678_100782512 | 330 |
| 333 | 3300026075 | Ga0207708_10023923 | Ga0207708_100239234 | 330 |
| 334 | 3300026088 | Ga0207641_10012454 | Ga0207641_100124543 | 330 |
| 335 | 3300026095 | Ga0207676_10036213 | Ga0207676_100362133 | 330 |
| 336 | 3300026118 | Ga0207675_100008112 | Ga0207675_1000081122 | 330 |
| 337 | 3300026121 | Ga0207683_10191247 | Ga0207683_101912473 | 330 |
| 338 | 3300028380 | Ga0268265_10200089 | Ga0268265_102000892 | 330 |
| 339 | 3300028381 | Ga0268264_10000963 | Ga0268264_1000096315 | 330 |
| 340 | 3300031824 | Ga0307413_10219676 | Ga0307413_102196761 | 330 |
| 341 | 3300031911 | Ga0307412_10236148 | Ga0307412_102361481 | 330 |
| 342 | 3300031995 | Ga0307409_100006655 | Ga0307409_1000066557 | 330 |
| 343 | 3300032002 | Ga0307416_100019732 | Ga0307416_1000197324 | 330 |
| 344 | 3300032005 | Ga0307411_10004105 | Ga0307411_100041057 | 330 |
| 345 | 3300032126 | Ga0307415_100042363 | Ga0307415_1000423634 | 330 |
| 346 | 3300035116 | Ga0373945_0087807 | Ga0373945_0087807_47_1066 | 330 |
| 347 | 3300036401 | Ga0373937_0190646 | Ga0373937_0190646_542_1561 | 330 |
| 348 | 3300046681 | Ga0495647_0006716 | Ga0495647_0006716_2358_3377 | 330 |
| 349 | 3300046691 | Ga0495670_0078754 | Ga0495670_0078754_440_1459 | 330 |
| 350 | 3300046809 | Ga0495600_0060720 | Ga0495600_0060720_1041_2060 | 330 |
| 351 | 3300047471 | Ga0495684_0092413 | Ga0495684_0092413_1015_2034 | 330 |
| 352 | 3300048905 | Ga0496102_0518629 | Ga0496102_0518629_29_1063 | 330 |
| 353 | 3300048908 | Ga0496105_0087831 | Ga0496105_0087831_904_1938 | 330 |
| 354 | 3300048911 | Ga0496108_0147745 | Ga0496108_0147745_963_1997 | 330 |
| 355 | 3300048916 | Ga0496113_0080078 | Ga0496113_0080078_25_1059 | 330 |
| 356 | 3300050511 | nmdc:mga08y16_274380_c1 | nmdc:mga08y16_274380_c1_543_1562 | 330 |
| 357 | 3300005329 | Ga0070683_100198468 | Ga0070683_1001984682 | 331 |
| 358 | 3300005459 | Ga0068867_100000036 | Ga0068867_1000000369 | 331 |
| 359 | 3300005577 | Ga0068857_100039125 | Ga0068857_1000391255 | 331 |
| 360 | 3300005616 | Ga0068852_100082887 | Ga0068852_1000828872 | 331 |
| 361 | 3300009148 | Ga0105243_10001240 | Ga0105243_1000124013 | 331 |
| 362 | 3300014745 | Ga0157377_10000010 | Ga0157377_1000001057 | 331 |
| 363 | 3300026142 | Ga0207698_10045436 | Ga0207698_100454362 | 331 |
| 364 | 3300031852 | Ga0307410_10271308 | Ga0307410_102713082 | 331 |
| 365 | 3300044712 | Ga0453684_0008823 | Ga0453684_0008823_15008_16042 | 331 |
| 366 | 3300044901 | Ga0466960_0070087 | Ga0466960_0070087_487_1521 | 331 |
| 367 | 3300048927 | Ga0496124_0073642 | Ga0496124_0073642_1321_2352 | 331 |
| 368 | 3300049679 | Ga0501249_002043 | Ga0501249_002043_83_1105 | 331 |
| 369 | 3300050493 | nmdc:mga0k408_16581_c1 | nmdc:mga0k408_16581_c1_1450_2634 | 331 |
| 370 | iso_pu_bacteria | 2585428062 | 2587759083 | 331 |
| 371 | 3300028381 | Ga0268264_10037911 | Ga0268264_100379112 | 332 |
