F462162

General Info

Members Datasets Scaffolds Average Seq Length
547 322 531 337

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_16581_c1|nmdc:mga0k408_16581_c1_1450_2634
Length 394
Sequence MAGRLGSGPALGPPPIRPLLIPDPHKDRQKPSLDGCADLLSIRALSSNRQPTLPAAMFPILRSPVRRLLVAAAATLSLPAFAATTLLNVSYDVARELYKEINPAFQKSWKASTGEDLTINQSHGGSSKQARSVLDGLEADVVTMNQSSDIDVLATRGKLIPADWAKRLPNNAAPTTSVTVILVRKGNPKGIKDWPDLAKAGTSVVIPNPKITGNGRYTYVAAWGSAIKAGGTPAQARELVQKIFANVPVFDGGGRAATTTFAQRGIGDALATFESEVNLIKSEFGDHFDVVYPSSTILAENPVSVVDKVVDKKGTRKQAEAYLKFLWSDEAQEIAAKHQLRPRSAALLAKYTKDFPKVTTFTIDEVFGGWTQAQKEHFDDGAIYDQILAAGKKQ

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
7 2643221585 Pelomonas sp. Root662 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
10 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
11 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
12 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
13 2643221656 Pelomonas sp. Root405 Isolate Unclassified
14 2643221660 Methylibium sp. Root1272 Isolate Unclassified
15 2738541337 Pelomonas sp. BT06 Isolate Unclassified
16 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
228 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
229 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
230 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
293 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
294 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
295 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
296 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
297 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
298 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
299 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
309 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
310 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
311 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
312 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
313 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
314 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
315 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
316 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
317 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
318 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
319 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
320 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
321 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
322 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.16
Metatranscriptomes 0.91
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 0.37
Rhizoplane 4.57
Rhizosphere 75.69
Stem 0
Stem Tuber 0
Unclassified 6.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10009649 3300002077 Bacteria 1981
2 JGI25156J39149_1010588 3300002705 Bacteria 2156
3 JGI25153J46596_10001786 3300003215 Bacteria 12758
4 rootH2_10029312 3300003320 Bacteria 9084
5 rootL2_10019891 3300003322 Bacteria 13677
6 rootL2_10131798 3300003322 Bacteria 3742
7 rootH1_10012734 3300003323 Bacteria 15075
8 rootH1_10185320 3300003323 Bacteria 4318
9 Ga0055533_1000011 3300003756 Bacteria 467893
10 Ga0055525_1000468 3300003759 Bacteria 22440
11 Ga0055535_1000107 3300003761 Bacteria 89840
12 Ga0055529_1000111 3300003763 Bacteria 118734
13 Ga0055526_1000070 3300003771 Bacteria 96845
14 Ga0055526_1003988 3300003771 Bacteria 9085
15 Ga0055524_1000227 3300003775 Bacteria 59891
16 Ga0055530_10008633 3300003791 Bacteria 4040
17 Ga0055540_1000112 3300003792 Bacteria 88200
18 Ga0055540_1011087 3300003792 Bacteria 2941
19 Ga0055531_10000021 3300003794 Bacteria 167213
20 Ga0055531_10021676 3300003794 Bacteria 2481
21 Ga0065165_1000707 3300005262 Bacteria 47352
22 Ga0065715_10009227 3300005293 Bacteria 4164
23 Ga0070658_10087406 3300005327 Bacteria 2566
24 Ga0070658_10253365 3300005327 Bacteria 1493
25 Ga0070658_10370031 3300005327 Bacteria 1228
26 Ga0070676_10008107 3300005328 Bacteria 5650
27 Ga0070676_10040392 3300005328 Bacteria 2702
28 Ga0070676_10041692 3300005328 Bacteria 2663
29 Ga0070683_100064962 3300005329 Bacteria 3397
30 Ga0070683_100088191 3300005329 Bacteria 2910
31 Ga0070683_100198468 3300005329 Bacteria 1905
32 Ga0070690_100057470 3300005330 Bacteria 2497
33 Ga0070670_100006130 3300005331 Bacteria 10167
34 Ga0070670_100015540 3300005331 Bacteria 6537
35 Ga0070670_100077509 3300005331 Bacteria 2855
36 Ga0070670_100081313 3300005331 Bacteria 2784
37 Ga0070677_10017591 3300005333 Bacteria 2561
38 Ga0068869_100003187 3300005334 Bacteria 10022
39 Ga0068869_100042093 3300005334 Bacteria 3274
40 Ga0068869_100045356 3300005334 Bacteria 3164
41 Ga0070666_10001924 3300005335 Bacteria 12627
42 Ga0070666_10221256 3300005335 Bacteria 1335
43 Ga0070666_10233765 3300005335 Bacteria 1299
44 Ga0070680_100005902 3300005336 Bacteria 9301
45 Ga0068868_100001433 3300005338 Bacteria 16455
46 Ga0068868_100003192 3300005338 Bacteria 11404
47 Ga0070660_100243605 3300005339 Bacteria 1465
48 Ga0070689_100346599 3300005340 Bacteria 1245
49 Ga0070687_100054457 3300005343 Bacteria 2085
50 Ga0070661_100012722 3300005344 Bacteria 5889
51 Ga0070661_100128726 3300005344 Bacteria 1900
52 Ga0070661_100141862 3300005344 Bacteria 1811
53 Ga0070661_100322578 3300005344 Bacteria 1206
54 Ga0070668_100019089 3300005347 Bacteria 5154
55 Ga0070669_100030933 3300005353 Bacteria 3864
56 Ga0070669_100193271 3300005353 Bacteria 1597
57 Ga0070675_100004634 3300005354 Bacteria 10501
58 Ga0070675_100012627 3300005354 Bacteria 6624
59 Ga0070675_100018720 3300005354 Bacteria 5512
60 Ga0070675_100196771 3300005354 Bacteria 1748
61 Ga0070675_100236953 3300005354 Bacteria 1593
62 Ga0070671_100028423 3300005355 Bacteria 4604
63 Ga0070671_100325800 3300005355 Bacteria 1309
64 Ga0070674_100010654 3300005356 Bacteria 5570
65 Ga0070674_100147199 3300005356 Bacteria 1774
66 Ga0070673_100015595 3300005364 Bacteria 5344
67 Ga0070673_100034120 3300005364 Bacteria 3847
68 Ga0070688_100010026 3300005365 Bacteria 5206
69 Ga0070659_100002488 3300005366 Bacteria 13084
70 Ga0070659_100015279 3300005366 Bacteria 5748
71 Ga0070659_100263807 3300005366 Bacteria 1429
72 Ga0070659_100339730 3300005366 Bacteria 1258
73 Ga0070667_100003252 3300005367 Bacteria 13886
74 Ga0070667_100011203 3300005367 Bacteria 7419
75 Ga0070700_100021791 3300005441 Bacteria 3728
76 Ga0070663_100267990 3300005455 Bacteria 1357
77 Ga0070678_100013316 3300005456 Bacteria 5152
78 Ga0070678_100064748 3300005456 Bacteria 2710
79 Ga0070662_100001070 3300005457 Bacteria 16689
80 Ga0070662_100002870 3300005457 Bacteria 10690
81 Ga0070662_100045787 3300005457 Bacteria 3140
82 Ga0070662_100165515 3300005457 Bacteria 1732
83 Ga0068867_100000036 3300005459 Bacteria 81113
84 Ga0068867_100015847 3300005459 Bacteria 5350
85 Ga0068867_100046698 3300005459 Bacteria 3181
86 Ga0070706_100355960 3300005467 Bacteria 1364
87 Ga0070679_100017484 3300005530 Bacteria 6941
88 Ga0070684_100129983 3300005535 Bacteria 2271
89 Ga0068853_100003281 3300005539 Bacteria 12370
90 Ga0068853_100090822 3300005539 Bacteria 2684
91 Ga0068853_100307180 3300005539 Bacteria 1467
92 Ga0070672_100001996 3300005543 Bacteria 12809
93 Ga0070672_100036630 3300005543 Bacteria 3738
94 Ga0070672_100105390 3300005543 Bacteria 2292
95 Ga0070672_100108461 3300005543 Bacteria 2260
96 Ga0070672_100230853 3300005543 Bacteria 1555
97 Ga0070686_100061741 3300005544 Bacteria 2422
98 Ga0070693_100018518 3300005547 Bacteria 3639
99 Ga0068855_100007253 3300005563 Bacteria 13442
100 Ga0068855_100079641 3300005563 Bacteria 3799
101 Ga0070664_100190400 3300005564 Bacteria 1827
102 Ga0070664_100208800 3300005564 Bacteria 1745
103 Ga0068857_100039125 3300005577 Bacteria 4200
104 Ga0068857_100144011 3300005577 Bacteria 2155
105 Ga0068854_100022165 3300005578 Bacteria 4322
106 Ga0068854_100220463 3300005578 Bacteria 1500
