F462106

General Info

Members Datasets Scaffolds Average Seq Length
547 292 522 192

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10111871|Ga0157371_101118712
Length 215
Sequence MHCFKYILIPSPIVGLTRKLSMKLLHIDSSALGGYSVSRQLTADIVAELKRATPSLTIRYHDLAAQPLPHWTPVADASDPAAVLGTEMLEEFLAADMVVIGAPMYNFAISSQLKAWLDRILVAGKTFRYTANGPEGLAGGKRVVIASSRGGFYGKDTPAAAMDFQEPYLRAAFAFIGINDIEFVRAEGIAIGDEQKAAALKSARSAIGTLVAKAA

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
3 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
4 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
5 2738543012 Acidovorax sp. CF301 Isolate Unclassified
6 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
7 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
8 2816332133 Acidovorax radicis 2721A Isolate Unclassified
9 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
10 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
11 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
12 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
13 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
14 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
15 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
16 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
17 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
18 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
19 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
20 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
21 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
22 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
23 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
24 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
25 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
187 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
188 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
189 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
190 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
279 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
280 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
281 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
282 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
283 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
284 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
285 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
286 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
287 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.52
Metatranscriptomes 0.91
Isolates 4.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.32
Nodule 0
Rhizoplane 1.65
Rhizosphere 76.97
Stem 0
Stem Tuber 0
Unclassified 12.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1003101 3300001915 Bacteria 4086
2 JGI25157J39369_1001539 3300002741 Bacteria 8345
3 rootH1_10071699 3300003316 Bacteria 1973
4 Ga0055524_1029533 3300003775 Unclassified 1618
5 Ga0055536_1002111 3300003781 Bacteria 11318
6 Ga0055536_1002566 3300003781 Bacteria 10134
7 Ga0055530_10003670 3300003791 Bacteria 8580
8 Ga0055531_10003812 3300003794 Bacteria 9464
9 Ga0070658_10002041 3300005327 Bacteria 16931
10 Ga0070683_100535341 3300005329 Bacteria 1120
11 Ga0070670_100214288 3300005331 Bacteria 1675
12 Ga0070666_10000034 3300005335 Bacteria 121537
13 Ga0070680_100001172 3300005336 Bacteria 18843
14 Ga0070680_100004094 3300005336 Bacteria 10920
15 Ga0070680_100103498 3300005336 Bacteria 2365
16 Ga0070660_100160501 3300005339 Bacteria 1811
17 Ga0070660_100260671 3300005339 Bacteria 1415
18 Ga0070691_10015632 3300005341 Bacteria 3487
19 Ga0070661_100088812 3300005344 Bacteria 2288
20 Ga0070661_100148105 3300005344 Bacteria 1773
21 Ga0070661_100224030 3300005344 Bacteria 1443
22 Ga0070692_10001030 3300005345 Bacteria 9605
23 Ga0070692_10645508 3300005345 Bacteria 706
24 Ga0070668_100032558 3300005347 Bacteria 3967
25 Ga0070668_100039086 3300005347 Bacteria 3629
26 Ga0070673_100869676 3300005364 Bacteria 835
27 Ga0070659_100985244 3300005366 Bacteria 739
28 Ga0070667_100055843 3300005367 Bacteria 3334
29 Ga0070667_100101616 3300005367 Bacteria 2484
30 Ga0070667_100227371 3300005367 Bacteria 1662
31 Ga0070667_100397540 3300005367 Bacteria 1254
32 Ga0070714_100001173 3300005435 Bacteria 18879
33 Ga0070714_100008847 3300005435 Bacteria 7874
34 Ga0070714_100023698 3300005435 Bacteria 5046
35 Ga0070713_100000486 3300005436 Bacteria 25305
36 Ga0070710_10072794 3300005437 Bacteria 1985
37 Ga0070708_100169641 3300005445 Bacteria 2037
38 Ga0070663_100019628 3300005455 Bacteria 4461
39 Ga0070662_100913957 3300005457 Bacteria 749
40 Ga0070681_10000998 3300005458 Bacteria 23956
41 Ga0070681_10037256 3300005458 Bacteria 4881
42 Ga0070681_10217252 3300005458 Bacteria 1827
43 Ga0070681_10520731 3300005458 Bacteria 1102
44 Ga0070681_10779395 3300005458 Bacteria 873
45 Ga0070681_11173334 3300005458 Bacteria 689
46 Ga0070706_100081774 3300005467 Bacteria 2991
47 Ga0070707_100044133 3300005468 Bacteria 4267
48 Ga0070698_100072406 3300005471 Bacteria 3454
49 Ga0070699_100046788 3300005518 Bacteria 3744
50 Ga0070679_100004197 3300005530 Bacteria 13289
51 Ga0070679_100522480 3300005530 Bacteria 1131
52 Ga0068853_100002456 3300005539 Bacteria 13868
53 Ga0068853_100013551 3300005539 Bacteria 6663
54 Ga0068853_100305906 3300005539 Bacteria 1470
55 Ga0070696_100003245 3300005546 Bacteria 10837
56 Ga0070693_100131536 3300005547 Bacteria 1565
57 Ga0070665_100012968 3300005548 Bacteria 8394
58 Ga0070665_100445714 3300005548 Bacteria 1304
59 Ga0070665_100647879 3300005548 Bacteria 1069
60 Ga0068855_100006202 3300005563 Bacteria 14572
61 Ga0068855_100012573 3300005563 Bacteria 10217
62 Ga0068855_100048330 3300005563 Bacteria 5021
63 Ga0068855_100711915 3300005563 Bacteria 1073
64 Ga0068857_100019518 3300005577 Bacteria 5954
65 Ga0068857_100159264 3300005577 Bacteria 2048
66 Ga0068854_100008367 3300005578 Bacteria 6649
67 Ga0068854_100009017 3300005578 Bacteria 6428
68 Ga0068854_100214718 3300005578 Bacteria 1519
69 Ga0068854_100414195 3300005578 Bacteria 1118
70 Ga0068856_100030478 3300005614 Bacteria 5273
71 Ga0068856_100315974 3300005614 Bacteria 1579
72 Ga0068856_100421043 3300005614 Bacteria 1355
73 Ga0068856_101318176 3300005614 Bacteria 737
74 Ga0068852_100006743 3300005616 Bacteria 8330
75 Ga0068859_100003681 3300005617 Bacteria 15616
76 Ga0068861_100272443 3300005719 Bacteria 1454
77 Ga0068851_10066882 3300005834 Bacteria 1852
78 Ga0068851_10442821 3300005834 Bacteria 771
79 Ga0068863_100390053 3300005841 Bacteria 1360
80 Ga0068858_100422276 3300005842 Bacteria 1282
81 Ga0068860_100069996 3300005843 Bacteria 3335
82 Ga0068860_100568061 3300005843 Bacteria 1137
83 Ga0068862_100000262 3300005844 Bacteria 58677
84 Ga0081455_10353634 3300005937 Bacteria 1035
85 Ga0075365_10022202 3300006038 Bacteria 3973
86 Ga0075368_10000096 3300006042 Bacteria 22180
87 Ga0075363_100015671 3300006048 Bacteria 3731