| 372 | 3300044735 | Ga0466968_0082237 | Ga0466968_0082237_210_1211 | 332 |
| 373 | 3300046543 | Ga0495645_0061193 | Ga0495645_0061193_316_1344 | 332 |
| 374 | 3300003215 | JGI25153J46596_10001786 | JGI25153J46596_100017866 | 333 |
| 375 | 3300003771 | Ga0055526_1003988 | Ga0055526_10039882 | 333 |
| 376 | 3300003791 | Ga0055530_10008633 | Ga0055530_100086332 | 333 |
| 377 | 3300005262 | Ga0065165_1000707 | Ga0065165_100070734 | 333 |
| 378 | 3300005459 | Ga0068867_100046698 | Ga0068867_1000466984 | 333 |
| 379 | 3300025245 | Ga0207425_1000328 | Ga0207425_10003286 | 333 |
| 380 | 3300025258 | Ga0209129_1000035 | Ga0209129_1000035286 | 333 |
| 381 | 3300025263 | Ga0209565_1014805 | Ga0209565_10148052 | 333 |
| 382 | 3300025273 | Ga0209673_1003283 | Ga0209673_10032832 | 333 |
| 383 | 3300025295 | Ga0209564_1000024 | Ga0209564_1000024480 | 333 |
| 384 | 3300025297 | Ga0209758_1000066 | Ga0209758_100006632 | 333 |
| 385 | 3300025298 | Ga0209050_1000178 | Ga0209050_100017867 | 333 |
| 386 | 3300025934 | Ga0207686_10288811 | Ga0207686_102888111 | 333 |
| 387 | 3300026067 | Ga0207678_10000924 | Ga0207678_1000092413 | 333 |
| 388 | 3300027876 | Ga0209974_10002408 | Ga0209974_100024085 | 333 |
| 389 | 3300031730 | Ga0307516_10217260 | Ga0307516_102172601 | 333 |
| 390 | 3300032002 | Ga0307416_100073360 | Ga0307416_1000733602 | 333 |
| 391 | 3300034820 | Ga0373959_0021180 | Ga0373959_0021180_131_1150 | 333 |
| 392 | 3300041452 | Ga0451793_1867563 | Ga0451793_1867563_859_1887 | 333 |
| 393 | 3300046460 | Ga0495638_0049107 | Ga0495638_0049107_402_1430 | 333 |
| 394 | 3300046519 | Ga0495632_0003423 | Ga0495632_0003423_1061_2089 | 333 |
| 395 | 3300049579 | Ga0501043_0000024 | Ga0501043_0000024_58789_59817 | 333 |
| 396 | 3300049580 | Ga0501046_0000173 | Ga0501046_0000173_58789_59817 | 333 |
| 397 | 3300049581 | Ga0501047_0000051 | Ga0501047_0000051_94465_95493 | 333 |
| 398 | 3300049582 | Ga0501048_0005127 | Ga0501048_0005127_3324_4352 | 333 |
| 399 | 3300049759 | Ga0501262_001963 | Ga0501262_001963_1161_2186 | 333 |
| 400 | 3300049824 | Ga0501045_0083239 | Ga0501045_0083239_1256_2284 | 333 |
| 401 | 3300050493 | nmdc:mga0k408_36237_c1 | nmdc:mga0k408_36237_c1_1604_2641 | 333 |
| 402 | 3300053086 | Ga0500578_0000182 | Ga0500578_0000182_23943_24971 | 333 |
| 403 | 3300053090 | Ga0500646_0007684 | Ga0500646_0007684_388_1416 | 333 |
| 404 | 3300053092 | Ga0500583_0057760 | Ga0500583_0057760_337_1365 | 333 |
| 405 | 3300053093 | Ga0500651_0004839 | Ga0500651_0004839_2858_3886 | 333 |
| 406 | 3300053098 | Ga0500650_0013775 | Ga0500650_0013775_37_1065 | 333 |
| 407 | 3300053130 | Ga0500642_0066834 | Ga0500642_0066834_486_1514 | 333 |
| 408 | 3300053131 | Ga0500652_000309 | Ga0500652_000309_12781_13809 | 333 |
| 409 | 3300053133 | Ga0500655_005748 | Ga0500655_005748_763_1791 | 333 |
| 410 | 3300053142 | Ga0500577_0007374 | Ga0500577_0007374_817_1845 | 333 |