107 Ga0068856_100470658 3300005614 Bacteria 1277
108 Ga0070702_100069884 3300005615 Bacteria 2071
109 Ga0070702_100123254 3300005615 Bacteria 1626
110 Ga0068852_100045093 3300005616 Bacteria 3748
111 Ga0068852_100082887 3300005616 Bacteria 2851
112 Ga0068852_100116127 3300005616 Bacteria 2441
113 Ga0068852_100199145 3300005616 Bacteria 1894
114 Ga0068859_100003467 3300005617 Bacteria 16040
115 Ga0068859_100021684 3300005617 Bacteria 6447
116 Ga0068864_100001208 3300005618 Bacteria 21454
117 Ga0068864_100011910 3300005618 Bacteria 7182
118 Ga0068864_100032262 3300005618 Bacteria 4449
119 Ga0068864_100036794 3300005618 Bacteria 4174
120 Ga0068864_100058060 3300005618 Bacteria 3343
121 Ga0068861_100008773 3300005719 Bacteria 6962
122 Ga0068861_100011385 3300005719 Bacteria 6181
123 Ga0068863_100002785 3300005841 Bacteria 17318
124 Ga0068863_100022314 3300005841 Bacteria 6043
125 Ga0068858_100000436 3300005842 Bacteria 43518
126 Ga0068858_100016124 3300005842 Bacteria 7019
127 Ga0068858_100027483 3300005842 Bacteria 5285
128 Ga0068858_100063430 3300005842 Bacteria 3419
129 Ga0068860_100001260 3300005843 Bacteria 27630
130 Ga0068860_100022605 3300005843 Bacteria 6080
131 Ga0068860_100280612 3300005843 Bacteria 1628
132 Ga0068862_100030222 3300005844 Bacteria 4565
133 Ga0075363_100033553 3300006048 Bacteria 2674
134 Ga0075366_10000823 3300006195 Bacteria 14890
135 Ga0075366_10030750 3300006195 Bacteria 3158
136 Ga0075366_10055154 3300006195 Bacteria 2360
137 Ga0075366_10140097 3300006195 Bacteria 1462
138 Ga0075366_10146802 3300006195 Bacteria 1427
139 Ga0097621_100010262 3300006237 Bacteria 6843
140 Ga0097621_100041421 3300006237 Bacteria 3708
141 Ga0097621_100167092 3300006237 Bacteria 1894
142 Ga0097621_100287171 3300006237 Bacteria 1449
143 Ga0075370_10031514 3300006353 Bacteria 2960
144 Ga0068871_100078765 3300006358 Bacteria 2725
145 Ga0075430_100100883 3300006846 Bacteria 2410
146 Ga0075430_100208152 3300006846 Bacteria 1623
147 Ga0075429_100000756 3300006880 Bacteria 25403
148 Ga0097620_100003467 3300006931 Bacteria 16040
149 Ga0097620_100021684 3300006931 Bacteria 6447
150 Ga0079104_1000024 3300006946 Bacteria 219543
151 Ga0105240_10068912 3300009093 Bacteria 4381
152 Ga0105240_10209141 3300009093 Bacteria 2281
153 Ga0111539_10423514 3300009094 Bacteria 1550
154 Ga0105245_10363798 3300009098 Bacteria 1436
155 Ga0105247_10047738 3300009101 Bacteria 2630
156 Ga0105243_10001240 3300009148 Bacteria 22981
157 Ga0105243_10022977 3300009148 Bacteria 4743
158 Ga0105243_10118756 3300009148 Bacteria 2226
159 Ga0105241_10067363 3300009174 Bacteria 2771
160 Ga0105242_10194341 3300009176 Bacteria 1798
161 Ga0105242_10207958 3300009176 Bacteria 1742
162 Ga0105248_10006273 3300009177 Bacteria 13041
163 Ga0105248_10024158 3300009177 Bacteria 6755
164 Ga0105248_10047429 3300009177 Bacteria 4817
165 Ga0105248_10102510 3300009177 Bacteria 3225
166 Ga0105248_10247246 3300009177 Bacteria 2008
167 Ga0105237_10586999 3300009545 Bacteria 1121
168 Ga0105238_10216528 3300009551 Bacteria 1891
169 Ga0105238_10260369 3300009551 Bacteria 1714
170 Ga0105249_10008506 3300009553 Bacteria 8946
171 Ga0105249_10257469 3300009553 Bacteria 1732
172 Ga0105239_10146529 3300010375 Bacteria 2634
173 Ga0157373_10030122 3300013100 Bacteria 3905
174 Ga0157369_10188410 3300013105 Bacteria 2168
175 Ga0157374_10345981 3300013296 Bacteria 1477
176 Ga0163162_10007061 3300013306 Bacteria 10891
177 Ga0163162_10039424 3300013306 Bacteria 4720
178 Ga0163162_10069032 3300013306 Bacteria 3586
179 Ga0163162_10487707 3300013306 Bacteria 1363
180 Ga0157372_10267700 3300013307 Bacteria 1985
181 Ga0157375_10079578 3300013308 Bacteria 3313
182 Ga0157375_10108585 3300013308 Bacteria 2870
183 Ga0157375_10184820 3300013308 Bacteria 2237
184 Ga0157375_10869704 3300013308 Bacteria 1047
185 Ga0163163_10104206 3300014325 Bacteria 2861
186 Ga0163163_10335187 3300014325 Bacteria 1568
187 Ga0157380_10033970 3300014326 Bacteria 3931
188 Ga0157380_10071692 3300014326 Bacteria 2803
189 Ga0157380_10103460 3300014326 Bacteria 2376
190 Ga0157377_10000010 3300014745 Bacteria 380929
191 Ga0157377_10002392 3300014745 Bacteria 8275
192 Ga0157379_10008733 3300014968 Bacteria 8832
193 Ga0157379_10008941 3300014968 Bacteria 8731
194 Ga0157379_10016132 3300014968 Bacteria 6570
195 Ga0157379_10021355 3300014968 Bacteria 5729
196 Ga0157376_10077274 3300014969 Bacteria 2847
197 Ga0157376_10189434 3300014969 Bacteria 1885
198 Ga0163161_10084417 3300017792 Bacteria 2342
199 Ga0163161_10094822 3300017792 Bacteria 2213
200 Ga0209674_100003 3300025226 Bacteria 2196646
201 Ga0209563_100010 3300025230 Bacteria 1337457
202 Ga0207427_100869 3300025231 Bacteria 13370
203 Ga0209258_100267 3300025242 Bacteria 89896
204 Ga0207425_1000328 3300025245 Bacteria 33571
205 Ga0209677_100068 3300025253 Bacteria 146135
206 Ga0209677_103116 3300025253 Bacteria 5635
207 Ga0209759_1000847 3300025256 Bacteria 23854
208 Ga0209759_1001246 3300025256 Bacteria 15442
209 Ga0209759_1002289 3300025256 Bacteria 8640
210 Ga0209759_1011814 3300025256 Bacteria 2456
211 Ga0209129_1000035 3300025258 Bacteria 329303
212 Ga0209565_1014805 3300025263 Bacteria 1779
213 Ga0209455_1000158 3300025272 Bacteria 118973
214 Ga0209673_1003283 3300025273 Bacteria 9734
215 Ga0209675_1011720 3300025291 Bacteria 2888
216 Ga0209564_1000024 3300025295 Bacteria 535041
217 Ga0209758_1000066 3300025297 Bacteria 298620
218 Ga0209758_1000213 3300025297 Bacteria 126745
219 Ga0209050_1000178 3300025298 Bacteria 145314
220 Ga0209050_1004228 3300025298 Bacteria 9879
221 Ga0209050_1004728 3300025298 Bacteria 9009
222 Ga0209256_1000011 3300025299 Bacteria 865309
223 Ga0209051_1000016 3300025303 Bacteria 541891
224 Ga0209051_1009600 3300025303 Bacteria 4969
225 Ga0209257_1000032 3300025304 Bacteria 680354
226 Ga0209257_1000510 3300025304 Bacteria 67777
227 Ga0209257_1017020 3300025304 Bacteria 2893
228 Ga0207697_10082366 3300025315 Bacteria 1357
229 Ga0207682_10048335 3300025893 Bacteria 1753
230 Ga0207642_10038849 3300025899 Bacteria 2063
231 Ga0207688_10081050 3300025901 Bacteria 1853
232 Ga0207680_10014016 3300025903 Bacteria 4134
233 Ga0207647_10137730 3300025904 Bacteria 1431
234 Ga0207685_10033492 3300025905 Bacteria 1857
235 Ga0207645_10016926 3300025907 Bacteria 4817
236 Ga0207645_10108134 3300025907 Bacteria 1799
237 Ga0207705_10237955 3300025909 Bacteria 1386
238 Ga0207695_10055277 3300025913 Bacteria 4138
239 Ga0207695_10117379 3300025913 Bacteria 2634
240 Ga0207695_10437014 3300025913 Bacteria 1192
241 Ga0207671_10001444 3300025914 Bacteria 27486
242 Ga0207660_10008400 3300025917 Bacteria 6680
243 Ga0207657_10022586 3300025919 Bacteria 5882
244 Ga0207649_10005583 3300025920 Bacteria 6803
245 Ga0207649_10160956 3300025920 Bacteria 1555
246 Ga0207652_10033780 3300025921 Bacteria 4308
247 Ga0207681_10004364 3300025923 Bacteria 8718
248 Ga0207681_10022723 3300025923 Bacteria 4003
249 Ga0207681_10063833 3300025923 Bacteria 2541
250 Ga0207694_10091166 3300025924 Bacteria 2405
251 Ga0207694_10096331 3300025924 Bacteria 2340
252 Ga0207650_10001175 3300025925 Bacteria 19267
253 Ga0207650_10092072 3300025925 Bacteria 2318
254 Ga0207659_10001653 3300025926 Bacteria 13245
255 Ga0207659_10004285 3300025926 Bacteria 8626
256 Ga0207659_10007056 3300025926 Bacteria 6893
257 Ga0207644_10006285 3300025931 Bacteria 7739
258 Ga0207644_10143772 3300025931 Bacteria 1839
259 Ga0207690_10007581 3300025932 Bacteria 6439
260 Ga0207690_10041443 3300025932 Bacteria 3017
261 Ga0207690_10045373 3300025932 Bacteria 2903
262 Ga0207690_10082677 3300025932 Bacteria 2246
263 Ga0207706_10007806 3300025933 Bacteria 9877
264 Ga0207706_10021986 3300025933 Bacteria 5725
265 Ga0207706_10030321 3300025933 Bacteria 4825
266 Ga0207706_10191472 3300025933 Bacteria 1795
267 Ga0207686_10152492 3300025934 Bacteria 1610