88 Ga0075364_10052451 3300006051 Bacteria 2665
89 Ga0075364_10052481 3300006051 Bacteria 2664
90 Ga0070712_100257927 3300006175 Bacteria 1396
91 Ga0075362_10000884 3300006177 Bacteria 9088
92 Ga0075367_10045443 3300006178 Bacteria 2577
93 Ga0075369_10008433 3300006186 Bacteria 3964
94 Ga0075366_10061668 3300006195 Bacteria 2229
95 Ga0097621_101373214 3300006237 Bacteria 668
96 Ga0075370_10063696 3300006353 Bacteria 2102
97 Ga0068865_100264491 3300006881 Bacteria 1363
98 Ga0097620_100003681 3300006931 Bacteria 15616
99 Ga0105251_10012126 3300009011 Bacteria 4892
100 Ga0105244_10061828 3300009036 Bacteria 1884
101 Ga0105244_10286174 3300009036 Bacteria 764
102 Ga0105240_10015552 3300009093 Bacteria 10342
103 Ga0105240_10057879 3300009093 Bacteria 4839
104 Ga0105240_10057975 3300009093 Bacteria 4835
105 Ga0105240_10240175 3300009093 Bacteria 2100
106 Ga0105240_10356953 3300009093 Bacteria 1657
107 Ga0105240_10806345 3300009093 Bacteria 1016
108 Ga0105247_10048328 3300009101 Bacteria 2613
109 Ga0105248_10158464 3300009177 Bacteria 2554
110 Ga0105248_10664014 3300009177 Bacteria 1176
111 Ga0105237_10222693 3300009545 Bacteria 1887
112 Ga0105237_10387417 3300009545 Bacteria 1402
113 Ga0105238_10001647 3300009551 Bacteria 22393
114 Ga0105238_10095521 3300009551 Bacteria 2959
115 Ga0105238_10190622 3300009551 Bacteria 2026
116 Ga0105238_10331099 3300009551 Bacteria 1510
117 Ga0105249_10017936 3300009553 Bacteria 6290
118 Ga0105239_10027103 3300010375 Bacteria 6308
119 Ga0105239_10253581 3300010375 Bacteria 1976
120 Ga0105239_10815617 3300010375 Bacteria 1069
121 Ga0105239_11012188 3300010375 Bacteria 955
122 Ga0157373_10009232 3300013100 Bacteria 7291
123 Ga0157373_10019037 3300013100 Bacteria 4997
124 Ga0157373_10365765 3300013100 Bacteria 1030
125 Ga0157373_10566527 3300013100 Bacteria 825
126 Ga0157371_10000206 3300013102 Bacteria 86320
127 Ga0157371_10027542 3300013102 Bacteria 4122
128 Ga0157371_10053822 3300013102 Bacteria 2858
129 Ga0157371_10111871 3300013102 Bacteria 1938
130 Ga0157370_10001616 3300013104 Bacteria 27853
131 Ga0157370_10037386 3300013104 Bacteria 4706
132 Ga0157370_10079356 3300013104 Bacteria 3091
133 Ga0157370_10080499 3300013104 Bacteria 3066
134 Ga0157370_10164568 3300013104 Bacteria 2063
135 Ga0157369_10004267 3300013105 Bacteria 16901
136 Ga0157369_10028244 3300013105 Bacteria 6210
137 Ga0157369_10242965 3300013105 Bacteria 1880
138 Ga0157369_10305755 3300013105 Bacteria 1654
139 Ga0157369_10454768 3300013105 Bacteria 1326
140 Ga0163162_10000106 3300013306 Bacteria 74934
141 Ga0157372_10001622 3300013307 Bacteria 24395
142 Ga0157372_10003420 3300013307 Bacteria 17127
143 Ga0157372_10042157 3300013307 Bacteria 5047
144 Ga0157372_10065011 3300013307 Bacteria 4094
145 Ga0157372_10202308 3300013307 Bacteria 2301
146 Ga0157372_11547330 3300013307 Bacteria 764
147 Ga0163163_10305813 3300014325 Bacteria 1642
148 Ga0157380_11003036 3300014326 Bacteria 868
149 Ga0182008_10001033 3300014497 Bacteria 19349
150 Ga0182008_10001083 3300014497 Bacteria 18795
151 Ga0182008_10011220 3300014497 Bacteria 4773
152 Ga0182008_10014388 3300014497 Bacteria 4144
153 Ga0157379_10884189 3300014968 Bacteria 847
154 Ga0182006_1038243 3300015261 Bacteria 1898
155 Ga0182006_1052194 3300015261 Bacteria 1571
156 Ga0182006_1079277 3300015261 Bacteria 1201
157 Ga0182007_10000061 3300015262 Bacteria 88102
158 Ga0182007_10011766 3300015262 Bacteria 3392
159 Ga0182007_10013005 3300015262 Bacteria 3188
160 Ga0182005_1000272 3300015265 Bacteria 32830
161 Ga0182005_1000611 3300015265 Bacteria 17260
162 Ga0183368_1004 3300015687 Bacteria 1211761
163 Ga0206356_11587738 3300020070 Bacteria 945
164 Ga0213872_10234715 3300021361 Bacteria 777
165 Ga0209674_100062 3300025226 Bacteria 276316
166 Ga0209674_102155 3300025226 Bacteria 4431
167 Ga0207427_100112 3300025231 Bacteria 109224
168 Ga0207427_100170 3300025231 Bacteria 72532
169 Ga0209437_100020 3300025233 Bacteria 656374
170 Ga0209437_100246 3300025233 Bacteria 87486
171 Ga0209258_101514 3300025242 Bacteria 7876
172 Ga0209026_1000213 3300025250 Bacteria 80756
173 Ga0209759_1007906 3300025256 Bacteria 3366
174 Ga0209233_1000020 3300025261 Bacteria 798224
175 Ga0209233_1000215 3300025261 Bacteria 108939
176 Ga0209676_1000114 3300025292 Bacteria 207416
177 Ga0209676_1000249 3300025292 Bacteria 115154
178 Ga0209050_1000237 3300025298 Bacteria 120119
179 Ga0209050_1011176 3300025298 Bacteria 4298
180 Ga0209256_1000596 3300025299 Bacteria 50326
181 Ga0209051_1106057 3300025303 Bacteria 744
182 Ga0209257_1000436 3300025304 Bacteria 80060
183 Ga0207655_1044094 3300025728 Bacteria 1877
184 Ga0207680_10000005 3300025903 Bacteria 660983
185 Ga0207647_10007991 3300025904 Bacteria 7606
186 Ga0207647_10051806 3300025904 Bacteria 2535
187 Ga0207645_10068225 3300025907 Bacteria 2274
188 Ga0207705_10002200 3300025909 Bacteria 15078
189 Ga0207705_10016797 3300025909 Bacteria 5240
190 Ga0207705_10188843 3300025909 Bacteria 1557
191 Ga0207705_10231585 3300025909 Bacteria 1405
192 Ga0207705_10315442 3300025909 Bacteria 1201
193 Ga0207654_10114298 3300025911 Bacteria 1684
194 Ga0207707_10000699 3300025912 Bacteria 33304
195 Ga0207707_10001210 3300025912 Bacteria 24269
196 Ga0207707_10393570 3300025912 Bacteria 1190
197 Ga0207695_10003671 3300025913 Bacteria 21402
198 Ga0207695_10032158 3300025913 Bacteria 5744
199 Ga0207695_10246913 3300025913 Bacteria 1685
200 Ga0207671_10839171 3300025914 Bacteria 728
201 Ga0207693_10430769 3300025915 Bacteria 1031
202 Ga0207660_10001647 3300025917 Bacteria 14968
203 Ga0207660_10003285 3300025917 Bacteria 10575
204 Ga0207660_10248499 3300025917 Bacteria 1403
205 Ga0207657_10004614 3300025919 Bacteria 14556
206 Ga0207657_10014645 3300025919 Bacteria 7642
207 Ga0207657_10015540 3300025919 Bacteria 7373
208 Ga0207649_10010387 3300025920 Bacteria 5115
209 Ga0207649_10026208 3300025920 Bacteria 3408
210 Ga0207649_10158746 3300025920 Bacteria 1565
211 Ga0207652_10001111 3300025921 Bacteria 24285
212 Ga0207652_10011257 3300025921 Bacteria 7207
213 Ga0207646_10125551 3300025922 Bacteria 2307
214 Ga0207694_10002059 3300025924 Bacteria 16629
215 Ga0207694_10052360 3300025924 Bacteria 3165
216 Ga0207694_10164535 3300025924 Bacteria 1793
217 Ga0207694_10400008 3300025924 Bacteria 1142
218 Ga0207700_10013135 3300025928 Bacteria 5375
219 Ga0207664_10000126 3300025929 Bacteria 66358
220 Ga0207664_10000745 3300025929 Bacteria 22147
221 Ga0207664_10186389 3300025929 Bacteria 1784
222 Ga0207690_10000266 3300025932 Bacteria 37573
223 Ga0207690_10001119 3300025932 Bacteria 17096
224 Ga0207690_10003518 3300025932 Bacteria 9331
225 Ga0207690_10153297 3300025932 Bacteria 1710
226 Ga0207706_10100867 3300025933 Bacteria 2539
227 Ga0207709_10062390 3300025935 Bacteria 2333
228 Ga0207691_10191416 3300025940 Bacteria 1784
229 Ga0207667_10003528 3300025949 Bacteria 19334
230 Ga0207667_10010145 3300025949 Bacteria 11031
231 Ga0207667_10143636 3300025949 Bacteria 2457