| 411 | 3300005293 | Ga0065715_10009227 | Ga0065715_100092274 | 334 |
| 412 | 3300005328 | Ga0070676_10040392 | Ga0070676_100403924 | 334 |
| 413 | 3300005330 | Ga0070690_100057470 | Ga0070690_1000574703 | 334 |
| 414 | 3300005331 | Ga0070670_100077509 | Ga0070670_1000775092 | 334 |
| 415 | 3300005335 | Ga0070666_10001924 | Ga0070666_100019242 | 334 |
| 416 | 3300005338 | Ga0068868_100003192 | Ga0068868_1000031927 | 334 |
| 417 | 3300005340 | Ga0070689_100346599 | Ga0070689_1003465991 | 334 |
| 418 | 3300005354 | Ga0070675_100004634 | Ga0070675_1000046342 | 334 |
| 419 | 3300005354 | Ga0070675_100196771 | Ga0070675_1001967712 | 334 |
| 420 | 3300005364 | Ga0070673_100015595 | Ga0070673_1000155956 | 334 |
| 421 | 3300005364 | Ga0070673_100034120 | Ga0070673_1000341203 | 334 |
| 422 | 3300005365 | Ga0070688_100010026 | Ga0070688_1000100263 | 334 |
| 423 | 3300005367 | Ga0070667_100011203 | Ga0070667_1000112039 | 334 |
| 424 | 3300005456 | Ga0070678_100013316 | Ga0070678_1000133164 | 334 |
| 425 | 3300005457 | Ga0070662_100045787 | Ga0070662_1000457873 | 334 |
| 426 | 3300005539 | Ga0068853_100090822 | Ga0068853_1000908223 | 334 |
| 427 | 3300005543 | Ga0070672_100105390 | Ga0070672_1001053901 | 334 |
| 428 | 3300005543 | Ga0070672_100230853 | Ga0070672_1002308532 | 334 |
| 429 | 3300005564 | Ga0070664_100208800 | Ga0070664_1002088002 | 334 |
| 430 | 3300005615 | Ga0070702_100123254 | Ga0070702_1001232541 | 334 |
| 431 | 3300005617 | Ga0068859_100003467 | Ga0068859_10000346711 | 334 |
| 432 | 3300005618 | Ga0068864_100011910 | Ga0068864_1000119105 | 334 |
| 433 | 3300005841 | Ga0068863_100022314 | Ga0068863_1000223147 | 334 |
| 434 | 3300005842 | Ga0068858_100000436 | Ga0068858_1000004367 | 334 |
| 435 | 3300005842 | Ga0068858_100063430 | Ga0068858_1000634302 | 334 |
| 436 | 3300005843 | Ga0068860_100022605 | Ga0068860_1000226054 | 334 |
| 437 | 3300005843 | Ga0068860_100280612 | Ga0068860_1002806122 | 334 |
| 438 | 3300006237 | Ga0097621_100010262 | Ga0097621_1000102627 | 334 |
| 439 | 3300006358 | Ga0068871_100078765 | Ga0068871_1000787652 | 334 |
| 440 | 3300006931 | Ga0097620_100003467 | Ga0097620_10000346711 | 334 |
| 441 | 3300009176 | Ga0105242_10207958 | Ga0105242_102079582 | 334 |
| 442 | 3300013296 | Ga0157374_10345981 | Ga0157374_103459812 | 334 |
| 443 | 3300013306 | Ga0163162_10069032 | Ga0163162_100690324 | 334 |
| 444 | 3300013306 | Ga0163162_10487707 | Ga0163162_104877072 | 334 |
| 445 | 3300013308 | Ga0157375_10079578 | Ga0157375_100795784 | 334 |
| 446 | 3300014325 | Ga0163163_10104206 | Ga0163163_101042063 | 334 |
| 447 | 3300014326 | Ga0157380_10071692 | Ga0157380_100716923 | 334 |
| 448 | 3300014326 | Ga0157380_10103460 | Ga0157380_101034603 | 334 |
| 449 | 3300014968 | Ga0157379_10008733 | Ga0157379_100087336 | 334 |
| 450 | 3300014968 | Ga0157379_10021355 | Ga0157379_100213553 | 334 |
| 451 | 3300014969 | Ga0157376_10077274 | Ga0157376_100772744 | 334 |