268 Ga0207686_10288811 3300025934 Bacteria 1213
269 Ga0207709_10001721 3300025935 Bacteria 14755
270 Ga0207709_10031240 3300025935 Bacteria 3108
271 Ga0207709_10059906 3300025935 Bacteria 2371
272 Ga0207670_10008723 3300025936 Bacteria 5741
273 Ga0207669_10025495 3300025937 Bacteria 3197
274 Ga0207669_10111422 3300025937 Bacteria 1835
275 Ga0207669_10123838 3300025937 Bacteria 1761
276 Ga0207669_10227133 3300025937 Bacteria 1375
277 Ga0207691_10070596 3300025940 Bacteria 3153
278 Ga0207691_10082895 3300025940 Bacteria 2879
279 Ga0207711_10044076 3300025941 Bacteria 3807
280 Ga0207711_10065978 3300025941 Bacteria 3129
281 Ga0207711_10113253 3300025941 Bacteria 2415
282 Ga0207711_10176853 3300025941 Bacteria 1939
283 Ga0207689_10007748 3300025942 Bacteria 9399
284 Ga0207689_10018156 3300025942 Bacteria 5939
285 Ga0207689_10043151 3300025942 Bacteria 3728
286 Ga0207689_10140581 3300025942 Bacteria 1988
287 Ga0207661_10059056 3300025944 Bacteria 3089
288 Ga0207679_10007653 3300025945 Bacteria 6862
289 Ga0207679_10011113 3300025945 Bacteria 5813
290 Ga0207679_10168631 3300025945 Bacteria 1800
291 Ga0207679_10238516 3300025945 Bacteria 1539
292 Ga0207667_10005517 3300025949 Bacteria 15432
293 Ga0207667_10343829 3300025949 Bacteria 1522
294 Ga0207651_10015996 3300025960 Bacteria 4378
295 Ga0207651_10270416 3300025960 Bacteria 1399
296 Ga0207712_10019737 3300025961 Bacteria 4405
297 Ga0207668_10017174 3300025972 Bacteria 4529
298 Ga0207668_10030692 3300025972 Bacteria 3534
299 Ga0207640_10039484 3300025981 Bacteria 2988
300 Ga0207658_10000458 3300025986 Bacteria 38200
301 Ga0207658_10114517 3300025986 Bacteria 2138
302 Ga0207677_10006505 3300026023 Bacteria 6418
303 Ga0207677_10067696 3300026023 Bacteria 2503
304 Ga0207677_10127528 3300026023 Bacteria 1926
305 Ga0207677_10137769 3300026023 Bacteria 1864
306 Ga0207703_10004646 3300026035 Bacteria 11216
307 Ga0207703_10016146 3300026035 Bacteria 5820
308 Ga0207703_10021127 3300026035 Bacteria 5095
309 Ga0207703_10081579 3300026035 Bacteria 2696
310 Ga0207639_10010143 3300026041 Bacteria 6517
311 Ga0207639_10107749 3300026041 Bacteria 2264
312 Ga0207678_10000924 3300026067 Bacteria 26847
313 Ga0207678_10078251 3300026067 Bacteria 2832
314 Ga0207708_10023923 3300026075 Bacteria 4619
315 Ga0207702_10013557 3300026078 Bacteria 6771
316 Ga0207702_10253805 3300026078 Bacteria 1653
317 Ga0207641_10012454 3300026088 Bacteria 6973
318 Ga0207641_10104424 3300026088 Bacteria 2501
319 Ga0207641_10169855 3300026088 Bacteria 1989
320 Ga0207648_10000037 3300026089 Bacteria 120856
321 Ga0207676_10000221 3300026095 Bacteria 49106
322 Ga0207676_10009712 3300026095 Bacteria 6841
323 Ga0207676_10036213 3300026095 Bacteria 3752
324 Ga0207676_10076456 3300026095 Bacteria 2705
325 Ga0207676_10459123 3300026095 Bacteria 1202
326 Ga0207674_10033930 3300026116 Bacteria 5339
327 Ga0207674_10227592 3300026116 Bacteria 1813
328 Ga0207674_10255040 3300026116 Bacteria 1701
329 Ga0207675_100001459 3300026118 Bacteria 23702
330 Ga0207675_100008112 3300026118 Bacteria 9895
331 Ga0207683_10025002 3300026121 Bacteria 5149
332 Ga0207683_10128341 3300026121 Bacteria 2280
333 Ga0207683_10191247 3300026121 Bacteria 1858
334 Ga0207698_10006139 3300026142 Bacteria 7478
335 Ga0207698_10045436 3300026142 Bacteria 3309
336 Ga0209281_1000104 3300027111 Bacteria 221056
337 Ga0209974_10002408 3300027876 Bacteria 6779
338 Ga0268266_10220107 3300028379 Bacteria 1745
339 Ga0268265_10200089 3300028380 Bacteria 1732
340 Ga0268265_10284748 3300028380 Bacteria 1480
341 Ga0268264_10000963 3300028381 Bacteria 29539
342 Ga0268264_10037911 3300028381 Bacteria 3976
343 Ga0307515_10005576 3300028794 Bacteria 25454
344 Ga0307515_10013844 3300028794 Bacteria 15023
345 Ga0307515_10054018 3300028794 Bacteria 5908
346 Ga0307515_10066151 3300028794 Bacteria 5012
347 Ga0307515_10174440 3300028794 Bacteria 2126
348 Ga0265324_10000232 3300029957 Bacteria 42039
349 Ga0307512_10060993 3300030522 Bacteria 2910
350 Ga0265332_10000030 3300031238 Bacteria 175141
351 Ga0265328_10008511 3300031239 Bacteria 4226
352 Ga0265331_10007217 3300031250 Bacteria 6451
353 Ga0265327_10026013 3300031251 Bacteria 3398
354 Ga0265316_10000180 3300031344 Bacteria 71764
355 Ga0307513_10026447 3300031456 Bacteria 6689
356 Ga0307513_10164049 3300031456 Bacteria 2109
357 Ga0307408_100000056 3300031548 Bacteria 140709
358 Ga0307408_100098777 3300031548 Bacteria 2220
359 Ga0307508_10000142 3300031616 Bacteria 85288
360 Ga0307514_10025162 3300031649 Bacteria 4813
361 Ga0307516_10000517 3300031730 Bacteria 51613
362 Ga0307516_10007360 3300031730 Bacteria 12668
363 Ga0307516_10217260 3300031730 Bacteria 1623
364 Ga0307413_10219676 3300031824 Bacteria 1387
365 Ga0307410_10271308 3300031852 Bacteria 1327
366 Ga0307412_10236148 3300031911 Bacteria 1411
367 Ga0307409_100006655 3300031995 Bacteria 6822
368 Ga0307416_100019732 3300032002 Bacteria 4788
369 Ga0307416_100073360 3300032002 Bacteria 2853
370 Ga0307414_10006110 3300032004 Bacteria 6687
371 Ga0307411_10000184 3300032005 Bacteria 20004
372 Ga0307411_10004105 3300032005 Bacteria 6908
373 Ga0307415_100042363 3300032126 Bacteria 3029
374 Ga0307507_10141672 3300033179 Bacteria 1841
375 Ga0373959_0021180 3300034820 Bacteria 1246
376 Ga0373939_0000063 3300035114 Bacteria 36084
377 Ga0373945_0087807 3300035116 Bacteria 1200
378 Ga0373960_0000294 3300035121 Bacteria 9505
379 Ga0373960_0005051 3300035121 Bacteria 3040
380 Ga0373946_0034374 3300035171 Bacteria 2047
381 Ga0373931_0000870 3300035691 Bacteria 12748
382 Ga0373931_0003270 3300035691 Bacteria 7251
383 Ga0373931_0094987 3300035691 Bacteria 1668
384 Ga0373927_0043918 3300035695 Bacteria 2893
385 Ga0373947_0113054 3300035725 Bacteria 1718
386 Ga0373937_0123177 3300036401 Bacteria 2417
387 Ga0373937_0190646 3300036401 Bacteria 1926
388 Ga0395905_0001528 3300037471 Bacteria 27686
389 Ga0395905_0004284 3300037471 Bacteria 14874
390 Ga0395905_0012063 3300037471 Bacteria 8328
391 Ga0395905_0053882 3300037471 Bacteria 3764
392 Ga0395905_0265972 3300037471 Bacteria 1600
393 Ga0436361_0050220 3300039447 Bacteria 22165
394 Ga0436363_1083478 3300039450 Bacteria 2645
395 Ga0451793_1867563 3300041452 Bacteria 3436
396 Ga0451853_2247177 3300041512 Bacteria 1147
397 Ga0439437_000891 3300042000 Bacteria 3111
398 Ga0439455_0008313 3300042012 Bacteria 2220
399 Ga0450888_000764 3300042126 Bacteria 3080
400 Ga0450891_000139 3300042129 Bacteria 6631
401 Ga0450892_000941 3300042130 Bacteria 3136
402 Ga0450899_005450 3300042135 Bacteria 1368
403 Ga0439464_0001824 3300042439 Bacteria 5139
404 Ga0451577_0216782 3300042876 Bacteria 1730
405 Ga0466969_0000157 3300044656 Bacteria 36880
406 Ga0466969_0037501 3300044656 Bacteria 2444
407 Ga0466972_0010902 3300044658 Bacteria 4561
408 Ga0466965_0003866 3300044683 Bacteria 6618
409 Ga0466965_0083787 3300044683 Bacteria 1614
410 Ga0466966_0010737 3300044684 Bacteria 6089
411 Ga0466966_0015258 3300044684 Bacteria 5080
412 Ga0466961_0061275 3300044693 Bacteria 2391
413 Ga0453684_0008823 3300044712 Bacteria 17877
414 Ga0466971_0011291 3300044719 Bacteria 3913
415 Ga0466971_0040395 3300044719 Bacteria 2095
416 Ga0466968_0082237 3300044735 Bacteria 1417
417 Ga0466970_0007109 3300044765 Bacteria 5602
418 Ga0466960_0070087 3300044901 Bacteria 1743
419 Ga0466959_0011523 3300045049 Bacteria 6356
420 Ga0466959_0075544 3300045049 Bacteria 2434
421 Ga0466959_0085138 3300045049 Bacteria 2275
422 Ga0451576_0001435 3300045051 Bacteria 40749
423 Ga0451576_0032586 3300045051 Bacteria 5546
424 Ga0451576_0081201 3300045051 Bacteria 3372
425 Ga0451576_0167851 3300045051 Bacteria 2290
426 Ga0466958_0028498 3300045836 Bacteria 3311
427 Ga0495590_0003984 3300046457 Bacteria 5998
428 Ga0495629_0060333 3300046459 Bacteria 2651
429 Ga0495638_0049107 3300046460 Bacteria 2639
430 Ga0495650_0000329 3300046471 Bacteria 84971