232 Ga0207667_10317320 3300025949 Bacteria 1591
233 Ga0207667_10464597 3300025949 Bacteria 1285
234 Ga0207668_10002728 3300025972 Bacteria 10325
235 Ga0207668_10846522 3300025972 Bacteria 812
236 Ga0207640_10015481 3300025981 Bacteria 4416
237 Ga0207640_10109949 3300025981 Bacteria 1951
238 Ga0207640_10311889 3300025981 Bacteria 1249
239 Ga0207677_10486684 3300026023 Bacteria 1064
240 Ga0207677_11098956 3300026023 Bacteria 725
241 Ga0207703_10406646 3300026035 Bacteria 1264
242 Ga0207639_10001503 3300026041 Bacteria 15684
243 Ga0207639_10004029 3300026041 Bacteria 9915
244 Ga0207639_10124490 3300026041 Bacteria 2123
245 Ga0207678_10001435 3300026067 Bacteria 21864
246 Ga0207678_10051268 3300026067 Bacteria 3563
247 Ga0207678_10087378 3300026067 Bacteria 2664
248 Ga0207702_10036075 3300026078 Bacteria 4135
249 Ga0207702_10050325 3300026078 Bacteria 3518
250 Ga0207641_10050461 3300026088 Bacteria 3520
251 Ga0207674_10030998 3300026116 Bacteria 5620
252 Ga0207674_10296220 3300026116 Bacteria 1566
253 Ga0207674_10505175 3300026116 Bacteria 1168
254 Ga0207674_11162508 3300026116 Bacteria 741
255 Ga0207675_100027116 3300026118 Bacteria 5334
256 Ga0207683_10402705 3300026121 Bacteria 1259
257 Ga0207698_10006674 3300026142 Bacteria 7212
258 Ga0209813_10000013 3300027866 Bacteria 89768
259 Ga0268266_10000004 3300028379 Bacteria 1495817
260 Ga0268266_10004625 3300028379 Bacteria 13124
261 Ga0268266_10013135 3300028379 Bacteria 7141
262 Ga0268266_10035713 3300028379 Bacteria 4228
263 Ga0268265_10000196 3300028380 Bacteria 70684
264 Ga0268264_10590221 3300028381 Bacteria 1094
265 Ga0316181_1155867 3300030744 Bacteria 987
266 Ga0265327_10137139 3300031251 Bacteria 1146
267 Ga0307513_10006001 3300031456 Bacteria 15956
268 Ga0307408_100574961 3300031548 Bacteria 998
269 Ga0316575_10068807 3300031665 Bacteria 1420
270 Ga0307516_10000352 3300031730 Bacteria 59644
271 Ga0307405_11052099 3300031731 Bacteria 697
272 Ga0307413_10158963 3300031824 Bacteria 1585
273 Ga0307413_10995225 3300031824 Bacteria 718
274 Ga0307410_10005495 3300031852 Bacteria 6716
275 Ga0307407_10019514 3300031903 Bacteria 3454
276 Ga0307407_10206196 3300031903 Bacteria 1321
277 Ga0307412_10008621 3300031911 Bacteria 5829
278 Ga0307412_10037183 3300031911 Bacteria 3126
279 Ga0307412_10099241 3300031911 Bacteria 2056
280 Ga0307409_100037862 3300031995 Bacteria 3560
281 Ga0307409_100914967 3300031995 Bacteria 891
282 Ga0307416_101587208 3300032002 Bacteria 760
283 Ga0307414_10000926 3300032004 Bacteria 15017
284 Ga0307414_10056329 3300032004 Bacteria 2757
285 Ga0307414_10183761 3300032004 Bacteria 1684
286 Ga0307411_10061495 3300032005 Bacteria 2500
287 Ga0307411_10065380 3300032005 Bacteria 2439
288 Ga0307415_100499953 3300032126 Bacteria 1063
289 Ga0307510_10000049 3300033180 Bacteria 91546
290 Ga0307510_10152030 3300033180 Bacteria 1931
291 Ga0373936_0009651 3300035113 Bacteria 3637
292 Ga0373937_0136390 3300036401 Bacteria 2295
293 Ga0395899_0050371 3300037312 Bacteria 3091
294 Ga0395899_0060902 3300037312 Bacteria 2780
295 Ga0395900_0000033 3300037418 Bacteria 260271
296 Ga0395900_0173492 3300037418 Bacteria 2194
297 Ga0395900_0262392 3300037418 Bacteria 1724
298 Ga0395898_0057971 3300037466 Bacteria 3771
299 Ga0395898_0386478 3300037466 Bacteria 1334
300 Ga0395898_1182953 3300037466 Bacteria 696
301 Ga0395901_0000772 3300038443 Bacteria 35860
302 Ga0395901_0120392 3300038443 Bacteria 2758
303 Ga0395901_0656823 3300038443 Bacteria 1051
304 Ga0395901_1381382 3300038443 Bacteria 663
305 Ga0436361_0522755 3300039447 Bacteria 1762
306 Ga0436361_0599794 3300039447 Bacteria 1298
307 Ga0439436_0000042 3300041404 Bacteria 39617
308 Ga0451789_0519464 3300041443 Bacteria 867
309 Ga0451797_0177709 3300041453 Bacteria 1620
310 Ga0451841_0049428 3300041498 Bacteria 1645
311 Ga0439437_003462 3300042000 Bacteria 1700
312 Ga0439448_0179403 3300042005 Bacteria 740
313 Ga0466972_0187607 3300044658 Bacteria 969
314 Ga0466982_0000010 3300044672 Bacteria 188341
315 Ga0466965_0073487 3300044683 Bacteria 1721
316 Ga0466966_0017116 3300044684 Bacteria 4795
317 Ga0466961_0064652 3300044693 Bacteria 2325
318 Ga0466964_0011053 3300044706 Bacteria 3410
319 Ga0466971_0009268 3300044719 Bacteria 4300
320 Ga0466968_0006918 3300044735 Bacteria 4293
321 Ga0466970_0025431 3300044765 Bacteria 3099
322 Ga0466957_0020549 3300044842 Bacteria 3886
323 Ga0466960_0006480 3300044901 Bacteria 4697
324 Ga0466959_0135522 3300045049 Bacteria 1743
325 Ga0466958_0011641 3300045836 Bacteria 4960
326 Ga0495627_003834 3300046453 Bacteria 6463
327 Ga0495638_0010259 3300046460 Bacteria 6516
328 Ga0495650_0000614 3300046471 Bacteria 48415
329 Ga0495607_0000003 3300046501 Bacteria 366900
330 Ga0495606_0090882 3300046507 Bacteria 1878
331 Ga0495606_0406219 3300046507 Bacteria 708
332 Ga0495610_0002529 3300046512 Bacteria 15263
333 Ga0495610_0008323 3300046512 Bacteria 6735
334 Ga0495610_0091821 3300046512 Bacteria 1375
335 Ga0495631_0000439 3300046518 Bacteria 28481
336 Ga0495663_0026145 3300046525 Bacteria 1707
337 Ga0495609_0181009 3300046538 Bacteria 887
338 Ga0495625_0018578 3300046660 Bacteria 5421
339 Ga0495581_0352666 3300047315 Bacteria 859
340 Ga0495672_0071487 3300047320 Bacteria 1963
341 Ga0495681_0098771 3300047470 Bacteria 1279
342 Ga0496102_0352251 3300048905 Bacteria 1386
343 Ga0496104_0133178 3300048907 Bacteria 2388
344 Ga0496104_0377711 3300048907 Bacteria 1330
345 Ga0496105_0078010 3300048908 Bacteria 2735
346 Ga0496111_0200884 3300048914 Bacteria 1482
347 Ga0496113_0665156 3300048916 Bacteria 832
348 Ga0496115_0000160 3300048918 Bacteria 63326
349 Ga0496116_0000569 3300048919 Bacteria 49423
350 Ga0496116_0041178 3300048919 Bacteria 3172
351 Ga0496116_0049956 3300048919 Bacteria 2791
352 Ga0496117_0000972 3300048920 Bacteria 43903
353 Ga0496117_0002817 3300048920 Bacteria 21157
354 Ga0496117_0129991 3300048920 Bacteria 1528
355 Ga0496118_0000074 3300048921 Bacteria 196515
356 Ga0496118_0000935 3300048921 Bacteria 45590
357 Ga0496118_0089945 3300048921 Bacteria 2117
358 Ga0496118_0268242 3300048921 Bacteria 958
359 Ga0496118_0283480 3300048921 Bacteria 920
360 Ga0496119_0000209 3300048922 Bacteria 83605
361 Ga0496119_0024864 3300048922 Bacteria 4199
362 Ga0496119_0080005 3300048922 Bacteria 1885
363 Ga0496119_0084672 3300048922 Bacteria 1817
364 Ga0496120_0000271 3300048923 Bacteria 86589
365 Ga0496121_0000373 3300048924 Bacteria 92338
366 Ga0496121_0028545 3300048924 Bacteria 5190
367 Ga0496121_0075879 3300048924 Bacteria 2683
368 Ga0496121_0099144 3300048924 Bacteria 2252
369 Ga0496122_0049982 3300048925 Bacteria 3193
370 Ga0496122_0078521 3300048925 Bacteria 2311
371 Ga0496123_0003904 3300048926 Bacteria 16202
372 Ga0496123_0015204 3300048926 Bacteria 6329
373 Ga0496123_0096718 3300048926 Bacteria 1732
374 Ga0496124_0000506 3300048927 Bacteria 67023
375 Ga0496124_0000517 3300048927 Bacteria 66311
376 Ga0496124_0027669 3300048927 Bacteria 5083