| 452 | 3300017792 | Ga0163161_10084417 | Ga0163161_100844173 | 334 |
| 453 | 3300025297 | Ga0209758_1000213 | Ga0209758_100021378 | 334 |
| 454 | 3300025893 | Ga0207682_10048335 | Ga0207682_100483351 | 334 |
| 455 | 3300025903 | Ga0207680_10014016 | Ga0207680_100140164 | 334 |
| 456 | 3300025905 | Ga0207685_10033492 | Ga0207685_100334922 | 334 |
| 457 | 3300025907 | Ga0207645_10108134 | Ga0207645_101081342 | 334 |
| 458 | 3300025925 | Ga0207650_10092072 | Ga0207650_100920722 | 334 |
| 459 | 3300025926 | Ga0207659_10004285 | Ga0207659_100042857 | 334 |
| 460 | 3300025931 | Ga0207644_10006285 | Ga0207644_100062854 | 334 |
| 461 | 3300025933 | Ga0207706_10191472 | Ga0207706_101914722 | 334 |
| 462 | 3300025936 | Ga0207670_10008723 | Ga0207670_100087232 | 334 |
| 463 | 3300025937 | Ga0207669_10123838 | Ga0207669_101238382 | 334 |
| 464 | 3300025937 | Ga0207669_10227133 | Ga0207669_102271331 | 334 |
| 465 | 3300025940 | Ga0207691_10082895 | Ga0207691_100828952 | 334 |
| 466 | 3300025941 | Ga0207711_10176853 | Ga0207711_101768532 | 334 |
| 467 | 3300025942 | Ga0207689_10043151 | Ga0207689_100431514 | 334 |
| 468 | 3300025945 | Ga0207679_10168631 | Ga0207679_101686312 | 334 |
| 469 | 3300025945 | Ga0207679_10238516 | Ga0207679_102385161 | 334 |
| 470 | 3300025960 | Ga0207651_10015996 | Ga0207651_100159965 | 334 |
| 471 | 3300025972 | Ga0207668_10030692 | Ga0207668_100306924 | 334 |
| 472 | 3300025986 | Ga0207658_10114517 | Ga0207658_101145174 | 334 |
| 473 | 3300026023 | Ga0207677_10006505 | Ga0207677_100065052 | 334 |
| 474 | 3300026035 | Ga0207703_10004646 | Ga0207703_100046467 | 334 |
| 475 | 3300026035 | Ga0207703_10016146 | Ga0207703_100161461 | 334 |
| 476 | 3300026088 | Ga0207641_10169855 | Ga0207641_101698552 | 334 |
| 477 | 3300026095 | Ga0207676_10000221 | Ga0207676_100002216 | 334 |
| 478 | 3300026121 | Ga0207683_10025002 | Ga0207683_100250024 | 334 |
| 479 | 3300028380 | Ga0268265_10284748 | Ga0268265_102847481 | 334 |
| 480 | 3300035171 | Ga0373946_0034374 | Ga0373946_0034374_197_1234 | 334 |
| 481 | 3300037471 | Ga0395905_0004284 | Ga0395905_0004284_4824_5837 | 334 |
| 482 | 3300042439 | Ga0439464_0001824 | Ga0439464_0001824_3300_4337 | 334 |
| 483 | 3300046681 | Ga0495647_0018493 | Ga0495647_0018493_932_1969 | 334 |
| 484 | 3300048907 | Ga0496104_0002996 | Ga0496104_0002996_2531_3568 | 334 |
| 485 | 3300048908 | Ga0496105_0019359 | Ga0496105_0019359_680_1717 | 334 |
| 486 | 3300048911 | Ga0496108_0195435 | Ga0496108_0195435_537_1571 | 334 |
| 487 | 3300048917 | Ga0496114_0408678 | Ga0496114_0408678_52_1089 | 334 |
| 488 | 3300003792 | Ga0055540_1000112 | Ga0055540_100011237 | 335 |
| 489 | 3300003794 | Ga0055531_10021676 | Ga0055531_100216761 | 335 |
| 490 | 3300005329 | Ga0070683_100064962 | Ga0070683_1000649624 | 335 |
| 491 | 3300005344 | Ga0070661_100128726 | Ga0070661_1001287263 | 335 |