431 Ga0495639_0017217 3300046475 Bacteria 3139
432 Ga0495585_0008761 3300046492 Bacteria 6116
433 Ga0495607_0128902 3300046501 Bacteria 1319
434 Ga0495583_0000628 3300046506 Bacteria 47247
435 Ga0495606_0000001 3300046507 Bacteria 592123
436 Ga0495606_0001339 3300046507 Bacteria 33542
437 Ga0495610_0001848 3300046512 Bacteria 18355
438 Ga0495610_0016504 3300046512 Bacteria 4246
439 Ga0495620_0035573 3300046515 Bacteria 2237
440 Ga0495632_0003423 3300046519 Bacteria 11276
441 Ga0495632_0019378 3300046519 Bacteria 3708
442 Ga0495643_0042463 3300046522 Bacteria 2477
443 Ga0495648_0057782 3300046524 Bacteria 2324
444 Ga0495621_0000904 3300046539 Bacteria 7543
445 Ga0495645_0061193 3300046543 Bacteria 2728
446 Ga0495668_0000474 3300046616 Bacteria 50676
447 Ga0495668_0033330 3300046616 Bacteria 2894
448 Ga0495625_0003318 3300046660 Bacteria 16212
449 Ga0495647_0006716 3300046681 Bacteria 3828
450 Ga0495647_0018493 3300046681 Bacteria 2482
451 Ga0495658_0006191 3300046683 Bacteria 5875
452 Ga0495670_0078754 3300046691 Bacteria 1677
453 Ga0495649_0000386 3300046694 Bacteria 38357
454 Ga0495589_0019325 3300046794 Bacteria 3495
455 Ga0495600_0060720 3300046809 Bacteria 2469
456 Ga0495684_0092413 3300047471 Bacteria 2292
457 Ga0495686_0005405 3300047472 Bacteria 10088
458 Ga0496100_0051032 3300048903 Bacteria 2683
459 Ga0496101_0052358 3300048904 Bacteria 2943
460 Ga0496101_0291367 3300048904 Bacteria 1277
461 Ga0496102_0007022 3300048905 Bacteria 9615
462 Ga0496102_0008369 3300048905 Bacteria 8859
463 Ga0496102_0518629 3300048905 Bacteria 1114
464 Ga0496104_0002996 3300048907 Bacteria 14561
465 Ga0496104_0031621 3300048907 Bacteria 4923
466 Ga0496105_0019359 3300048908 Bacteria 5490
467 Ga0496105_0079723 3300048908 Bacteria 2704
468 Ga0496105_0087831 3300048908 Bacteria 2569
469 Ga0496108_0056190 3300048911 Bacteria 3306
470 Ga0496108_0147745 3300048911 Bacteria 2027
471 Ga0496108_0195435 3300048911 Bacteria 1754
472 Ga0496110_0078442 3300048913 Bacteria 2940
473 Ga0496110_0359809 3300048913 Bacteria 1326
474 Ga0496112_0109434 3300048915 Bacteria 2733
475 Ga0496113_0038115 3300048916 Bacteria 3532
476 Ga0496113_0080078 3300048916 Bacteria 2501
477 Ga0496114_0015736 3300048917 Bacteria 6087
478 Ga0496114_0103021 3300048917 Bacteria 2439
479 Ga0496114_0137482 3300048917 Bacteria 2113
480 Ga0496114_0408678 3300048917 Bacteria 1202
481 Ga0496115_0003633 3300048918 Bacteria 11100
482 Ga0496124_0073642 3300048927 Bacteria 2826
483 Ga0501309_004053 3300049129 Bacteria 1691
484 Ga0501310_002776 3300049130 Bacteria 1678
485 Ga0501310_010318 3300049130 Bacteria 1040
486 Ga0501305_005422 3300049161 Bacteria 1545
487 Ga0501311_002816 3300049527 Bacteria 1707
488 Ga0501043_0000024 3300049579 Bacteria 154045
489 Ga0501046_0000173 3300049580 Bacteria 65571
490 Ga0501047_0000051 3300049581 Bacteria 154281
491 Ga0501048_0005127 3300049582 Bacteria 9981
492 Ga0501198_000003 3300049649 Bacteria 175301
493 Ga0501222_000001 3300049662 Bacteria 307689
494 Ga0501222_000413 3300049662 Bacteria 6442
495 Ga0501233_006681 3300049668 Bacteria 2174
496 Ga0501235_014643 3300049669 Bacteria 1728
497 Ga0501249_002043 3300049679 Bacteria 4107
498 Ga0501221_001265 3300049704 Bacteria 4182
499 Ga0501262_001963 3300049759 Bacteria 2318
500 Ga0501268_023687 3300049765 Bacteria 1068
501 Ga0501045_0083239 3300049824 Bacteria 2360
502 nmdc:mga0k408_16581_c1 3300050493 Bacteria 4090
503 nmdc:mga0k408_31648_c1 3300050493 Bacteria 2493
504 nmdc:mga0k408_36237_c1 3300050493 Bacteria 2831
505 nmdc:mga0k408_4394_c2 3300050493 Bacteria 5891
506 nmdc:mga0k408_54126_c1 3300050493 Bacteria 2326
507 nmdc:mga0k408_54981_c1 3300050493 Bacteria 2307
508 nmdc:mga0k408_93357_c1 3300050493 Bacteria 1769
509 nmdc:mga07m45_23934_c1 3300050496 Bacteria 3341
510 nmdc:mga09592_1348_c1 3300050508 Bacteria 19609
511 nmdc:mga0qj67_16850_c1 3300050509 Bacteria 5549
512 nmdc:mga0qj67_337087_c1 3300050509 Bacteria 1220
513 nmdc:mga08y16_274380_c1 3300050511 Bacteria 1740
514 nmdc:mga08y16_439885_c1 3300050511 Bacteria 1331
515 Ga0500635_0000330 3300053080 Bacteria 16279
516 Ga0495619_0055920 3300053085 Bacteria 2615
517 Ga0500578_0000182 3300053086 Bacteria 75873
518 Ga0500646_0007684 3300053090 Bacteria 2753
519 Ga0500583_0057760 3300053092 Bacteria 1823
520 Ga0500651_0004839 3300053093 Bacteria 7604
521 Ga0500650_0013775 3300053098 Bacteria 3401
522 Ga0500593_016373 3300053117 Bacteria 3211
523 Ga0500642_0066834 3300053130 Bacteria 1628
524 Ga0500652_000309 3300053131 Bacteria 17694
525 Ga0500655_005748 3300053133 Bacteria 2231
526 Ga0500577_0007374 3300053142 Bacteria 3080
527 Ga0500590_004896 3300053148 Bacteria 6393
528 Ga0500619_000134 3300053154 Bacteria 19056
529 Ga0500622_0001582 3300053156 Bacteria 17915
530 Ga0500636_0059034 3300053177 Bacteria 2242
531 Ga0466962_0022161 3300061719 Bacteria 3050

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100002870 Ga0070662_1000028703 312
2 3300025933 Ga0207706_10030321 Ga0207706_100303213 312
3 3300025935 Ga0207709_10001721 Ga0207709_100017217 313
4 3300026089 Ga0207648_10000037 Ga0207648_100000379 313
5 3300031238 Ga0265332_10000030 Ga0265332_10000030120 313
6 3300046492 Ga0495585_0008761 Ga0495585_0008761_1118_2134 314
7 3300048917 Ga0496114_0015736 Ga0496114_0015736_851_1879 314
8 3300035695 Ga0373927_0043918 Ga0373927_0043918_1556_2575 315
9 3300039450 Ga0436363_1083478 Ga0436363_1083478_792_1808 315
10 3300046475 Ga0495639_0017217 Ga0495639_0017217_992_2011 315
11 3300036401 Ga0373937_0123177 Ga0373937_0123177_119_1147 316
12 3300044683 Ga0466965_0003866 Ga0466965_0003866_1007_2008 316
13 3300044693 Ga0466961_0061275 Ga0466961_0061275_705_1706 316
14 3300045049 Ga0466959_0011523 Ga0466959_0011523_1521_2522 316
15 3300045836 Ga0466958_0028498 Ga0466958_0028498_730_1731 316
16 3300049130 Ga0501310_002776 Ga0501310_002776_27_998 316
17 3300014325 Ga0163163_10335187 Ga0163163_103351872 317
18 3300026023 Ga0207677_10127528 Ga0207677_101275282 317
19 3300035725 Ga0373947_0113054 Ga0373947_0113054_320_1348 317
20 3300046459 Ga0495629_0060333 Ga0495629_0060333_247_1275 317
21 3300046683 Ga0495658_0006191 Ga0495658_0006191_1606_2634 317
22 3300053080 Ga0500635_0000330 Ga0500635_0000330_4028_5035 317
23 3300053085 Ga0495619_0055920 Ga0495619_0055920_435_1463 317
24 3300005344 Ga0070661_100012722 Ga0070661_1000127225 318
25 3300005366 Ga0070659_100002488 Ga0070659_1000024887 318
26 3300005455 Ga0070663_100267990 Ga0070663_1002679901 318
27 3300025920 Ga0207649_10005583 Ga0207649_100055835 318
28 3300025932 Ga0207690_10007581 Ga0207690_100075816 318
29 3300025945 Ga0207679_10011113 Ga0207679_100111132 318
30 3300026095 Ga0207676_10076456 Ga0207676_100764562 318
31 3300041512 Ga0451853_2247177 Ga0451853_2247177_98_1108 318
32 3300005535 Ga0070684_100129983 Ga0070684_1001299833 319
33 3300009177 Ga0105248_10102510 Ga0105248_101025102 319
34 3300025913 Ga0207695_10117379 Ga0207695_101173793 319
35 3300005331 Ga0070670_100081313 Ga0070670_1000813132 320
36 3300005618 Ga0068864_100058060 Ga0068864_1000580602 320
37 3300006237 Ga0097621_100167092 Ga0097621_1001670922 320
38 3300026095 Ga0207676_10459123 Ga0207676_104591232 320
39 3300031239 Ga0265328_10008511 Ga0265328_100085113 320
40 3300031250 Ga0265331_10007217 Ga0265331_100072173 320
41 3300031251 Ga0265327_10026013 Ga0265327_100260132 320
42 3300048904 Ga0496101_0291367 Ga0496101_0291367_49_1068 320
43 3300048913 Ga0496110_0359809 Ga0496110_0359809_272_1291 320
44 3300005328 Ga0070676_10041692 Ga0070676_100416923 321
45 3300005334 Ga0068869_100003187 Ga0068869_1000031872 321
46 3300005335 Ga0070666_10233765 Ga0070666_102337651 321
47 3300005338 Ga0068868_100001433 Ga0068868_1000014337 321
48 3300005366 Ga0070659_100015279 Ga0070659_1000152796 321
49 3300005457 Ga0070662_100001070 Ga0070662_10000107014 321
50 3300005539 Ga0068853_100003281 Ga0068853_1000032817 321