377 Ga0496124_0048888 3300048927 Bacteria 3610
378 Ga0496124_0099502 3300048927 Bacteria 2358
379 Ga0496124_0105960 3300048927 Bacteria 2270
380 Ga0496124_0218465 3300048927 Bacteria 1435
381 Ga0496125_0000249 3300048928 Bacteria 110627
382 Ga0496125_0006234 3300048928 Bacteria 12970
383 Ga0496125_0053515 3300048928 Bacteria 3307
384 Ga0496125_0065762 3300048928 Bacteria 2869
385 Ga0496125_0120575 3300048928 Bacteria 1872
386 Ga0496125_0309841 3300048928 Bacteria 962
387 Ga0496126_0007142 3300048929 Bacteria 12295
388 Ga0496126_0042860 3300048929 Bacteria 4178
389 Ga0496126_0251283 3300048929 Bacteria 1473
390 Ga0501306_056530 3300049127 Bacteria 639
391 Ga0501307_057087 3300049162 Bacteria 598
392 Ga0501315_039323 3300049531 Bacteria 710
393 Ga0501318_084741 3300049534 Bacteria 518
394 Ga0501031_0015502 3300049568 Bacteria 4947
395 Ga0501031_0035462 3300049568 Bacteria 3253
396 Ga0501031_0240289 3300049568 Bacteria 1177
397 Ga0501031_0367375 3300049568 Bacteria 931
398 Ga0501032_0010068 3300049569 Bacteria 6824
399 Ga0501032_0027933 3300049569 Bacteria 3877
400 Ga0501032_0035261 3300049569 Bacteria 3421
401 Ga0501032_0169575 3300049569 Bacteria 1431
402 Ga0501032_0562627 3300049569 Bacteria 726
403 Ga0501033_0009333 3300049570 Bacteria 7553
404 Ga0501033_0020764 3300049570 Bacteria 4962
405 Ga0501033_0027602 3300049570 Bacteria 4268
406 Ga0501033_0097815 3300049570 Bacteria 2143
407 Ga0501033_0103969 3300049570 Bacteria 2070
408 Ga0501033_0113757 3300049570 Bacteria 1968
409 Ga0501034_0005146 3300049571 Bacteria 14350
410 Ga0501034_0074811 3300049571 Bacteria 3394
411 Ga0501034_0140281 3300049571 Bacteria 2397
412 Ga0501034_0195520 3300049571 Bacteria 1982
413 Ga0501034_0907866 3300049571 Bacteria 768
414 Ga0501036_0092679 3300049572 Bacteria 2552
415 Ga0501037_0001943 3300049573 Bacteria 14963
416 Ga0501037_0022796 3300049573 Bacteria 4629
417 Ga0501037_0036528 3300049573 Bacteria 3621
418 Ga0501037_0131254 3300049573 Bacteria 1796
419 Ga0501037_0184228 3300049573 Bacteria 1480
420 Ga0501038_0000772 3300049574 Bacteria 28412
421 Ga0501038_0154446 3300049574 Bacteria 1869
422 Ga0501039_0086251 3300049575 Bacteria 2445
423 Ga0501039_0129218 3300049575 Bacteria 1982
424 Ga0501040_0061272 3300049576 Bacteria 2587
425 Ga0501040_0244569 3300049576 Bacteria 1279
426 Ga0501042_0120334 3300049578 Bacteria 1890
427 Ga0501042_0224920 3300049578 Bacteria 1353
428 Ga0501043_0002484 3300049579 Bacteria 15597
429 Ga0501043_0232615 3300049579 Bacteria 1423
430 Ga0501043_0341189 3300049579 Bacteria 1139
431 Ga0501043_0388589 3300049579 Bacteria 1055
432 Ga0501046_0005495 3300049580 Bacteria 11320
433 Ga0501046_0039475 3300049580 Bacteria 3779
434 Ga0501046_0189079 3300049580 Bacteria 1536
435 Ga0501047_0069672 3300049581 Bacteria 3387
436 Ga0501047_0078156 3300049581 Bacteria 3182
437 Ga0501047_0102727 3300049581 Bacteria 2738
438 Ga0501047_0154284 3300049581 Bacteria 2170
439 Ga0501047_0387659 3300049581 Bacteria 1231
440 Ga0501048_0022428 3300049582 Bacteria 4618
441 Ga0501048_0554682 3300049582 Bacteria 824
442 Ga0501067_0029964 3300049583 Bacteria 3017
443 Ga0501068_0042587 3300049584 Bacteria 2730
444 Ga0501068_0046776 3300049584 Bacteria 2608
445 Ga0501069_0004570 3300049585 Bacteria 7156
446 Ga0501069_0005548 3300049585 Bacteria 6570
447 Ga0501069_0035955 3300049585 Bacteria 2730
448 Ga0501069_0060141 3300049585 Bacteria 2121
449 Ga0501069_0112812 3300049585 Bacteria 1549
450 Ga0501069_0115839 3300049585 Bacteria 1528
451 Ga0501070_0001957 3300049586 Bacteria 18177
452 Ga0501070_0014723 3300049586 Bacteria 6581
453 Ga0501070_0072089 3300049586 Bacteria 2859
454 Ga0501070_0073500 3300049586 Bacteria 2829
455 Ga0501070_0174427 3300049586 Bacteria 1770
456 Ga0501071_0365816 3300049587 Bacteria 1099
457 Ga0501072_0067516 3300049588 Bacteria 2821
458 Ga0501072_0435934 3300049588 Bacteria 1038
459 Ga0501073_0082792 3300049589 Bacteria 2232
460 Ga0501073_0152397 3300049589 Bacteria 1602
461 Ga0501073_0270151 3300049589 Bacteria 1173
462 Ga0501074_0006109 3300049590 Bacteria 8698
463 Ga0501074_0006157 3300049590 Bacteria 8664
464 Ga0501074_0029583 3300049590 Bacteria 3967
465 Ga0501074_0029637 3300049590 Bacteria 3964
466 Ga0501074_0270065 3300049590 Bacteria 1209
467 Ga0501077_0113464 3300049593 Bacteria 1718
468 Ga0501249_000086 3300049679 Bacteria 29752
469 Ga0501079_0004237 3300049741 Bacteria 10636
470 Ga0501079_0048259 3300049741 Bacteria 3286
471 Ga0501080_0032689 3300049742 Bacteria 4853
472 Ga0501080_0037361 3300049742 Bacteria 4535
473 Ga0501080_0039713 3300049742 Bacteria 4392
474 Ga0501080_0126445 3300049742 Bacteria 2367
475 Ga0501080_0312567 3300049742 Bacteria 1424
476 Ga0501081_0288319 3300049743 Bacteria 1203
477 Ga0501083_0029799 3300049744 Bacteria 3750
478 Ga0501083_0043488 3300049744 Bacteria 3043
479 Ga0501083_0177628 3300049744 Bacteria 1391
480 Ga0501035_0001421 3300049822 Bacteria 24513
481 Ga0501035_0004595 3300049822 Bacteria 13086
482 Ga0501035_0025843 3300049822 Bacteria 5381
483 Ga0501035_0043763 3300049822 Bacteria 4034
484 Ga0501035_0065662 3300049822 Bacteria 3221
485 Ga0501035_0120123 3300049822 Bacteria 2298
486 Ga0501035_0434210 3300049822 Bacteria 1088
487 Ga0501044_0013281 3300049823 Bacteria 8916
488 Ga0501044_0028607 3300049823 Bacteria 5882
489 Ga0501044_0062567 3300049823 Bacteria 3804
490 Ga0501044_0193663 3300049823 Bacteria 1994
491 Ga0501044_0293870 3300049823 Bacteria 1555
492 Ga0501044_0303871 3300049823 Bacteria 1524
493 Ga0501044_0392909 3300049823 Bacteria 1300
494 Ga0501044_0489158 3300049823 Bacteria 1132
495 Ga0501044_0610597 3300049823 Bacteria 983
496 Ga0501045_0111075 3300049824 Bacteria 2032
497 Ga0501204_009108 3300049850 Bacteria 1142
498 nmdc:mga03683_3216_c1 3300050489 Bacteria 5224
499 nmdc:mga03n38_339088_c1 3300050490 Bacteria 816
500 nmdc:mga00v17_204780_c1 3300050491 Bacteria 1276
501 nmdc:mga00v17_835632_c1 3300050491 Bacteria 586
502 nmdc:mga0yw44_33249_c1 3300050492 Bacteria 3012
503 nmdc:mga06z11_49_c1 3300050494 Bacteria 50406
504 nmdc:mga04h51_779_c1 3300050495 Bacteria 7378
505 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
506 nmdc:mga0sz30_409_c1 3300050516 Bacteria 16403
507 Ga0500646_0039368 3300053090 Bacteria 1326
508 Ga0500646_0073300 3300053090 Bacteria 1031
509 Ga0500583_0001525 3300053092 Bacteria 6677
510 Ga0500556_0046219 3300053104 Bacteria 1557
511 Ga0500607_000442 3300053121 Bacteria 39777
512 Ga0500617_061027 3300053124 Bacteria 1669
513 Ga0500652_138962 3300053131 Bacteria 1012
514 Ga0500658_0153154 3300053134 Bacteria 1040
515 Ga0500588_0007819 3300053146 Bacteria 2477
516 Ga0500637_0437253 3300053178 Unclassified 668
517 Ga0501084_0135949 3300054114 Bacteria 2069
518 Ga0501082_0061549 3300060353 Bacteria 3231
519 Ga0501082_0099791 3300060353 Bacteria 2510
520 Ga0466962_0004187 3300061719 Bacteria 6910
521 Ga0530510_0113586 3300061734 Bacteria 1985
522 Ga0530510_0332451 3300061734 Bacteria 1140