| 492 | 3300005577 | Ga0068857_100144011 | Ga0068857_1001440112 | 335 |
| 493 | 3300005614 | Ga0068856_100470658 | Ga0068856_1004706581 | 335 |
| 494 | 3300005616 | Ga0068852_100116127 | Ga0068852_1001161272 | 335 |
| 495 | 3300006195 | Ga0075366_10055154 | Ga0075366_100551543 | 335 |
| 496 | 3300006846 | Ga0075430_100100883 | Ga0075430_1001008832 | 335 |
| 497 | 3300006880 | Ga0075429_100000756 | Ga0075429_10000075623 | 335 |
| 498 | 3300013100 | Ga0157373_10030122 | Ga0157373_100301221 | 335 |
| 499 | 3300013105 | Ga0157369_10188410 | Ga0157369_101884102 | 335 |
| 500 | 3300025298 | Ga0209050_1004728 | Ga0209050_10047288 | 335 |
| 501 | 3300025303 | Ga0209051_1000016 | Ga0209051_100001637 | 335 |
| 502 | 3300025304 | Ga0209257_1000510 | Ga0209257_100051023 | 335 |
| 503 | 3300025919 | Ga0207657_10022586 | Ga0207657_100225864 | 335 |
| 504 | 3300025924 | Ga0207694_10096331 | Ga0207694_100963312 | 335 |
| 505 | 3300025932 | Ga0207690_10045373 | Ga0207690_100453733 | 335 |
| 506 | 3300025944 | Ga0207661_10059056 | Ga0207661_100590562 | 335 |
| 507 | 3300025945 | Ga0207679_10007653 | Ga0207679_100076534 | 335 |
| 508 | 3300026078 | Ga0207702_10013557 | Ga0207702_100135574 | 335 |
| 509 | 3300028794 | Ga0307515_10013844 | Ga0307515_1001384411 | 335 |
| 510 | 3300028794 | Ga0307515_10066151 | Ga0307515_100661512 | 335 |
| 511 | 3300031456 | Ga0307513_10026447 | Ga0307513_100264473 | 335 |
| 512 | 3300031616 | Ga0307508_10000142 | Ga0307508_1000014263 | 335 |
| 513 | 3300031649 | Ga0307514_10025162 | Ga0307514_100251622 | 335 |
| 514 | 3300031730 | Ga0307516_10007360 | Ga0307516_100073602 | 335 |
| 515 | 3300033179 | Ga0307507_10141672 | Ga0307507_101416722 | 335 |
| 516 | 3300044656 | Ga0466969_0037501 | Ga0466969_0037501_1038_2048 | 335 |
| 517 | 3300044719 | Ga0466971_0011291 | Ga0466971_0011291_450_1460 | 335 |
| 518 | 3300045049 | Ga0466959_0085138 | Ga0466959_0085138_396_1406 | 335 |
| 519 | 3300046512 | Ga0495610_0016504 | Ga0495610_0016504_45_1076 | 335 |
| 520 | 3300046515 | Ga0495620_0035573 | Ga0495620_0035573_306_1337 | 335 |
| 521 | 3300046519 | Ga0495632_0019378 | Ga0495632_0019378_2098_3129 | 335 |
| 522 | 3300046522 | Ga0495643_0042463 | Ga0495643_0042463_45_1076 | 335 |
| 523 | 3300046660 | Ga0495625_0003318 | Ga0495625_0003318_10865_11896 | 335 |
| 524 | 3300049649 | Ga0501198_000003 | Ga0501198_000003_136361_137392 | 335 |
| 525 | 3300049662 | Ga0501222_000001 | Ga0501222_000001_253779_254810 | 335 |
| 526 | 3300050493 | nmdc:mga0k408_54126_c1 | nmdc:mga0k408_54126_c1_910_1941 | 335 |
| 527 | 3300006195 | Ga0075366_10030750 | Ga0075366_100307503 | 336 |
| 528 | 3300028379 | Ga0268266_10220107 | Ga0268266_102201072 | 336 |
| 529 | 3300028794 | Ga0307515_10005576 | Ga0307515_100055764 | 336 |
| 530 | 3300030522 | Ga0307512_10060993 | Ga0307512_100609931 | 336 |
| 531 | 3300031456 | Ga0307513_10164049 | Ga0307513_101640492 | 336 |