51 3300005547 Ga0070693_100018518 Ga0070693_1000185182 321
52 3300005578 Ga0068854_100022165 Ga0068854_1000221653 321
53 3300005615 Ga0070702_100069884 Ga0070702_1000698843 321
54 3300005616 Ga0068852_100045093 Ga0068852_1000450934 321
55 3300005618 Ga0068864_100001208 Ga0068864_1000012087 321
56 3300005719 Ga0068861_100011385 Ga0068861_1000113857 321
57 3300005842 Ga0068858_100027483 Ga0068858_1000274832 321
58 3300006237 Ga0097621_100041421 Ga0097621_1000414214 321
59 3300009174 Ga0105241_10067363 Ga0105241_100673633 321
60 3300009177 Ga0105248_10006273 Ga0105248_1000627314 321
61 3300009551 Ga0105238_10216528 Ga0105238_102165282 321
62 3300010375 Ga0105239_10146529 Ga0105239_101465293 321
63 3300013306 Ga0163162_10039424 Ga0163162_100394244 321
64 3300013307 Ga0157372_10267700 Ga0157372_102677001 321
65 3300014745 Ga0157377_10002392 Ga0157377_1000239211 321
66 3300014968 Ga0157379_10016132 Ga0157379_100161324 321
67 3300025907 Ga0207645_10016926 Ga0207645_100169263 321
68 3300025923 Ga0207681_10022723 Ga0207681_100227234 321
69 3300025924 Ga0207694_10091166 Ga0207694_100911663 321
70 3300025932 Ga0207690_10041443 Ga0207690_100414433 321
71 3300025933 Ga0207706_10007806 Ga0207706_100078067 321
72 3300025942 Ga0207689_10007748 Ga0207689_1000774811 321
73 3300025981 Ga0207640_10039484 Ga0207640_100394844 321
74 3300026035 Ga0207703_10081579 Ga0207703_100815792 321
75 3300026041 Ga0207639_10010143 Ga0207639_100101433 321
76 3300026078 Ga0207702_10253805 Ga0207702_102538051 321
77 3300026088 Ga0207641_10104424 Ga0207641_101044242 321
78 3300026095 Ga0207676_10009712 Ga0207676_100097124 321
79 3300026118 Ga0207675_100001459 Ga0207675_1000014597 321
80 3300026142 Ga0207698_10006139 Ga0207698_100061395 321
81 3300035121 Ga0373960_0005051 Ga0373960_0005051_1199_2206 321
82 3300035691 Ga0373931_0000870 Ga0373931_0000870_3125_4132 321
83 3300042135 Ga0450899_005450 Ga0450899_005450_290_1285 321
84 3300045051 Ga0451576_0167851 Ga0451576_0167851_514_1521 321
85 3300048903 Ga0496100_0051032 Ga0496100_0051032_1265_2272 321
86 3300048904 Ga0496101_0052358 Ga0496101_0052358_1501_2508 321
87 3300048905 Ga0496102_0008369 Ga0496102_0008369_4754_5761 321
88 3300048907 Ga0496104_0031621 Ga0496104_0031621_938_1945 321
89 3300048908 Ga0496105_0079723 Ga0496105_0079723_123_1130 321
90 3300048911 Ga0496108_0056190 Ga0496108_0056190_1405_2412 321
91 3300048913 Ga0496110_0078442 Ga0496110_0078442_594_1601 321
92 3300048916 Ga0496113_0038115 Ga0496113_0038115_1630_2637 321
93 3300048917 Ga0496114_0137482 Ga0496114_0137482_1085_2092 321
94 3300048918 Ga0496115_0003633 Ga0496115_0003633_7334_8341 321
95 3300003775 Ga0055524_1000227 Ga0055524_100022739 322
96 3300005467 Ga0070706_100355960 Ga0070706_1003559602 322
97 3300006946 Ga0079104_1000024 Ga0079104_1000024169 322
98 3300025291 Ga0209675_1011720 Ga0209675_10117203 322
99 3300025299 Ga0209256_1000011 Ga0209256_1000011297 322
100 3300025913 Ga0207695_10437014 Ga0207695_104370141 322
101 3300027111 Ga0209281_1000104 Ga0209281_100010433 322
102 3300039447 Ga0436361_0050220 Ga0436361_0050220_3468_4460 322
103 3300050493 nmdc:mga0k408_31648_c1 nmdc:mga0k408_31648_c1_798_1808 322
104 3300053117 Ga0500593_016373 Ga0500593_016373_1443_2456 322
105 3300003792 Ga0055540_1011087 Ga0055540_10110871 323
106 3300009148 Ga0105243_10022977 Ga0105243_100229772 323
107 3300025253 Ga0209677_103116 Ga0209677_1031163 323
108 3300025935 Ga0207709_10059906 Ga0207709_100599061 323
109 3300042876 Ga0451577_0216782 Ga0451577_0216782_213_1217 323
110 3300044684 Ga0466966_0015258 Ga0466966_0015258_464_1465 323
111 3300044719 Ga0466971_0040395 Ga0466971_0040395_790_1791 323
112 3300044765 Ga0466970_0007109 Ga0466970_0007109_1439_2440 323
113 3300045051 Ga0451576_0032586 Ga0451576_0032586_1498_2523 323
114 3300061719 Ga0466962_0022161 Ga0466962_0022161_1139_2140 323
115 iso_pu_bacteria 2643221544 2643746038 323
116 iso_pu_bacteria 2643221585 2643937003 323
117 iso_pu_bacteria 2643221639 2644218031 323
118 iso_pu_bacteria 2643221646 2644258228 323
119 iso_pu_bacteria 2643221656 2644318168 323
120 iso_pu_bacteria 2738541337 2739057166 323
121 3300005327 Ga0070658_10370031 Ga0070658_103700311 324
122 3300005331 Ga0070670_100006130 Ga0070670_1000061307 324
123 3300005354 Ga0070675_100018720 Ga0070675_1000187205 324
124 3300005356 Ga0070674_100147199 Ga0070674_1001471992 324
125 3300005456 Ga0070678_100064748 Ga0070678_1000647481 324
126 3300005543 Ga0070672_100036630 Ga0070672_1000366304 324
127 3300005618 Ga0068864_100036794 Ga0068864_1000367944 324
128 3300006195 Ga0075366_10000823 Ga0075366_1000082310 324
129 3300009094 Ga0111539_10423514 Ga0111539_104235142 324
130 3300009148 Ga0105243_10118756 Ga0105243_101187563 324
131 3300009553 Ga0105249_10257469 Ga0105249_102574692 324
132 3300013308 Ga0157375_10184820 Ga0157375_101848204 324
133 3300025298 Ga0209050_1004228 Ga0209050_100422812 324
134 3300025909 Ga0207705_10237955 Ga0207705_102379551 324
135 3300025923 Ga0207681_10063833 Ga0207681_100638332 324
136 3300025926 Ga0207659_10007056 Ga0207659_100070563 324
137 3300025937 Ga0207669_10111422 Ga0207669_101114222 324
138 3300026116 Ga0207674_10033930 Ga0207674_100339303 324
139 3300026121 Ga0207683_10128341 Ga0207683_101283412 324
140 3300031344 Ga0265316_10000180 Ga0265316_1000018016 324
141 3300037471 Ga0395905_0001528 Ga0395905_0001528_17798_18805 324
142 3300042012 Ga0439455_0008313 Ga0439455_0008313_241_1248 324
143 3300046539 Ga0495621_0000904 Ga0495621_0000904_5146_6162 324
144 3300050511 nmdc:mga08y16_439885_c1 nmdc:mga08y16_439885_c1_263_1279 324
145 3300003322 rootL2_10019891 rootL2_100198913 325
146 3300003761 Ga0055535_1000107 Ga0055535_100010722 325
147 3300003763 Ga0055529_1000111 Ga0055529_100011155 325
148 3300003794 Ga0055531_10000021 Ga0055531_1000002171 325
149 3300005563 Ga0068855_100007253 Ga0068855_1000072537 325
150 3300006195 Ga0075366_10146802 Ga0075366_101468021 325
151 3300006353 Ga0075370_10031514 Ga0075370_100315144 325
152 3300006846 Ga0075430_100208152 Ga0075430_1002081522 325
153 3300025242 Ga0209258_100267 Ga0209258_10026722 325
154 3300025256 Ga0209759_1001246 Ga0209759_100124611 325
155 3300025256 Ga0209759_1011814 Ga0209759_10118142 325
156 3300025272 Ga0209455_1000158 Ga0209455_100015840 325
157 3300025303 Ga0209051_1009600 Ga0209051_10096005 325
158 3300025304 Ga0209257_1000032 Ga0209257_1000032449 325
159 3300025304 Ga0209257_1017020 Ga0209257_10170203 325
160 3300025949 Ga0207667_10005517 Ga0207667_100055178 325
161 3300026116 Ga0207674_10255040 Ga0207674_102550402 325
162 3300028794 Ga0307515_10174440 Ga0307515_101744401 325
163 3300031548 Ga0307408_100000056 Ga0307408_100000056117 325
164 3300031548 Ga0307408_100098777 Ga0307408_1000987772 325
165 3300032004 Ga0307414_10006110 Ga0307414_100061102 325
166 3300032005 Ga0307411_10000184 Ga0307411_100001847 325
167 3300035114 Ga0373939_0000063 Ga0373939_0000063_26236_27246 325
168 3300035121 Ga0373960_0000294 Ga0373960_0000294_8447_9457 325
169 3300035691 Ga0373931_0003270 Ga0373931_0003270_1692_2702 325
170 3300042000 Ga0439437_000891 Ga0439437_000891_65_1075 325
171 3300042126 Ga0450888_000764 Ga0450888_000764_965_1975 325
172 3300042129 Ga0450891_000139 Ga0450891_000139_3646_4656 325
173 3300042130 Ga0450892_000941 Ga0450892_000941_1461_2471 325
174 3300045051 Ga0451576_0001435 Ga0451576_0001435_29947_30969 325
175 3300045051 Ga0451576_0081201 Ga0451576_0081201_1135_2145 325
176 3300049129 Ga0501309_004053 Ga0501309_004053_658_1668 325
177 3300049161 Ga0501305_005422 Ga0501305_005422_90_1100 325
178 3300049527 Ga0501311_002816 Ga0501311_002816_687_1697 325
179 3300049662 Ga0501222_000413 Ga0501222_000413_2552_3562 325
180 3300049668 Ga0501233_006681 Ga0501233_006681_461_1471 325
181 3300049669 Ga0501235_014643 Ga0501235_014643_85_1095 325
182 3300049704 Ga0501221_001265 Ga0501221_001265_2406_3416 325
183 3300049765 Ga0501268_023687 Ga0501268_023687_38_1048 325
184 3300050493 nmdc:mga0k408_54981_c1 nmdc:mga0k408_54981_c1_510_1520 325
185 3300050496 nmdc:mga07m45_23934_c1 nmdc:mga07m45_23934_c1_1486_2496 325
186 3300050509 nmdc:mga0qj67_337087_c1 nmdc:mga0qj67_337087_c1_201_1199 325
187 iso_pu_bacteria 2585428058 2587733676 325
188 iso_pu_bacteria 2643221660 2644339643 325
189 3300003320 rootH2_10029312 rootH2_100293129 326
190 3300003322 rootL2_10131798 rootL2_101317983 326
191 3300003323 rootH1_10012734 rootH1_100127342 326
192 3300003756 Ga0055533_1000011 Ga0055533_100001172 326
193 3300003759 Ga0055525_1000468 Ga0055525_100046810 326
194 3300005327 Ga0070658_10087406 Ga0070658_100874062 326
195 3300005334 Ga0068869_100042093 Ga0068869_1000420932 326
196 3300005339 Ga0070660_100243605 Ga0070660_1002436052 326
197 3300005344 Ga0070661_100141862 Ga0070661_1001418622 326
198 3300006195 Ga0075366_10140097 Ga0075366_101400972 326
199 3300009093 Ga0105240_10068912 Ga0105240_100689123 326
200 3300009093 Ga0105240_10209141 Ga0105240_102091412 326
201 3300009098 Ga0105245_10363798 Ga0105245_103637982 326
202 3300009545 Ga0105237_10586999 Ga0105237_105869991 326
203 3300009551 Ga0105238_10260369 Ga0105238_102603692 326
204 3300013308 Ga0157375_10869704 Ga0157375_108697041 326
205 3300025226 Ga0209674_100003 Ga0209674_100003373 326
206 3300025230 Ga0209563_100010 Ga0209563_100010102 326
207 3300025231 Ga0207427_100869 Ga0207427_10086911 326
208 3300025253 Ga0209677_100068 Ga0209677_10006820 326
209 3300025256 Ga0209759_1002289 Ga0209759_10022895 326
210 3300025913 Ga0207695_10055277 Ga0207695_100552772 326
211 3300025920 Ga0207649_10160956 Ga0207649_101609562 326
212 3300025942 Ga0207689_10140581 Ga0207689_101405812 326
213 3300025949 Ga0207667_10343829 Ga0207667_103438292 326
214 3300026116 Ga0207674_10227592 Ga0207674_102275921 326
215 3300031730 Ga0307516_10000517 Ga0307516_1000051738 326
216 3300044656 Ga0466969_0000157 Ga0466969_0000157_33084_34103 326
217 3300044658 Ga0466972_0010902 Ga0466972_0010902_3121_4131 326
218 3300044684 Ga0466966_0010737 Ga0466966_0010737_3873_4892 326
219 3300045049 Ga0466959_0075544 Ga0466959_0075544_1132_2151 326
220 3300046506 Ga0495583_0000628 Ga0495583_0000628_33427_34446 326
221 3300046507 Ga0495606_0001339 Ga0495606_0001339_8634_9653 326
222 3300046524 Ga0495648_0057782 Ga0495648_0057782_755_1774 326
223 3300046694 Ga0495649_0000386 Ga0495649_0000386_13967_14986 326
224 3300046794 Ga0495589_0019325 Ga0495589_0019325_1060_2079 326
225 3300048915 Ga0496112_0109434 Ga0496112_0109434_597_1619 326
226 3300050493 nmdc:mga0k408_93357_c1 nmdc:mga0k408_93357_c1_435_1451 326
227 3300053177 Ga0500636_0059034 Ga0500636_0059034_516_1535 326
228 iso_pu_bacteria 2547132512 2548848492 326
229 iso_pu_bacteria 2891633521 2891633833 326
230 3300005366 Ga0070659_100339730 Ga0070659_1003397301 327
231 3300025932 Ga0207690_10082677 Ga0207690_100826772 327
232 3300026023 Ga0207677_10067696 Ga0207677_100676962 327
233 3300035691 Ga0373931_0094987 Ga0373931_0094987_87_1103 327
234 3300049130 Ga0501310_010318 Ga0501310_010318_15_1016 327
235 3300002705 JGI25156J39149_1010588 JGI25156J39149_10105883 328
236 3300025256 Ga0209759_1000847 Ga0209759_10008473 328
237 3300028794 Ga0307515_10054018 Ga0307515_100540184 328
238 3300003771 Ga0055526_1000070 Ga0055526_100007061 329
239 3300005355 Ga0070671_100028423 Ga0070671_1000284234 329
240 3300006048 Ga0075363_100033553 Ga0075363_1000335532 329
241 3300009177 Ga0105248_10024158 Ga0105248_100241587 329
242 3300014969 Ga0157376_10189434 Ga0157376_101894342 329
243 3300026041 Ga0207639_10107749 Ga0207639_101077492 329
244 3300046471 Ga0495650_0000329 Ga0495650_0000329_67149_68165 329
245 3300046501 Ga0495607_0128902 Ga0495607_0128902_180_1196 329
246 3300046507 Ga0495606_0000001 Ga0495606_0000001_416039_417055 329
247 3300046512 Ga0495610_0001848 Ga0495610_0001848_5932_6948 329
248 3300046616 Ga0495668_0000474 Ga0495668_0000474_17056_18072 329
249 3300046616 Ga0495668_0033330 Ga0495668_0033330_373_1389 329
250 3300047472 Ga0495686_0005405 Ga0495686_0005405_1287_2303 329
251 iso_pu_bacteria 2585428057 2587729101 329
252 iso_pu_bacteria 2588253510 2588294061 329
253 iso_pu_bacteria 2643221592 2643967162 329
254 iso_pu_bacteria 2643221625 2644139993 329
255 iso_pu_bacteria 2643221648 2644271233 329
256 3300003323 rootH1_10185320 rootH1_101853202 330
257 3300005327 Ga0070658_10253365 Ga0070658_102533652 330
258 3300005328 Ga0070676_10008107 Ga0070676_100081072 330
259 3300005329 Ga0070683_100088191 Ga0070683_1000881912 330
260 3300005331 Ga0070670_100015540 Ga0070670_1000155407 330
261 3300005333 Ga0070677_10017591 Ga0070677_100175914 330
262 3300005334 Ga0068869_100045356 Ga0068869_1000453563 330
263 3300005335 Ga0070666_10221256 Ga0070666_102212562 330
264 3300005336 Ga0070680_100005902 Ga0070680_1000059026 330
265 3300005343 Ga0070687_100054457 Ga0070687_1000544572 330
266 3300005344 Ga0070661_100322578 Ga0070661_1003225781 330
267 3300005347 Ga0070668_100019089 Ga0070668_1000190891 330
268 3300005353 Ga0070669_100030933 Ga0070669_1000309334 330
269 3300005353 Ga0070669_100193271 Ga0070669_1001932712 330
270 3300005354 Ga0070675_100012627 Ga0070675_1000126276 330
271 3300005354 Ga0070675_100236953 Ga0070675_1002369531 330
272 3300005355 Ga0070671_100325800 Ga0070671_1003258001 330
273 3300005356 Ga0070674_100010654 Ga0070674_1000106542 330
274 3300005366 Ga0070659_100263807 Ga0070659_1002638072 330
275 3300005367 Ga0070667_100003252 Ga0070667_10000325214 330
276 3300005441 Ga0070700_100021791 Ga0070700_1000217912 330
277 3300005457 Ga0070662_100165515 Ga0070662_1001655151 330
278 3300005459 Ga0068867_100015847 Ga0068867_1000158476 330
279 3300005530 Ga0070679_100017484 Ga0070679_1000174844 330
280 3300005539 Ga0068853_100307180 Ga0068853_1003071802 330
281 3300005543 Ga0070672_100001996 Ga0070672_1000019966 330
282 3300005543 Ga0070672_100108461 Ga0070672_1001084612 330
283 3300005544 Ga0070686_100061741 Ga0070686_1000617414 330
284 3300005564 Ga0070664_100190400 Ga0070664_1001904001 330
285 3300005578 Ga0068854_100220463 Ga0068854_1002204632 330
286 3300005616 Ga0068852_100199145 Ga0068852_1001991452 330
287 3300005617 Ga0068859_100021684 Ga0068859_1000216842 330
288 3300005618 Ga0068864_100032262 Ga0068864_1000322623 330
289 3300005719 Ga0068861_100008773 Ga0068861_1000087733 330
290 3300005841 Ga0068863_100002785 Ga0068863_10000278519 330
291 3300005842 Ga0068858_100016124 Ga0068858_1000161243 330
292 3300005843 Ga0068860_100001260 Ga0068860_10000126021 330
293 3300005844 Ga0068862_100030222 Ga0068862_1000302224 330
294 3300006237 Ga0097621_100287171 Ga0097621_1002871711 330
295 3300006931 Ga0097620_100021684 Ga0097620_1000216847 330
296 3300009101 Ga0105247_10047738 Ga0105247_100477382 330
297 3300009176 Ga0105242_10194341 Ga0105242_101943412 330
298 3300009177 Ga0105248_10047429 Ga0105248_100474293 330
299 3300009177 Ga0105248_10247246 Ga0105248_102472461 330
300 3300009553 Ga0105249_10008506 Ga0105249_1000850611 330
301 3300013306 Ga0163162_10007061 Ga0163162_100070617 330
302 3300013308 Ga0157375_10108585 Ga0157375_101085854 330
303 3300014326 Ga0157380_10033970 Ga0157380_100339703 330
304 3300014968 Ga0157379_10008941 Ga0157379_100089415 330
305 3300017792 Ga0163161_10094822 Ga0163161_100948222 330
306 3300025315 Ga0207697_10082366 Ga0207697_100823662 330
307 3300025899 Ga0207642_10038849 Ga0207642_100388492 330
308 3300025901 Ga0207688_10081050 Ga0207688_100810501 330
309 3300025904 Ga0207647_10137730 Ga0207647_101377302 330
310 3300025914 Ga0207671_10001444 Ga0207671_100014449 330
311 3300025917 Ga0207660_10008400 Ga0207660_100084006 330
312 3300025921 Ga0207652_10033780 Ga0207652_100337802 330
313 3300025923 Ga0207681_10004364 Ga0207681_100043649 330
314 3300025925 Ga0207650_10001175 Ga0207650_100011757 330
315 3300025926 Ga0207659_10001653 Ga0207659_100016537 330
316 3300025931 Ga0207644_10143772 Ga0207644_101437722 330
317 3300025933 Ga0207706_10021986 Ga0207706_100219866 330
318 3300025934 Ga0207686_10152492 Ga0207686_101524922 330
319 3300025935 Ga0207709_10031240 Ga0207709_100312402 330
320 3300025937 Ga0207669_10025495 Ga0207669_100254954 330
321 3300025940 Ga0207691_10070596 Ga0207691_100705964 330
322 3300025941 Ga0207711_10044076 Ga0207711_100440762 330
323 3300025941 Ga0207711_10065978 Ga0207711_100659783 330
324 3300025941 Ga0207711_10113253 Ga0207711_101132534 330
325 3300025942 Ga0207689_10018156 Ga0207689_100181563 330
326 3300025960 Ga0207651_10270416 Ga0207651_102704161 330
327 3300025961 Ga0207712_10019737 Ga0207712_100197372 330
328 3300025972 Ga0207668_10017174 Ga0207668_100171744 330
329 3300025986 Ga0207658_10000458 Ga0207658_1000045820 330
330 3300026023 Ga0207677_10137769 Ga0207677_101377693 330
331 3300026035 Ga0207703_10021127 Ga0207703_100211273 330
332 3300026067 Ga0207678_10078251 Ga0207678_100782512 330
333 3300026075 Ga0207708_10023923 Ga0207708_100239234 330
334 3300026088 Ga0207641_10012454 Ga0207641_100124543 330
335 3300026095 Ga0207676_10036213 Ga0207676_100362133 330
336 3300026118 Ga0207675_100008112 Ga0207675_1000081122 330
337 3300026121 Ga0207683_10191247 Ga0207683_101912473 330
338 3300028380 Ga0268265_10200089 Ga0268265_102000892 330
339 3300028381 Ga0268264_10000963 Ga0268264_1000096315 330
340 3300031824 Ga0307413_10219676 Ga0307413_102196761 330
341 3300031911 Ga0307412_10236148 Ga0307412_102361481 330
342 3300031995 Ga0307409_100006655 Ga0307409_1000066557 330
343 3300032002 Ga0307416_100019732 Ga0307416_1000197324 330
344 3300032005 Ga0307411_10004105 Ga0307411_100041057 330
345 3300032126 Ga0307415_100042363 Ga0307415_1000423634 330
346 3300035116 Ga0373945_0087807 Ga0373945_0087807_47_1066 330
347 3300036401 Ga0373937_0190646 Ga0373937_0190646_542_1561 330
348 3300046681 Ga0495647_0006716 Ga0495647_0006716_2358_3377 330
349 3300046691 Ga0495670_0078754 Ga0495670_0078754_440_1459 330
350 3300046809 Ga0495600_0060720 Ga0495600_0060720_1041_2060 330
351 3300047471 Ga0495684_0092413 Ga0495684_0092413_1015_2034 330
352 3300048905 Ga0496102_0518629 Ga0496102_0518629_29_1063 330
353 3300048908 Ga0496105_0087831 Ga0496105_0087831_904_1938 330
354 3300048911 Ga0496108_0147745 Ga0496108_0147745_963_1997 330
355 3300048916 Ga0496113_0080078 Ga0496113_0080078_25_1059 330
356 3300050511 nmdc:mga08y16_274380_c1 nmdc:mga08y16_274380_c1_543_1562 330
357 3300005329 Ga0070683_100198468 Ga0070683_1001984682 331
358 3300005459 Ga0068867_100000036 Ga0068867_1000000369 331
359 3300005577 Ga0068857_100039125 Ga0068857_1000391255 331
360 3300005616 Ga0068852_100082887 Ga0068852_1000828872 331
361 3300009148 Ga0105243_10001240 Ga0105243_1000124013 331
362 3300014745 Ga0157377_10000010 Ga0157377_1000001057 331
363 3300026142 Ga0207698_10045436 Ga0207698_100454362 331
364 3300031852 Ga0307410_10271308 Ga0307410_102713082 331
365 3300044712 Ga0453684_0008823 Ga0453684_0008823_15008_16042 331
366 3300044901 Ga0466960_0070087 Ga0466960_0070087_487_1521 331
367 3300048927 Ga0496124_0073642 Ga0496124_0073642_1321_2352 331
368 3300049679 Ga0501249_002043 Ga0501249_002043_83_1105 331
369 3300050493 nmdc:mga0k408_16581_c1 nmdc:mga0k408_16581_c1_1450_2634 331
370 iso_pu_bacteria 2585428062 2587759083 331
371 3300028381 Ga0268264_10037911 Ga0268264_100379112 332
372 3300044735 Ga0466968_0082237 Ga0466968_0082237_210_1211 332
373 3300046543 Ga0495645_0061193 Ga0495645_0061193_316_1344 332
374 3300003215 JGI25153J46596_10001786 JGI25153J46596_100017866 333
375 3300003771 Ga0055526_1003988 Ga0055526_10039882 333
376 3300003791 Ga0055530_10008633 Ga0055530_100086332 333
377 3300005262 Ga0065165_1000707 Ga0065165_100070734 333
378 3300005459 Ga0068867_100046698 Ga0068867_1000466984 333
379 3300025245 Ga0207425_1000328 Ga0207425_10003286 333
380 3300025258 Ga0209129_1000035 Ga0209129_1000035286 333
381 3300025263 Ga0209565_1014805 Ga0209565_10148052 333
382 3300025273 Ga0209673_1003283 Ga0209673_10032832 333
383 3300025295 Ga0209564_1000024 Ga0209564_1000024480 333
384 3300025297 Ga0209758_1000066 Ga0209758_100006632 333
385 3300025298 Ga0209050_1000178 Ga0209050_100017867 333
386 3300025934 Ga0207686_10288811 Ga0207686_102888111 333
387 3300026067 Ga0207678_10000924 Ga0207678_1000092413 333
388 3300027876 Ga0209974_10002408 Ga0209974_100024085 333
389 3300031730 Ga0307516_10217260 Ga0307516_102172601 333
390 3300032002 Ga0307416_100073360 Ga0307416_1000733602 333
391 3300034820 Ga0373959_0021180 Ga0373959_0021180_131_1150 333
392 3300041452 Ga0451793_1867563 Ga0451793_1867563_859_1887 333
393 3300046460 Ga0495638_0049107 Ga0495638_0049107_402_1430 333
394 3300046519 Ga0495632_0003423 Ga0495632_0003423_1061_2089 333
395 3300049579 Ga0501043_0000024 Ga0501043_0000024_58789_59817 333
396 3300049580 Ga0501046_0000173 Ga0501046_0000173_58789_59817 333
397 3300049581 Ga0501047_0000051 Ga0501047_0000051_94465_95493 333
398 3300049582 Ga0501048_0005127 Ga0501048_0005127_3324_4352 333
399 3300049759 Ga0501262_001963 Ga0501262_001963_1161_2186 333
400 3300049824 Ga0501045_0083239 Ga0501045_0083239_1256_2284 333
401 3300050493 nmdc:mga0k408_36237_c1 nmdc:mga0k408_36237_c1_1604_2641 333
402 3300053086 Ga0500578_0000182 Ga0500578_0000182_23943_24971 333
403 3300053090 Ga0500646_0007684 Ga0500646_0007684_388_1416 333
404 3300053092 Ga0500583_0057760 Ga0500583_0057760_337_1365 333
405 3300053093 Ga0500651_0004839 Ga0500651_0004839_2858_3886 333
406 3300053098 Ga0500650_0013775 Ga0500650_0013775_37_1065 333
407 3300053130 Ga0500642_0066834 Ga0500642_0066834_486_1514 333
408 3300053131 Ga0500652_000309 Ga0500652_000309_12781_13809 333
409 3300053133 Ga0500655_005748 Ga0500655_005748_763_1791 333
410 3300053142 Ga0500577_0007374 Ga0500577_0007374_817_1845 333
411 3300005293 Ga0065715_10009227 Ga0065715_100092274 334
412 3300005328 Ga0070676_10040392 Ga0070676_100403924 334
413 3300005330 Ga0070690_100057470 Ga0070690_1000574703 334
414 3300005331 Ga0070670_100077509 Ga0070670_1000775092 334
415 3300005335 Ga0070666_10001924 Ga0070666_100019242 334
416 3300005338 Ga0068868_100003192 Ga0068868_1000031927 334
417 3300005340 Ga0070689_100346599 Ga0070689_1003465991 334
418 3300005354 Ga0070675_100004634 Ga0070675_1000046342 334
419 3300005354 Ga0070675_100196771 Ga0070675_1001967712 334
420 3300005364 Ga0070673_100015595 Ga0070673_1000155956 334
421 3300005364 Ga0070673_100034120 Ga0070673_1000341203 334
422 3300005365 Ga0070688_100010026 Ga0070688_1000100263 334
423 3300005367 Ga0070667_100011203 Ga0070667_1000112039 334
424 3300005456 Ga0070678_100013316 Ga0070678_1000133164 334
425 3300005457 Ga0070662_100045787 Ga0070662_1000457873 334
426 3300005539 Ga0068853_100090822 Ga0068853_1000908223 334
427 3300005543 Ga0070672_100105390 Ga0070672_1001053901 334
428 3300005543 Ga0070672_100230853 Ga0070672_1002308532 334
429 3300005564 Ga0070664_100208800 Ga0070664_1002088002 334
430 3300005615 Ga0070702_100123254 Ga0070702_1001232541 334
431 3300005617 Ga0068859_100003467 Ga0068859_10000346711 334
432 3300005618 Ga0068864_100011910 Ga0068864_1000119105 334
433 3300005841 Ga0068863_100022314 Ga0068863_1000223147 334
434 3300005842 Ga0068858_100000436 Ga0068858_1000004367 334
435 3300005842 Ga0068858_100063430 Ga0068858_1000634302 334
436 3300005843 Ga0068860_100022605 Ga0068860_1000226054 334
437 3300005843 Ga0068860_100280612 Ga0068860_1002806122 334
438 3300006237 Ga0097621_100010262 Ga0097621_1000102627 334
439 3300006358 Ga0068871_100078765 Ga0068871_1000787652 334
440 3300006931 Ga0097620_100003467 Ga0097620_10000346711 334
441 3300009176 Ga0105242_10207958 Ga0105242_102079582 334
442 3300013296 Ga0157374_10345981 Ga0157374_103459812 334
443 3300013306 Ga0163162_10069032 Ga0163162_100690324 334
444 3300013306 Ga0163162_10487707 Ga0163162_104877072 334
445 3300013308 Ga0157375_10079578 Ga0157375_100795784 334
446 3300014325 Ga0163163_10104206 Ga0163163_101042063 334
447 3300014326 Ga0157380_10071692 Ga0157380_100716923 334
448 3300014326 Ga0157380_10103460 Ga0157380_101034603 334
449 3300014968 Ga0157379_10008733 Ga0157379_100087336 334
450 3300014968 Ga0157379_10021355 Ga0157379_100213553 334
451 3300014969 Ga0157376_10077274 Ga0157376_100772744 334
452 3300017792 Ga0163161_10084417 Ga0163161_100844173 334
453 3300025297 Ga0209758_1000213 Ga0209758_100021378 334
454 3300025893 Ga0207682_10048335 Ga0207682_100483351 334
455 3300025903 Ga0207680_10014016 Ga0207680_100140164 334
456 3300025905 Ga0207685_10033492 Ga0207685_100334922 334
457 3300025907 Ga0207645_10108134 Ga0207645_101081342 334
458 3300025925 Ga0207650_10092072 Ga0207650_100920722 334
459 3300025926 Ga0207659_10004285 Ga0207659_100042857 334
460 3300025931 Ga0207644_10006285 Ga0207644_100062854 334
461 3300025933 Ga0207706_10191472 Ga0207706_101914722 334
462 3300025936 Ga0207670_10008723 Ga0207670_100087232 334
463 3300025937 Ga0207669_10123838 Ga0207669_101238382 334
464 3300025937 Ga0207669_10227133 Ga0207669_102271331 334
465 3300025940 Ga0207691_10082895 Ga0207691_100828952 334
466 3300025941 Ga0207711_10176853 Ga0207711_101768532 334
467 3300025942 Ga0207689_10043151 Ga0207689_100431514 334
468 3300025945 Ga0207679_10168631 Ga0207679_101686312 334
469 3300025945 Ga0207679_10238516 Ga0207679_102385161 334
470 3300025960 Ga0207651_10015996 Ga0207651_100159965 334
471 3300025972 Ga0207668_10030692 Ga0207668_100306924 334
472 3300025986 Ga0207658_10114517 Ga0207658_101145174 334
473 3300026023 Ga0207677_10006505 Ga0207677_100065052 334
474 3300026035 Ga0207703_10004646 Ga0207703_100046467 334
475 3300026035 Ga0207703_10016146 Ga0207703_100161461 334
476 3300026088 Ga0207641_10169855 Ga0207641_101698552 334
477 3300026095 Ga0207676_10000221 Ga0207676_100002216 334
478 3300026121 Ga0207683_10025002 Ga0207683_100250024 334
479 3300028380 Ga0268265_10284748 Ga0268265_102847481 334
480 3300035171 Ga0373946_0034374 Ga0373946_0034374_197_1234 334
481 3300037471 Ga0395905_0004284 Ga0395905_0004284_4824_5837 334
482 3300042439 Ga0439464_0001824 Ga0439464_0001824_3300_4337 334
483 3300046681 Ga0495647_0018493 Ga0495647_0018493_932_1969 334
484 3300048907 Ga0496104_0002996 Ga0496104_0002996_2531_3568 334
485 3300048908 Ga0496105_0019359 Ga0496105_0019359_680_1717 334
486 3300048911 Ga0496108_0195435 Ga0496108_0195435_537_1571 334
487 3300048917 Ga0496114_0408678 Ga0496114_0408678_52_1089 334
488 3300003792 Ga0055540_1000112 Ga0055540_100011237 335
489 3300003794 Ga0055531_10021676 Ga0055531_100216761 335
490 3300005329 Ga0070683_100064962 Ga0070683_1000649624 335
491 3300005344 Ga0070661_100128726 Ga0070661_1001287263 335
492 3300005577 Ga0068857_100144011 Ga0068857_1001440112 335
493 3300005614 Ga0068856_100470658 Ga0068856_1004706581 335
494 3300005616 Ga0068852_100116127 Ga0068852_1001161272 335
495 3300006195 Ga0075366_10055154 Ga0075366_100551543 335
496 3300006846 Ga0075430_100100883 Ga0075430_1001008832 335
497 3300006880 Ga0075429_100000756 Ga0075429_10000075623 335
498 3300013100 Ga0157373_10030122 Ga0157373_100301221 335
499 3300013105 Ga0157369_10188410 Ga0157369_101884102 335
500 3300025298 Ga0209050_1004728 Ga0209050_10047288 335
501 3300025303 Ga0209051_1000016 Ga0209051_100001637 335
502 3300025304 Ga0209257_1000510 Ga0209257_100051023 335
503 3300025919 Ga0207657_10022586 Ga0207657_100225864 335
504 3300025924 Ga0207694_10096331 Ga0207694_100963312 335
505 3300025932 Ga0207690_10045373 Ga0207690_100453733 335
506 3300025944 Ga0207661_10059056 Ga0207661_100590562 335
507 3300025945 Ga0207679_10007653 Ga0207679_100076534 335
508 3300026078 Ga0207702_10013557 Ga0207702_100135574 335
509 3300028794 Ga0307515_10013844 Ga0307515_1001384411 335
510 3300028794 Ga0307515_10066151 Ga0307515_100661512 335
511 3300031456 Ga0307513_10026447 Ga0307513_100264473 335
512 3300031616 Ga0307508_10000142 Ga0307508_1000014263 335
513 3300031649 Ga0307514_10025162 Ga0307514_100251622 335
514 3300031730 Ga0307516_10007360 Ga0307516_100073602 335
515 3300033179 Ga0307507_10141672 Ga0307507_101416722 335
516 3300044656 Ga0466969_0037501 Ga0466969_0037501_1038_2048 335
517 3300044719 Ga0466971_0011291 Ga0466971_0011291_450_1460 335
518 3300045049 Ga0466959_0085138 Ga0466959_0085138_396_1406 335
519 3300046512 Ga0495610_0016504 Ga0495610_0016504_45_1076 335
520 3300046515 Ga0495620_0035573 Ga0495620_0035573_306_1337 335
521 3300046519 Ga0495632_0019378 Ga0495632_0019378_2098_3129 335
522 3300046522 Ga0495643_0042463 Ga0495643_0042463_45_1076 335
523 3300046660 Ga0495625_0003318 Ga0495625_0003318_10865_11896 335
524 3300049649 Ga0501198_000003 Ga0501198_000003_136361_137392 335
525 3300049662 Ga0501222_000001 Ga0501222_000001_253779_254810 335
526 3300050493 nmdc:mga0k408_54126_c1 nmdc:mga0k408_54126_c1_910_1941 335
527 3300006195 Ga0075366_10030750 Ga0075366_100307503 336
528 3300028379 Ga0268266_10220107 Ga0268266_102201072 336
529 3300028794 Ga0307515_10005576 Ga0307515_100055764 336
530 3300030522 Ga0307512_10060993 Ga0307512_100609931 336
531 3300031456 Ga0307513_10164049 Ga0307513_101640492 336
532 3300044683 Ga0466965_0083787 Ga0466965_0083787_71_1081 336
533 3300048905 Ga0496102_0007022 Ga0496102_0007022_8261_9298 336
534 3300048917 Ga0496114_0103021 Ga0496114_0103021_611_1654 336
535 3300050493 nmdc:mga0k408_4394_c2 nmdc:mga0k408_4394_c2_1453_2481 336
536 3300053148 Ga0500590_004896 Ga0500590_004896_1622_2671 336
537 3300053154 Ga0500619_000134 Ga0500619_000134_15441_16478 336
538 3300037471 Ga0395905_0012063 Ga0395905_0012063_6519_7538 337
539 3300037471 Ga0395905_0053882 Ga0395905_0053882_2398_3411 337
540 3300037471 Ga0395905_0265972 Ga0395905_0265972_320_1339 337
541 3300046457 Ga0495590_0003984 Ga0495590_0003984_311_1330 337
542 3300005563 Ga0068855_100079641 Ga0068855_1000796413 338
543 3300029957 Ga0265324_10000232 Ga0265324_100002328 339
544 3300053156 Ga0500622_0001582 Ga0500622_0001582_1462_2601 339
545 3300050508 nmdc:mga09592_1348_c1 nmdc:mga09592_1348_c1_1264_2358 343
546 3300050509 nmdc:mga0qj67_16850_c1 nmdc:mga0qj67_16850_c1_3038_4132 343
547 3300002077 JGI24744J21845_10009649 JGI24744J21845_100096492 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

86

341

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9057 39 343
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.8983 39 346
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.8921 39 343
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.8745 39 346
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.86 40 334
ID Description Score Start End Superfamily
1sbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9878 39 311 3.40.190.10
1sbpA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9749 39 311 3.40.190.10
1sbpA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9532 132 343 3.40.190.10
1sbpA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9415 132 343 3.40.190.10
af_P16700_28_100_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9375 42 113 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q3N7M7-F1-model_v4 deleted 0.9875 109 342
AF-A0A833GVX5-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9873 53 342 GO:0042597
GO:1902358
AF-A0A5E7VYV4-F1-model_v4 Sulfate-binding protein 0.9805 36 342 GO:0042597
GO:1902358
AF-A0A7U7FUM0-F1-model_v4 deleted 0.9767 42 342
AF-W0V128-F1-model_v4 Sulfate ABC transporter, sulfate-binding family protein 0.9736 42 344 GO:0042597
GO:1902358

Feature Viewer

pLDDT pTM Quality
89.7 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map