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049534 Ga0501318_084741 Ga0501318_084741_34_504 155
2 3300021361 Ga0213872_10234715 Ga0213872_102347151 157
3 3300039447 Ga0436361_0599794 Ga0436361_0599794_483_1049 157
4 3300053178 Ga0500637_0437253 Ga0500637_0437253_34_543 167
5 3300026121 Ga0207683_10402705 Ga0207683_104027052 169
6 3300005471 Ga0070698_100072406 Ga0070698_1000724061 171
7 3300005445 Ga0070708_100169641 Ga0070708_1001696412 172
8 3300005467 Ga0070706_100081774 Ga0070706_1000817743 172
9 3300005468 Ga0070707_100044133 Ga0070707_1000441331 172
10 3300005518 Ga0070699_100046788 Ga0070699_1000467884 172
11 3300025922 Ga0207646_10125551 Ga0207646_101255511 172
12 3300005329 Ga0070683_100535341 Ga0070683_1005353412 175
13 3300009093 Ga0105240_10806345 Ga0105240_108063452 175
14 3300010375 Ga0105239_10815617 Ga0105239_108156172 175
15 3300005339 Ga0070660_100160501 Ga0070660_1001605011 178
16 3300005563 Ga0068855_100711915 Ga0068855_1007119152 178
17 3300005834 Ga0068851_10442821 Ga0068851_104428211 178
18 3300025919 Ga0207657_10014645 Ga0207657_100146459 178
19 3300025949 Ga0207667_10317320 Ga0207667_103173203 178
20 3300026067 Ga0207678_10051268 Ga0207678_100512682 178
21 3300037312 Ga0395899_0050371 Ga0395899_0050371_1092_1631 178
22 3300046507 Ga0495606_0406219 Ga0495606_0406219_20_559 178
23 3300006038 Ga0075365_10022202 Ga0075365_100222024 179
24 3300006042 Ga0075368_10000096 Ga0075368_100000967 179
25 3300006048 Ga0075363_100015671 Ga0075363_1000156713 179
26 3300006051 Ga0075364_10052451 Ga0075364_100524515 179
27 3300006177 Ga0075362_10000884 Ga0075362_1000088413 179
28 3300006178 Ga0075367_10045443 Ga0075367_100454435 179
29 3300006186 Ga0075369_10008433 Ga0075369_100084335 179
30 3300006195 Ga0075366_10061668 Ga0075366_100616684 179
31 3300006353 Ga0075370_10063696 Ga0075370_100636963 179
32 3300027866 Ga0209813_10000013 Ga0209813_1000001335 179
33 3300032002 Ga0307416_101587208 Ga0307416_1015872081 179
34 3300050489 nmdc:mga03683_3216_c1 nmdc:mga03683_3216_c1_860_1402 179
35 3300050490 nmdc:mga03n38_339088_c1 nmdc:mga03n38_339088_c1_257_799 179
36 3300050491 nmdc:mga00v17_835632_c1 nmdc:mga00v17_835632_c1_27_569 179
37 3300050492 nmdc:mga0yw44_33249_c1 nmdc:mga0yw44_33249_c1_1516_2058 179
38 3300050494 nmdc:mga06z11_49_c1 nmdc:mga06z11_49_c1_8935_9477 179
39 3300050495 nmdc:mga04h51_779_c1 nmdc:mga04h51_779_c1_802_1344 179
40 3300050496 nmdc:mga07m45_16_c1 nmdc:mga07m45_16_c1_123023_123565 179
41 3300050516 nmdc:mga0sz30_409_c1 nmdc:mga0sz30_409_c1_1452_1994 179
42 3300009093 Ga0105240_10356953 Ga0105240_103569532 180
43 3300025913 Ga0207695_10246913 Ga0207695_102469132 180
44 3300005331 Ga0070670_100214288 Ga0070670_1002142881 182
45 3300005458 Ga0070681_11173334 Ga0070681_111733341 182
46 3300005548 Ga0070665_100012968 Ga0070665_1000129687 182
47 3300005563 Ga0068855_100006202 Ga0068855_10000620212 182
48 3300005614 Ga0068856_100030478 Ga0068856_1000304784 182
49 3300009093 Ga0105240_10015552 Ga0105240_100155523 182
50 3300009551 Ga0105238_10095521 Ga0105238_100955214 182
51 3300025913 Ga0207695_10032158 Ga0207695_100321584 182
52 3300025924 Ga0207694_10052360 Ga0207694_100523602 182
53 3300025949 Ga0207667_10010145 Ga0207667_100101454 182
54 3300025981 Ga0207640_10311889 Ga0207640_103118891 182
55 3300026078 Ga0207702_10050325 Ga0207702_100503254 182
56 3300028379 Ga0268266_10004625 Ga0268266_1000462511 182
57 3300031548 Ga0307408_100574961 Ga0307408_1005749611 182
58 3300031731 Ga0307405_11052099 Ga0307405_110520992 182
59 3300031824 Ga0307413_10158963 Ga0307413_101589631 182
60 3300031852 Ga0307410_10005495 Ga0307410_100054955 182
61 3300031903 Ga0307407_10019514 Ga0307407_100195141 182
62 3300031903 Ga0307407_10206196 Ga0307407_102061963 182
63 3300031911 Ga0307412_10037183 Ga0307412_100371834 182
64 3300031995 Ga0307409_100037862 Ga0307409_1000378621 182
65 3300031995 Ga0307409_100914967 Ga0307409_1009149672 182
66 3300032004 Ga0307414_10056329 Ga0307414_100563293 182
67 3300032004 Ga0307414_10183761 Ga0307414_101837612 182
68 3300032005 Ga0307411_10061495 Ga0307411_100614953 182
69 3300032005 Ga0307411_10065380 Ga0307411_100653802 182
70 3300032126 Ga0307415_100499953 Ga0307415_1004999531 182
71 3300037418 Ga0395900_0173492 Ga0395900_0173492_810_1361 182
72 3300045836 Ga0466958_0011641 Ga0466958_0011641_196_747 182
73 3300048905 Ga0496102_0352251 Ga0496102_0352251_79_687 182
74 3300048907 Ga0496104_0377711 Ga0496104_0377711_588_1139 182
75 3300048914 Ga0496111_0200884 Ga0496111_0200884_567_1118 182
76 3300049127 Ga0501306_056530 Ga0501306_056530_22_573 182
77 3300049162 Ga0501307_057087 Ga0501307_057087_20_571 182
78 3300049531 Ga0501315_039323 Ga0501315_039323_20_571 182
79 3300053121 Ga0500607_000442 Ga0500607_000442_33368_33919 182
80 3300031251 Ga0265327_10137139 Ga0265327_101371392 183
81 3300039447 Ga0436361_0522755 Ga0436361_0522755_74_637 183
82 3300047315 Ga0495581_0352666 Ga0495581_0352666_36_611 183
83 3300031730 Ga0307516_10000352 Ga0307516_1000035231 184
84 3300049585 Ga0501069_0004570 Ga0501069_0004570_5824_6420 184
85 iso_pu_bacteria 2576861471 2578457934 184
86 iso_pu_bacteria 2852649853 2852650361 184
87 iso_pu_bacteria 2857442823 2857443868 184
88 iso_pu_bacteria 2939622612 2939625735 184
89 iso_pu_bacteria 2941475908 2941476331 184
90 3300005344 Ga0070661_100088812 Ga0070661_1000888122 185
91 3300005458 Ga0070681_10779395 Ga0070681_107793951 185
92 3300005539 Ga0068853_100002456 Ga0068853_1000024565 185
93 iso_pu_bacteria 8057101203 8057105819 185
94 3300009177 Ga0105248_10158464 Ga0105248_101584641 186
95 3300049679 Ga0501249_000086 Ga0501249_000086_14956_15519 186
96 3300049850 Ga0501204_009108 Ga0501204_009108_515_1078 186
97 iso_pu_bacteria 2547132130 2547501051 186
98 iso_pu_bacteria 2547132130 2547502487 186
99 iso_pu_bacteria 2747842428 2747951082 186
100 iso_pu_bacteria 2765235840 2765579561 186
101 iso_pu_bacteria 2874220319 2874222255 186
102 iso_pu_bacteria 2919089067 2919091032 186
103 iso_pu_bacteria 2919134579 2919135483 186
104 iso_pu_bacteria 2928496128 2928497582 186
105 iso_pu_bacteria 2931380184 2931380193 186
106 iso_pu_bacteria 2937610967 2937613224 186
107 iso_pu_bacteria 2939626828 2939629021 186
108 iso_pu_bacteria 2961047084 2961049020 186
109 3300009011 Ga0105251_10012126 Ga0105251_100121261 187
110 3300014326 Ga0157380_11003036 Ga0157380_110030362 187
111 3300049823 Ga0501044_0610597 Ga0501044_0610597_274_867 187
112 3300005347 Ga0070668_100039086 Ga0070668_1000390864 188
113 3300006051 Ga0075364_10052481 Ga0075364_100524813 188
114 3300009036 Ga0105244_10061828 Ga0105244_100618282 188
115 3300013102 Ga0157371_10000206 Ga0157371_1000020656 188
116 3300013104 Ga0157370_10164568 Ga0157370_101645683 188
117 3300014497 Ga0182008_10001083 Ga0182008_100010833 188
118 3300015261 Ga0182006_1079277 Ga0182006_10792772 188
119 3300015262 Ga0182007_10000061 Ga0182007_1000006173 188
120 3300015265 Ga0182005_1000272 Ga0182005_100027215 188
121 3300025728 Ga0207655_1044094 Ga0207655_10440942 188
122 3300025972 Ga0207668_10846522 Ga0207668_108465222 188
123 3300031456 Ga0307513_10006001 Ga0307513_100060015 188
124 3300031911 Ga0307412_10099241 Ga0307412_100992413 188
125 3300041443 Ga0451789_0519464 Ga0451789_0519464_243_824 188
126 3300041453 Ga0451797_0177709 Ga0451797_0177709_64_645 188
127 3300041498 Ga0451841_0049428 Ga0451841_0049428_668_1249 188
128 3300046453 Ga0495627_003834 Ga0495627_003834_658_1239 188
129 3300046460 Ga0495638_0010259 Ga0495638_0010259_5384_5965 188
130 3300046512 Ga0495610_0091821 Ga0495610_0091821_655_1236 188
131 3300046525 Ga0495663_0026145 Ga0495663_0026145_769_1350 188
132 3300046538 Ga0495609_0181009 Ga0495609_0181009_25_606 188
133 3300047320 Ga0495672_0071487 Ga0495672_0071487_874_1455 188
134 3300047470 Ga0495681_0098771 Ga0495681_0098771_393_974 188
135 3300048907 Ga0496104_0133178 Ga0496104_0133178_1741_2322 188
136 3300048908 Ga0496105_0078010 Ga0496105_0078010_1660_2241 188
137 3300048916 Ga0496113_0665156 Ga0496113_0665156_143_724 188
138 3300048919 Ga0496116_0041178 Ga0496116_0041178_473_1054 188
139 3300048919 Ga0496116_0049956 Ga0496116_0049956_1989_2570 188
140 3300048920 Ga0496117_0000972 Ga0496117_0000972_28430_29011 188
141 3300048920 Ga0496117_0002817 Ga0496117_0002817_130_711 188
142 3300048921 Ga0496118_0000074 Ga0496118_0000074_56386_56967 188
143 3300048921 Ga0496118_0000935 Ga0496118_0000935_16580_17161 188
144 3300048921 Ga0496118_0089945 Ga0496118_0089945_245_826 188
145 3300048921 Ga0496118_0268242 Ga0496118_0268242_178_759 188
146 3300048921 Ga0496118_0283480 Ga0496118_0283480_128_709 188
147 3300048922 Ga0496119_0000209 Ga0496119_0000209_54274_54855 188
148 3300048923 Ga0496120_0000271 Ga0496120_0000271_57241_57822 188
149 3300048924 Ga0496121_0000373 Ga0496121_0000373_1145_1726 188
150 3300048924 Ga0496121_0075879 Ga0496121_0075879_274_855 188
151 3300048924 Ga0496121_0099144 Ga0496121_0099144_148_729 188
152 3300048925 Ga0496122_0049982 Ga0496122_0049982_537_1118 188
153 3300048925 Ga0496122_0078521 Ga0496122_0078521_524_1105 188
154 3300048926 Ga0496123_0003904 Ga0496123_0003904_1395_1976 188
155 3300048926 Ga0496123_0015204 Ga0496123_0015204_5238_5819 188
156 3300048926 Ga0496123_0096718 Ga0496123_0096718_297_878 188
157 3300048927 Ga0496124_0000506 Ga0496124_0000506_65897_66478 188
158 3300048927 Ga0496124_0027669 Ga0496124_0027669_3414_3995 188
159 3300048927 Ga0496124_0048888 Ga0496124_0048888_507_1088 188
160 3300048927 Ga0496124_0099502 Ga0496124_0099502_1364_1945 188
161 3300048927 Ga0496124_0105960 Ga0496124_0105960_1360_2013 188
162 3300048928 Ga0496125_0000249 Ga0496125_0000249_107635_108216 188
163 3300048928 Ga0496125_0006234 Ga0496125_0006234_108_689 188
164 3300048928 Ga0496125_0053515 Ga0496125_0053515_1553_2134 188
165 3300048928 Ga0496125_0065762 Ga0496125_0065762_2181_2762 188
166 3300048928 Ga0496125_0120575 Ga0496125_0120575_102_755 188
167 3300048929 Ga0496126_0007142 Ga0496126_0007142_198_779 188
168 3300048929 Ga0496126_0251283 Ga0496126_0251283_266_847 188
169 3300050491 nmdc:mga00v17_204780_c1 nmdc:mga00v17_204780_c1_322_927 188
170 3300053090 Ga0500646_0073300 Ga0500646_0073300_243_821 188
171 3300014968 Ga0157379_10884189 Ga0157379_108841892 189
172 iso_pu_bacteria 2643221577 2643894966 189
173 iso_pu_bacteria 2643221685 2644477124 189
174 iso_pu_bacteria 2842918807 2842919052 189
175 iso_pu_bacteria 2895395659 2895399065 189
176 iso_pu_bacteria 2939611941 2939612217 189
177 3300003775 Ga0055524_1029533 Ga0055524_10295332 190
178 3300003781 Ga0055536_1002111 Ga0055536_100211112 190
179 3300003781 Ga0055536_1002566 Ga0055536_10025669 190
180 3300003791 Ga0055530_10003670 Ga0055530_100036702 190
181 3300003794 Ga0055531_10003812 Ga0055531_100038122 190
182 3300005347 Ga0070668_100032558 Ga0070668_1000325582 190
183 3300005367 Ga0070667_100055843 Ga0070667_1000558434 190
184 3300005548 Ga0070665_100445714 Ga0070665_1004457142 190
185 3300005548 Ga0070665_100647879 Ga0070665_1006478792 190
186 3300005578 Ga0068854_100214718 Ga0068854_1002147182 190
187 3300005617 Ga0068859_100003681 Ga0068859_10000368113 190
188 3300005834 Ga0068851_10066882 Ga0068851_100668821 190
189 3300005841 Ga0068863_100390053 Ga0068863_1003900532 190
190 3300005843 Ga0068860_100069996 Ga0068860_1000699963 190
191 3300005844 Ga0068862_100000262 Ga0068862_10000026225 190
192 3300006931 Ga0097620_100003681 Ga0097620_10000368113 190
193 3300009036 Ga0105244_10286174 Ga0105244_102861741 190
194 3300009101 Ga0105247_10048328 Ga0105247_100483283 190
195 3300009545 Ga0105237_10222693 Ga0105237_102226932 190
196 3300010375 Ga0105239_10253581 Ga0105239_102535812 190
197 3300013105 Ga0157369_10028244 Ga0157369_100282442 190
198 3300014325 Ga0163163_10305813 Ga0163163_103058132 190
199 3300015261 Ga0182006_1052194 Ga0182006_10521942 190
200 3300025292 Ga0209676_1000114 Ga0209676_100011489 190
201 3300025292 Ga0209676_1000249 Ga0209676_100024962 190
202 3300025298 Ga0209050_1000237 Ga0209050_100023751 190
203 3300025298 Ga0209050_1011176 Ga0209050_10111763 190
204 3300025299 Ga0209256_1000596 Ga0209256_100059643 190
205 3300025304 Ga0209257_1000436 Ga0209257_100043659 190
206 3300025935 Ga0207709_10062390 Ga0207709_100623902 190
207 3300025972 Ga0207668_10002728 Ga0207668_100027288 190
208 3300026088 Ga0207641_10050461 Ga0207641_100504613 190
209 3300028379 Ga0268266_10035713 Ga0268266_100357135 190
210 3300028380 Ga0268265_10000196 Ga0268265_1000019632 190
211 3300030744 Ga0316181_1155867 Ga0316181_11558671 190
212 3300032004 Ga0307414_10000926 Ga0307414_1000092616 190
213 3300036401 Ga0373937_0136390 Ga0373937_0136390_640_1218 190
214 3300046512 Ga0495610_0002529 Ga0495610_0002529_20_607 190
215 3300046518 Ga0495631_0000439 Ga0495631_0000439_6548_7135 190
216 3300048919 Ga0496116_0000569 Ga0496116_0000569_47834_48421 190
217 3300048920 Ga0496117_0129991 Ga0496117_0129991_872_1459 190
218 3300048922 Ga0496119_0080005 Ga0496119_0080005_822_1409 190
219 3300048922 Ga0496119_0084672 Ga0496119_0084672_702_1286 190
220 3300048924 Ga0496121_0028545 Ga0496121_0028545_53_640 190
221 3300048927 Ga0496124_0000517 Ga0496124_0000517_17039_17626 190
222 3300048927 Ga0496124_0218465 Ga0496124_0218465_359_946 190
223 3300048928 Ga0496125_0309841 Ga0496125_0309841_338_925 190
224 3300005719 Ga0068861_100272443 Ga0068861_1002724432 191
225 3300005843 Ga0068860_100568061 Ga0068860_1005680612 191
226 3300005937 Ga0081455_10353634 Ga0081455_103536341 191
227 3300009093 Ga0105240_10240175 Ga0105240_102401752 191
228 3300009551 Ga0105238_10190622 Ga0105238_101906222 191
229 3300009553 Ga0105249_10017936 Ga0105249_100179363 191
230 3300026118 Ga0207675_100027116 Ga0207675_1000271163 191
231 3300028379 Ga0268266_10013135 Ga0268266_100131352 191
232 3300028381 Ga0268264_10590221 Ga0268264_105902211 191
233 3300035113 Ga0373936_0009651 Ga0373936_0009651_1410_1991 191
234 3300044658 Ga0466972_0187607 Ga0466972_0187607_290_883 191
235 3300049742 Ga0501080_0312567 Ga0501080_0312567_549_1130 191
236 3300049744 Ga0501083_0177628 Ga0501083_0177628_624_1205 191
237 3300053092 Ga0500583_0001525 Ga0500583_0001525_2901_3482 191
238 3300053104 Ga0500556_0046219 Ga0500556_0046219_300_881 191
239 3300053124 Ga0500617_061027 Ga0500617_061027_894_1475 191
240 3300053131 Ga0500652_138962 Ga0500652_138962_168_749 191
241 3300053134 Ga0500658_0153154 Ga0500658_0153154_227_808 191
242 3300053146 Ga0500588_0007819 Ga0500588_0007819_391_972 191
243 3300005563 Ga0068855_100048330 Ga0068855_1000483302 192
244 3300025231 Ga0207427_100112 Ga0207427_10011288 192
245 3300025231 Ga0207427_100170 Ga0207427_10017056 192
246 3300025233 Ga0209437_100020 Ga0209437_10002070 192
247 3300025233 Ga0209437_100246 Ga0209437_10024670 192
248 3300025261 Ga0209233_1000020 Ga0209233_1000020555 192
249 3300025261 Ga0209233_1000215 Ga0209233_100021590 192
250 3300026116 Ga0207674_11162508 Ga0207674_111625081 192
251 3300031665 Ga0316575_10068807 Ga0316575_100688071 192
252 3300037418 Ga0395900_0000033 Ga0395900_0000033_149571_150149 192
253 3300037466 Ga0395898_0386478 Ga0395898_0386478_187_765 192
254 iso_pu_bacteria 2738543012 2739242869 192
255 iso_pu_bacteria 2816332133 2816475771 192
256 3300001915 JGI24741J21665_1003101 JGI24741J21665_10031012 193
257 3300002741 JGI25157J39369_1001539 JGI25157J39369_10015394 193
258 3300003316 rootH1_10071699 rootH1_100716993 193
259 3300005327 Ga0070658_10002041 Ga0070658_1000204110 193
260 3300005335 Ga0070666_10000034 Ga0070666_1000003489 193
261 3300005336 Ga0070680_100001172 Ga0070680_1000011726 193
262 3300005336 Ga0070680_100004094 Ga0070680_1000040942 193
263 3300005336 Ga0070680_100103498 Ga0070680_1001034982 193
264 3300005339 Ga0070660_100260671 Ga0070660_1002606712 193
265 3300005341 Ga0070691_10015632 Ga0070691_100156322 193
266 3300005344 Ga0070661_100148105 Ga0070661_1001481052 193
267 3300005344 Ga0070661_100224030 Ga0070661_1002240302 193
268 3300005345 Ga0070692_10001030 Ga0070692_100010305 193
269 3300005345 Ga0070692_10645508 Ga0070692_106455081 193
270 3300005364 Ga0070673_100869676 Ga0070673_1008696761 193
271 3300005366 Ga0070659_100985244 Ga0070659_1009852441 193
272 3300005367 Ga0070667_100101616 Ga0070667_1001016163 193
273 3300005367 Ga0070667_100227371 Ga0070667_1002273712 193
274 3300005367 Ga0070667_100397540 Ga0070667_1003975402 193
275 3300005435 Ga0070714_100001173 Ga0070714_1000011735 193
276 3300005435 Ga0070714_100008847 Ga0070714_1000088474 193
277 3300005435 Ga0070714_100023698 Ga0070714_1000236982 193
278 3300005436 Ga0070713_100000486 Ga0070713_10000048620 193
279 3300005437 Ga0070710_10072794 Ga0070710_100727941 193
280 3300005455 Ga0070663_100019628 Ga0070663_1000196285 193
281 3300005457 Ga0070662_100913957 Ga0070662_1009139571 193
282 3300005458 Ga0070681_10000998 Ga0070681_1000099817 193
283 3300005458 Ga0070681_10037256 Ga0070681_100372563 193
284 3300005458 Ga0070681_10217252 Ga0070681_102172521 193
285 3300005458 Ga0070681_10520731 Ga0070681_105207312 193
286 3300005530 Ga0070679_100004197 Ga0070679_10000419710 193
287 3300005530 Ga0070679_100522480 Ga0070679_1005224801 193
288 3300005539 Ga0068853_100013551 Ga0068853_1000135513 193
289 3300005539 Ga0068853_100305906 Ga0068853_1003059062 193
290 3300005546 Ga0070696_100003245 Ga0070696_10000324510 193
291 3300005547 Ga0070693_100131536 Ga0070693_1001315362 193
292 3300005563 Ga0068855_100012573 Ga0068855_1000125732 193
293 3300005577 Ga0068857_100019518 Ga0068857_1000195183 193
294 3300005577 Ga0068857_100159264 Ga0068857_1001592642 193
295 3300005578 Ga0068854_100008367 Ga0068854_1000083673 193
296 3300005578 Ga0068854_100009017 Ga0068854_1000090177 193
297 3300005578 Ga0068854_100414195 Ga0068854_1004141952 193
298 3300005614 Ga0068856_100315974 Ga0068856_1003159742 193
299 3300005614 Ga0068856_100421043 Ga0068856_1004210432 193
300 3300005614 Ga0068856_101318176 Ga0068856_1013181761 193
301 3300005616 Ga0068852_100006743 Ga0068852_1000067436 193
302 3300005842 Ga0068858_100422276 Ga0068858_1004222762 193
303 3300006175 Ga0070712_100257927 Ga0070712_1002579272 193
304 3300006237 Ga0097621_101373214 Ga0097621_1013732141 193
305 3300006881 Ga0068865_100264491 Ga0068865_1002644912 193
306 3300009093 Ga0105240_10057879 Ga0105240_100578792 193
307 3300009093 Ga0105240_10057975 Ga0105240_100579754 193
308 3300009177 Ga0105248_10664014 Ga0105248_106640142 193
309 3300009545 Ga0105237_10387417 Ga0105237_103874172 193
310 3300009551 Ga0105238_10001647 Ga0105238_1000164710 193
311 3300009551 Ga0105238_10331099 Ga0105238_103310992 193
312 3300010375 Ga0105239_10027103 Ga0105239_100271032 193
313 3300010375 Ga0105239_11012188 Ga0105239_110121881 193
314 3300013100 Ga0157373_10009232 Ga0157373_100092323 193
315 3300013100 Ga0157373_10019037 Ga0157373_100190374 193
316 3300013100 Ga0157373_10365765 Ga0157373_103657652 193
317 3300013100 Ga0157373_10566527 Ga0157373_105665271 193
318 3300013102 Ga0157371_10027542 Ga0157371_100275422 193
319 3300013102 Ga0157371_10053822 Ga0157371_100538223 193
320 3300013102 Ga0157371_10111871 Ga0157371_101118712 193
321 3300013104 Ga0157370_10001616 Ga0157370_1000161621 193
322 3300013104 Ga0157370_10037386 Ga0157370_100373863 193
323 3300013104 Ga0157370_10079356 Ga0157370_100793562 193
324 3300013104 Ga0157370_10080499 Ga0157370_100804992 193
325 3300013105 Ga0157369_10004267 Ga0157369_1000426713 193
326 3300013105 Ga0157369_10242965 Ga0157369_102429652 193
327 3300013105 Ga0157369_10305755 Ga0157369_103057551 193
328 3300013105 Ga0157369_10454768 Ga0157369_104547682 193
329 3300013306 Ga0163162_10000106 Ga0163162_1000010666 193
330 3300013307 Ga0157372_10001622 Ga0157372_1000162221 193
331 3300013307 Ga0157372_10003420 Ga0157372_100034203 193
332 3300013307 Ga0157372_10042157 Ga0157372_100421574 193
333 3300013307 Ga0157372_10065011 Ga0157372_100650112 193
334 3300013307 Ga0157372_10202308 Ga0157372_102023082 193
335 3300013307 Ga0157372_11547330 Ga0157372_115473302 193
336 3300014497 Ga0182008_10001033 Ga0182008_100010339 193
337 3300014497 Ga0182008_10011220 Ga0182008_100112206 193
338 3300014497 Ga0182008_10014388 Ga0182008_100143882 193
339 3300015261 Ga0182006_1038243 Ga0182006_10382432 193
340 3300015262 Ga0182007_10011766 Ga0182007_100117662 193
341 3300015262 Ga0182007_10013005 Ga0182007_100130053 193
342 3300015265 Ga0182005_1000611 Ga0182005_100061110 193
343 3300015687 Ga0183368_1004 Ga0183368_1004985 193
344 3300020070 Ga0206356_11587738 Ga0206356_115877382 193
345 3300025226 Ga0209674_100062 Ga0209674_100062148 193
346 3300025226 Ga0209674_102155 Ga0209674_1021554 193
347 3300025242 Ga0209258_101514 Ga0209258_1015145 193
348 3300025250 Ga0209026_1000213 Ga0209026_100021343 193
349 3300025256 Ga0209759_1007906 Ga0209759_10079061 193
350 3300025303 Ga0209051_1106057 Ga0209051_11060571 193
351 3300025903 Ga0207680_10000005 Ga0207680_10000005269 193
352 3300025904 Ga0207647_10007991 Ga0207647_100079916 193
353 3300025904 Ga0207647_10051806 Ga0207647_100518061 193
354 3300025907 Ga0207645_10068225 Ga0207645_100682253 193
355 3300025909 Ga0207705_10002200 Ga0207705_100022003 193
356 3300025909 Ga0207705_10016797 Ga0207705_100167975 193
357 3300025909 Ga0207705_10188843 Ga0207705_101888432 193
358 3300025909 Ga0207705_10231585 Ga0207705_102315852 193
359 3300025909 Ga0207705_10315442 Ga0207705_103154421 193
360 3300025911 Ga0207654_10114298 Ga0207654_101142982 193
361 3300025912 Ga0207707_10000699 Ga0207707_100006995 193
362 3300025912 Ga0207707_10001210 Ga0207707_1000121016 193
363 3300025912 Ga0207707_10393570 Ga0207707_103935702 193
364 3300025913 Ga0207695_10003671 Ga0207695_1000367113 193
365 3300025914 Ga0207671_10839171 Ga0207671_108391711 193
366 3300025915 Ga0207693_10430769 Ga0207693_104307692 193
367 3300025917 Ga0207660_10001647 Ga0207660_100016479 193
368 3300025917 Ga0207660_10003285 Ga0207660_100032853 193
369 3300025917 Ga0207660_10248499 Ga0207660_102484992 193
370 3300025919 Ga0207657_10004614 Ga0207657_1000461412 193
371 3300025919 Ga0207657_10015540 Ga0207657_100155405 193
372 3300025920 Ga0207649_10010387 Ga0207649_100103873 193
373 3300025920 Ga0207649_10026208 Ga0207649_100262083 193
374 3300025920 Ga0207649_10158746 Ga0207649_101587461 193
375 3300025921 Ga0207652_10001111 Ga0207652_100011119 193
376 3300025921 Ga0207652_10011257 Ga0207652_100112575 193
377 3300025924 Ga0207694_10002059 Ga0207694_100020595 193
378 3300025924 Ga0207694_10164535 Ga0207694_101645352 193
379 3300025924 Ga0207694_10400008 Ga0207694_104000081 193
380 3300025928 Ga0207700_10013135 Ga0207700_100131357 193
381 3300025929 Ga0207664_10000126 Ga0207664_1000012642 193
382 3300025929 Ga0207664_10000745 Ga0207664_1000074515 193
383 3300025929 Ga0207664_10186389 Ga0207664_101863892 193
384 3300025932 Ga0207690_10000266 Ga0207690_1000026622 193
385 3300025932 Ga0207690_10001119 Ga0207690_100011194 193
386 3300025932 Ga0207690_10003518 Ga0207690_100035188 193
387 3300025932 Ga0207690_10153297 Ga0207690_101532972 193
388 3300025933 Ga0207706_10100867 Ga0207706_101008672 193
389 3300025940 Ga0207691_10191416 Ga0207691_101914162 193
390 3300025949 Ga0207667_10003528 Ga0207667_100035287 193
391 3300025949 Ga0207667_10143636 Ga0207667_101436362 193
392 3300025949 Ga0207667_10464597 Ga0207667_104645971 193
393 3300025981 Ga0207640_10015481 Ga0207640_100154812 193
394 3300025981 Ga0207640_10109949 Ga0207640_101099491 193
395 3300026023 Ga0207677_10486684 Ga0207677_104866842 193
396 3300026023 Ga0207677_11098956 Ga0207677_110989561 193
397 3300026035 Ga0207703_10406646 Ga0207703_104066461 193
398 3300026041 Ga0207639_10001503 Ga0207639_1000150313 193
399 3300026041 Ga0207639_10004029 Ga0207639_100040292 193
400 3300026041 Ga0207639_10124490 Ga0207639_101244902 193
401 3300026067 Ga0207678_10001435 Ga0207678_100014358 193
402 3300026067 Ga0207678_10087378 Ga0207678_100873783 193
403 3300026078 Ga0207702_10036075 Ga0207702_100360753 193
404 3300026116 Ga0207674_10030998 Ga0207674_100309985 193
405 3300026116 Ga0207674_10296220 Ga0207674_102962202 193
406 3300026116 Ga0207674_10505175 Ga0207674_105051751 193
407 3300026142 Ga0207698_10006674 Ga0207698_100066745 193
408 3300028379 Ga0268266_10000004 Ga0268266_100000041256 193
409 3300031824 Ga0307413_10995225 Ga0307413_109952251 193
410 3300031911 Ga0307412_10008621 Ga0307412_100086214 193
411 3300033180 Ga0307510_10000049 Ga0307510_100000495 193
412 3300033180 Ga0307510_10152030 Ga0307510_101520302 193
413 3300037312 Ga0395899_0060902 Ga0395899_0060902_2009_2590 193
414 3300037418 Ga0395900_0262392 Ga0395900_0262392_217_798 193
415 3300037466 Ga0395898_0057971 Ga0395898_0057971_1696_2277 193
416 3300037466 Ga0395898_1182953 Ga0395898_1182953_81_662 193
417 3300038443 Ga0395901_0000772 Ga0395901_0000772_3076_3660 193
418 3300038443 Ga0395901_0120392 Ga0395901_0120392_504_1085 193
419 3300038443 Ga0395901_0656823 Ga0395901_0656823_192_776 193
420 3300038443 Ga0395901_1381382 Ga0395901_1381382_58_642 193
421 3300041404 Ga0439436_0000042 Ga0439436_0000042_5751_6335 193
422 3300042000 Ga0439437_003462 Ga0439437_003462_93_740 193
423 3300042005 Ga0439448_0179403 Ga0439448_0179403_54_638 193
424 3300044672 Ga0466982_0000010 Ga0466982_0000010_174386_174970 193
425 3300044683 Ga0466965_0073487 Ga0466965_0073487_1098_1682 193
426 3300044684 Ga0466966_0017116 Ga0466966_0017116_1335_1919 193
427 3300044693 Ga0466961_0064652 Ga0466961_0064652_728_1312 193
428 3300044706 Ga0466964_0011053 Ga0466964_0011053_208_792 193
429 3300044719 Ga0466971_0009268 Ga0466971_0009268_2336_2920 193
430 3300044735 Ga0466968_0006918 Ga0466968_0006918_2291_2875 193
431 3300044765 Ga0466970_0025431 Ga0466970_0025431_715_1299 193
432 3300044842 Ga0466957_0020549 Ga0466957_0020549_1056_1640 193
433 3300044901 Ga0466960_0006480 Ga0466960_0006480_2131_2715 193
434 3300045049 Ga0466959_0135522 Ga0466959_0135522_845_1429 193
435 3300046471 Ga0495650_0000614 Ga0495650_0000614_1735_2325 193
436 3300046501 Ga0495607_0000003 Ga0495607_0000003_62663_63247 193
437 3300046507 Ga0495606_0090882 Ga0495606_0090882_537_1172 193
438 3300046512 Ga0495610_0008323 Ga0495610_0008323_2996_3580 193
439 3300046660 Ga0495625_0018578 Ga0495625_0018578_278_868 193
440 3300048918 Ga0496115_0000160 Ga0496115_0000160_42973_43557 193
441 3300048922 Ga0496119_0024864 Ga0496119_0024864_463_1047 193
442 3300048929 Ga0496126_0042860 Ga0496126_0042860_1701_2291 193
443 3300049568 Ga0501031_0015502 Ga0501031_0015502_249_830 193
444 3300049568 Ga0501031_0035462 Ga0501031_0035462_909_1493 193
445 3300049568 Ga0501031_0240289 Ga0501031_0240289_214_798 193
446 3300049568 Ga0501031_0367375 Ga0501031_0367375_105_689 193
447 3300049569 Ga0501032_0010068 Ga0501032_0010068_4210_4791 193
448 3300049569 Ga0501032_0027933 Ga0501032_0027933_1795_2379 193
449 3300049569 Ga0501032_0035261 Ga0501032_0035261_520_1104 193
450 3300049569 Ga0501032_0169575 Ga0501032_0169575_569_1153 193
451 3300049569 Ga0501032_0562627 Ga0501032_0562627_105_689 193
452 3300049570 Ga0501033_0009333 Ga0501033_0009333_1122_1703 193
453 3300049570 Ga0501033_0020764 Ga0501033_0020764_49_642 193
454 3300049570 Ga0501033_0027602 Ga0501033_0027602_2485_3069 193
455 3300049570 Ga0501033_0097815 Ga0501033_0097815_991_1575 193
456 3300049570 Ga0501033_0103969 Ga0501033_0103969_1107_1691 193
457 3300049570 Ga0501033_0113757 Ga0501033_0113757_665_1249 193
458 3300049571 Ga0501034_0005146 Ga0501034_0005146_80_661 193
459 3300049571 Ga0501034_0074811 Ga0501034_0074811_2242_2826 193
460 3300049571 Ga0501034_0140281 Ga0501034_0140281_596_1180 193
461 3300049571 Ga0501034_0195520 Ga0501034_0195520_349_933 193
462 3300049571 Ga0501034_0907866 Ga0501034_0907866_64_648 193
463 3300049572 Ga0501036_0092679 Ga0501036_0092679_1695_2279 193
464 3300049573 Ga0501037_0001943 Ga0501037_0001943_12349_12930 193
465 3300049573 Ga0501037_0022796 Ga0501037_0022796_316_900 193
466 3300049573 Ga0501037_0036528 Ga0501037_0036528_1572_2156 193
467 3300049573 Ga0501037_0131254 Ga0501037_0131254_1047_1631 193
468 3300049573 Ga0501037_0184228 Ga0501037_0184228_328_912 193
469 3300049574 Ga0501038_0000772 Ga0501038_0000772_15780_16361 193
470 3300049574 Ga0501038_0154446 Ga0501038_0154446_717_1301 193
471 3300049575 Ga0501039_0086251 Ga0501039_0086251_250_831 193
472 3300049575 Ga0501039_0129218 Ga0501039_0129218_1050_1634 193
473 3300049576 Ga0501040_0061272 Ga0501040_0061272_786_1370 193
474 3300049576 Ga0501040_0244569 Ga0501040_0244569_414_998 193
475 3300049578 Ga0501042_0120334 Ga0501042_0120334_610_1194 193
476 3300049578 Ga0501042_0224920 Ga0501042_0224920_102_686 193
477 3300049579 Ga0501043_0002484 Ga0501043_0002484_10935_11516 193
478 3300049579 Ga0501043_0232615 Ga0501043_0232615_201_785 193
479 3300049579 Ga0501043_0341189 Ga0501043_0341189_208_792 193
480 3300049579 Ga0501043_0388589 Ga0501043_0388589_316_900 193
481 3300049580 Ga0501046_0005495 Ga0501046_0005495_8967_9551 193
482 3300049580 Ga0501046_0039475 Ga0501046_0039475_2096_2677 193
483 3300049580 Ga0501046_0189079 Ga0501046_0189079_216_800 193
484 3300049581 Ga0501047_0069672 Ga0501047_0069672_1433_2014 193
485 3300049581 Ga0501047_0078156 Ga0501047_0078156_696_1277 193
486 3300049581 Ga0501047_0102727 Ga0501047_0102727_1411_1995 193
487 3300049581 Ga0501047_0154284 Ga0501047_0154284_569_1153 193
488 3300049581 Ga0501047_0387659 Ga0501047_0387659_598_1182 193
489 3300049582 Ga0501048_0022428 Ga0501048_0022428_2377_2961 193
490 3300049582 Ga0501048_0554682 Ga0501048_0554682_152_733 193
491 3300049583 Ga0501067_0029964 Ga0501067_0029964_45_629 193
492 3300049584 Ga0501068_0042587 Ga0501068_0042587_1934_2518 193
493 3300049584 Ga0501068_0046776 Ga0501068_0046776_1007_1591 193
494 3300049585 Ga0501069_0005548 Ga0501069_0005548_435_1028 193
495 3300049585 Ga0501069_0035955 Ga0501069_0035955_998_1582 193
496 3300049585 Ga0501069_0060141 Ga0501069_0060141_64_645 193
497 3300049585 Ga0501069_0112812 Ga0501069_0112812_678_1262 193
498 3300049585 Ga0501069_0115839 Ga0501069_0115839_759_1340 193
499 3300049586 Ga0501070_0001957 Ga0501070_0001957_695_1276 193
500 3300049586 Ga0501070_0014723 Ga0501070_0014723_2412_2996 193
501 3300049586 Ga0501070_0072089 Ga0501070_0072089_54_647 193
502 3300049586 Ga0501070_0073500 Ga0501070_0073500_1257_1838 193
503 3300049586 Ga0501070_0174427 Ga0501070_0174427_618_1202 193
504 3300049587 Ga0501071_0365816 Ga0501071_0365816_180_764 193
505 3300049588 Ga0501072_0067516 Ga0501072_0067516_779_1363 193
506 3300049588 Ga0501072_0435934 Ga0501072_0435934_119_703 193
507 3300049589 Ga0501073_0082792 Ga0501073_0082792_651_1235 193
508 3300049589 Ga0501073_0152397 Ga0501073_0152397_388_969 193
509 3300049589 Ga0501073_0270151 Ga0501073_0270151_274_855 193
510 3300049590 Ga0501074_0006109 Ga0501074_0006109_1425_2006 193
511 3300049590 Ga0501074_0006157 Ga0501074_0006157_2979_3584 193
512 3300049590 Ga0501074_0029583 Ga0501074_0029583_2012_2596 193
513 3300049590 Ga0501074_0029637 Ga0501074_0029637_1841_2425 193
514 3300049590 Ga0501074_0270065 Ga0501074_0270065_220_843 193
515 3300049593 Ga0501077_0113464 Ga0501077_0113464_150_773 193
516 3300049741 Ga0501079_0004237 Ga0501079_0004237_1374_1958 193
517 3300049741 Ga0501079_0048259 Ga0501079_0048259_53_646 193
518 3300049742 Ga0501080_0032689 Ga0501080_0032689_19_600 193
519 3300049742 Ga0501080_0037361 Ga0501080_0037361_1262_1867 193
520 3300049742 Ga0501080_0039713 Ga0501080_0039713_2268_2849 193
521 3300049742 Ga0501080_0126445 Ga0501080_0126445_998_1582 193
522 3300049743 Ga0501081_0288319 Ga0501081_0288319_238_822 193
523 3300049744 Ga0501083_0029799 Ga0501083_0029799_1641_2225 193
524 3300049744 Ga0501083_0043488 Ga0501083_0043488_380_964 193
525 3300049822 Ga0501035_0001421 Ga0501035_0001421_540_1121 193
526 3300049822 Ga0501035_0004595 Ga0501035_0004595_10600_11181 193
527 3300049822 Ga0501035_0025843 Ga0501035_0025843_3153_3830 193
528 3300049822 Ga0501035_0043763 Ga0501035_0043763_1149_1730 193
529 3300049822 Ga0501035_0065662 Ga0501035_0065662_569_1153 193
530 3300049822 Ga0501035_0120123 Ga0501035_0120123_1526_2110 193
531 3300049822 Ga0501035_0434210 Ga0501035_0434210_156_740 193
532 3300049823 Ga0501044_0013281 Ga0501044_0013281_3711_4292 193
533 3300049823 Ga0501044_0028607 Ga0501044_0028607_2303_2896 193
534 3300049823 Ga0501044_0062567 Ga0501044_0062567_642_1223 193
535 3300049823 Ga0501044_0193663 Ga0501044_0193663_185_766 193
536 3300049823 Ga0501044_0293870 Ga0501044_0293870_764_1348 193
537 3300049823 Ga0501044_0303871 Ga0501044_0303871_903_1487 193
538 3300049823 Ga0501044_0392909 Ga0501044_0392909_148_732 193
539 3300049823 Ga0501044_0489158 Ga0501044_0489158_393_977 193
540 3300049824 Ga0501045_0111075 Ga0501045_0111075_782_1366 193
541 3300053090 Ga0500646_0039368 Ga0500646_0039368_309_899 193
542 3300054114 Ga0501084_0135949 Ga0501084_0135949_264_848 193
543 3300060353 Ga0501082_0061549 Ga0501082_0061549_373_957 193
544 3300060353 Ga0501082_0099791 Ga0501082_0099791_1140_1724 193
545 3300061719 Ga0466962_0004187 Ga0466962_0004187_3928_4512 193
546 3300061734 Ga0530510_0113586 Ga0530510_0113586_1178_1762 193
547 3300061734 Ga0530510_0332451 Ga0530510_0332451_52_636 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

22

211

0.93

PF03358

FMN_red

NADPH-dependent FMN reductase

22

172

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9319 1 185
4c0w-assembly1.cif.gz_A the crystal strucuture of native ppazor 0.93 1 188
2z98-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) 0.9296 1 185
2z9c-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: azor in complex with dicoumarol 0.9277 1 185
1tik-assembly1.cif.gz_A crystal structure of acyl carrier protein phosphodiesterase 0.9244 2 185
ID Description Score Start End Superfamily
af_Q2G1F2_1_208_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9308 2 185 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.93 1 188 3.40.50.360
3w77A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9167 1 184 3.40.50.360
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.909 2 185 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9066 1 188 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A7W8JJB3-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9796 1 184 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A1W6MYX6-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9766 1 185 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A4Q7CG53-F1-model_v4 deleted 0.9717 1 186
AF-A0A0H3I3T1-F1-model_v4 FMN-dependent NADH-azoreductase 0.9715 64 185
AF-F0KNL4-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9714 1 186 GO:0009055
GO:0010181
GO:0016652
GO:0016655

Feature Viewer

pLDDT pTM Quality
92.88 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map