| 532 | 3300044683 | Ga0466965_0083787 | Ga0466965_0083787_71_1081 | 336 |
| 533 | 3300048905 | Ga0496102_0007022 | Ga0496102_0007022_8261_9298 | 336 |
| 534 | 3300048917 | Ga0496114_0103021 | Ga0496114_0103021_611_1654 | 336 |
| 535 | 3300050493 | nmdc:mga0k408_4394_c2 | nmdc:mga0k408_4394_c2_1453_2481 | 336 |
| 536 | 3300053148 | Ga0500590_004896 | Ga0500590_004896_1622_2671 | 336 |
| 537 | 3300053154 | Ga0500619_000134 | Ga0500619_000134_15441_16478 | 336 |
| 538 | 3300037471 | Ga0395905_0012063 | Ga0395905_0012063_6519_7538 | 337 |
| 539 | 3300037471 | Ga0395905_0053882 | Ga0395905_0053882_2398_3411 | 337 |
| 540 | 3300037471 | Ga0395905_0265972 | Ga0395905_0265972_320_1339 | 337 |
| 541 | 3300046457 | Ga0495590_0003984 | Ga0495590_0003984_311_1330 | 337 |
| 542 | 3300005563 | Ga0068855_100079641 | Ga0068855_1000796413 | 338 |
| 543 | 3300029957 | Ga0265324_10000232 | Ga0265324_100002328 | 339 |
| 544 | 3300053156 | Ga0500622_0001582 | Ga0500622_0001582_1462_2601 | 339 |
| 545 | 3300050508 | nmdc:mga09592_1348_c1 | nmdc:mga09592_1348_c1_1264_2358 | 343 |
| 546 | 3300050509 | nmdc:mga0qj67_16850_c1 | nmdc:mga0qj67_16850_c1_3038_4132 | 343 |
| 547 | 3300002077 | JGI24744J21845_10009649 | JGI24744J21845_100096492 | 346 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sbp-assembly1.cif.gz_A | 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding | 0.9057 | 39 | 343 |
| 5um2-assembly1.cif.gz_A | functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri | 0.8983 | 39 | 346 |
| 1sbp-assembly1.cif.gz_A | 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding | 0.8921 | 39 | 343 |
| 5um2-assembly1.cif.gz_A | functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri | 0.8745 | 39 | 346 |
| 6ddn-assembly2.cif.gz_B | the sulfate-binding protein subi from mycobacterium tuberculosis h37rv | 0.86 | 40 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1sbpA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9878 | 39 | 311 | 3.40.190.10 |
| 1sbpA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9749 | 39 | 311 | 3.40.190.10 |
| 1sbpA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9532 | 132 | 343 | 3.40.190.10 |
| 1sbpA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9415 | 132 | 343 | 3.40.190.10 |
| af_P16700_28_100_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9375 | 42 | 113 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3N7M7-F1-model_v4 | deleted | 0.9875 | 109 | 342 |
|
| AF-A0A833GVX5-F1-model_v4 | Sulfate ABC transporter substrate-binding protein | 0.9873 | 53 | 342 |
GO:0042597
GO:1902358 |
| AF-A0A5E7VYV4-F1-model_v4 | Sulfate-binding protein | 0.9805 | 36 | 342 |
GO:0042597
GO:1902358 |
| AF-A0A7U7FUM0-F1-model_v4 | deleted | 0.9767 | 42 | 342 |
|
| AF-W0V128-F1-model_v4 | Sulfate ABC transporter, sulfate-binding family protein | 0.9736 | 42 | 344 |
GO:0042597
GO:1902358 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar