F462077

General Info

Members Datasets Scaffolds Average Seq Length
547 227 1094 358

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100114084|Ga0070696_1001140842
Length 416
Sequence LIADFRLPIADLVFGFRSWVFAKTHCDDKSKGQKPKDQIGNWQSQIDNHINSMPSKSTGKRTARMTAVPSTKRRAAIEKRQRAVTLITGGTGFLGSHLVRQLVEEGAKDIRVMATSIPDWLVNLGVETFEGSINNSEDCKRAVDGIKEIYHLAGRVSRERDDARKMYEIHVEGTRLLCDAAKAAGAKTIVLASTSGTIAVTKEGDLIPDETYPVPLEIISRWPYYASKAYQEMAALERFSGRGLRLVIMNPSLLLGPGDERLSSTKVVLDFMARKIGAVPTGGVSFVDARDAATTFRVAMKKGRHGERYLLGAANWTFNKFFGRLERLTKVSAPRFAVPSRLAITGAQLVDSFFKQWDLTSPVEPGAIEMAQYFWYLNCSKAARELNFKPRDPGETLHDTVSYLRENFLGGNAFAK

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
202 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
203 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
210 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
211 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
212 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
213 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
214 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
215 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 2.01
Rhizosphere 96.89
Stem 0
Stem Tuber 0
Unclassified 19.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100114084 3300005546 Bacteria 1948
2 JGI24748J21848_1000006 3300002074 Bacteria 212677
3 JGI24034J26672_10000002 3300002239 Bacteria 925353
4 JGI24751J29686_10000018 3300002459 Bacteria 107255
5 JGI25406J46586_10015378 3300003203 Bacteria 3229
6 rootL2_10160894 3300003322 Bacteria 2121
7 Ga0065714_10064448 3300005288 Bacteria 81247
8 Ga0065712_10000125 3300005290 Bacteria 81248
9 Ga0065712_10001631 3300005290 Bacteria 7437
10 Ga0065712_10079197 3300005290 Unclassified 3237
11 Ga0065715_10089810 3300005293 Bacteria 8451
12 Ga0065715_10099752 3300005293 Bacteria 3351
13 Ga0065715_10100174 3300005293 Bacteria 3326
14 Ga0065707_10007597 3300005295 Unclassified 4956
15 Ga0065707_10018880 3300005295 Unclassified 1853
16 Ga0065707_10091508 3300005295 Bacteria 3931
17 Ga0065707_10149369 3300005295 Bacteria 1676
18 Ga0070676_10025721 3300005328 Unclassified 3329
19 Ga0070676_10103498 3300005328 Unclassified 1763
20 Ga0070676_10122610 3300005328 Bacteria 1633
21 Ga0070676_10228696 3300005328 Bacteria 1232
22 Ga0070683_100003017 3300005329 Bacteria 13519
23 Ga0070690_100001854 3300005330 Bacteria 11213
24 Ga0070690_100024360 3300005330 Bacteria 3721
25 Ga0070670_100000176 3300005331 Bacteria 57932
26 Ga0070670_100068081 3300005331 Bacteria 3055
27 Ga0070670_100217529 3300005331 Bacteria 1662
28 Ga0070670_100218601 3300005331 Unclassified 1657
29 Ga0070670_100308162 3300005331 Bacteria 1386
30 Ga0068869_100011841 3300005334 Bacteria 5738
31 Ga0068869_100067972 3300005334 Bacteria 2630
32 Ga0070680_100001132 3300005336 Bacteria 19143
33 Ga0070680_100005449 3300005336 Bacteria 9629
34 Ga0070682_100000081 3300005337 Bacteria 85485
35 Ga0070682_100003805 3300005337 Bacteria 8386
36 Ga0068868_100014580 3300005338 Bacteria 5796
37 Ga0070660_100167488 3300005339 Bacteria 1773
38 Ga0070689_100001436 3300005340 Bacteria 15192
39 Ga0070689_100002981 3300005340 Bacteria 11132
40 Ga0070689_100007107 3300005340 Bacteria 7796
41 Ga0070689_100024261 3300005340 Bacteria 4547
42 Ga0070689_100031881 3300005340 Bacteria 4006
43 Ga0070689_100051637 3300005340 Bacteria 3178
44 Ga0070689_100215920 3300005340 Bacteria 1571
45 Ga0070691_10038264 3300005341 Bacteria 2265
46 Ga0070687_100005008 3300005343 Bacteria 5336
47 Ga0070661_100080570 3300005344 Bacteria 2403
48 Ga0070692_10017026 3300005345 Bacteria 3467
49 Ga0070692_10201263 3300005345 Bacteria 1166
50 Ga0070668_100341112 3300005347 Bacteria 1266
51 Ga0070669_100002368 3300005353 Bacteria 13621
52 Ga0070669_100033735 3300005353 Bacteria 3704
53 Ga0070669_100045594 3300005353 Unclassified 3195
54 Ga0070669_100134126 3300005353 Bacteria 1903
55 Ga0070669_100137850 3300005353 Bacteria 1878
56 Ga0070669_100171015 3300005353 Bacteria 1694
57 Ga0070675_100061774 3300005354 Bacteria 3094
58 Ga0070675_100191337 3300005354 Unclassified 1773
59 Ga0070671_100002547 3300005355 Bacteria 14122
60 Ga0070674_100184302 3300005356 Bacteria 1601
61 Ga0070673_100013430 3300005364 Bacteria 5665
62 Ga0070673_100025184 3300005364 Bacteria 4375
63 Ga0070673_100027819 3300005364 Unclassified 4196
64 Ga0070673_100041000 3300005364 Bacteria 3555
65 Ga0070688_100013745 3300005365 Unclassified 4574
66 Ga0070688_100110096 3300005365 Bacteria 1830
67 Ga0070659_100002651 3300005366 Bacteria 12741
68 Ga0070667_100004650 3300005367 Bacteria 11522
69 Ga0070703_10002466 3300005406 Bacteria 5316
70 Ga0070703_10004152 3300005406 Bacteria 4082
71 Ga0070703_10065730 3300005406 Bacteria 1198
72 Ga0070701_10105470 3300005438 Bacteria 1567
73 Ga0070705_100027078 3300005440 Bacteria 3126
74 Ga0070705_100030224 3300005440 Unclassified 2988
75 Ga0070700_100012641 3300005441 Bacteria 4720
76 Ga0070700_100020388 3300005441 Bacteria 3840
77 Ga0070700_100031185 3300005441 Unclassified 3192
78 Ga0070694_100000316 3300005444 Bacteria 25983
79 Ga0070694_100003554 3300005444 Bacteria 9319
80 Ga0070694_100011630 3300005444 Bacteria 5449
81 Ga0070694_100017601 3300005444 Unclassified 4519
82 Ga0070694_100030619 3300005444 Bacteria 3522
83 Ga0070694_100045516 3300005444 Unclassified 2941
84 Ga0070694_100066717 3300005444 Unclassified 2469
85 Ga0070694_100237103 3300005444 Bacteria 1375
86 Ga0070694_100258009 3300005444 Unclassified 1321
87 Ga0070708_100000223 3300005445 Bacteria 42136
88 Ga0070662_100038388 3300005457 Bacteria 3402
89 Ga0070662_100214860 3300005457 Bacteria 1532
90 Ga0070662_100345469 3300005457 Bacteria 1218
91 Ga0070681_10001899 3300005458 Bacteria 18853
92 Ga0070681_10002490 3300005458 Bacteria 16869
93 Ga0070681_10051321 3300005458 Bacteria 4113
94 Ga0070681_10109831 3300005458 Bacteria 2697
95 Ga0068867_100006370 3300005459 Bacteria 8345
96 Ga0068867_100058745 3300005459 Bacteria 2850
97 Ga0070685_10052554 3300005466 Bacteria 2358
98 Ga0070706_100000032 3300005467 Bacteria 152892
99 Ga0070706_100127036 3300005467 Bacteria 2378
100 Ga0070707_100035987 3300005468 Bacteria 4724
101 Ga0070707_100265040 3300005468 Bacteria 1671
102 Ga0070698_100004185 3300005471 Bacteria 15850
103 Ga0070698_100012105 3300005471 Bacteria 9144
104 Ga0070698_100025854 3300005471 Bacteria 6117
105 Ga0070698_100138416 3300005471 Unclassified 2387
106 Ga0070699_100000714 3300005518 Bacteria 30821
107 Ga0070699_100073588 3300005518 Bacteria 2972
108 Ga0070679_100000215 3300005530 Bacteria 47050
109 Ga0070684_100001147 3300005535 Bacteria 19051
110 Ga0070697_100000074 3300005536 Bacteria 79648
111 Ga0070697_100000171 3300005536 Bacteria 52537
112 Ga0070697_100001900 3300005536 Bacteria 15974
113 Ga0070697_100016086 3300005536 Bacteria 5882
114 Ga0070697_100063706 3300005536 Unclassified 3011
115 Ga0070697_100216719 3300005536 Unclassified 1631
116 Ga0068853_100017514 3300005539 Bacteria 5913
117 Ga0068853_100129902 3300005539 Bacteria 2254
118 Ga0068853_100150806 3300005539 Unclassified 2093
119 Ga0070672_100018705 3300005543 Bacteria 5015
120 Ga0070672_100136222 3300005543 Bacteria 2022
121 Ga0070672_100240218 3300005543 Unclassified 1523
122 Ga0070686_100006819 3300005544 Bacteria 6359
123 Ga0070686_100024392 3300005544 Bacteria 3624
124 Ga0070686_100113119 3300005544 Bacteria 1852
125 Ga0070686_100291036 3300005544 Bacteria 1208
126 Ga0070695_100020906 3300005545 Bacteria 3999
127 Ga0070695_100078738 3300005545 Bacteria 2174
128 Ga0070696_100020489 3300005546 Bacteria 4480
129 Ga0070696_100082659 3300005546 Bacteria 2277
130 Ga0070696_100086066 3300005546 Bacteria 2231
131 Ga0070696_100116618 3300005546 Bacteria 1929
132 Ga0070693_100017807 3300005547 Unclassified 3701
133 Ga0070693_100030215 3300005547 Bacteria 2961
134 Ga0070693_100033705 3300005547 Bacteria 2829
135 Ga0070693_100172649 3300005547 Unclassified 1386
136 Ga0070704_100050587 3300005549 Bacteria 2922
137 Ga0070664_100001410 3300005564 Bacteria 19208
138 Ga0068857_100104779 3300005577 Bacteria 2539
139 Ga0068857_100436284 3300005577 Bacteria 1223
140 Ga0068854_100020656 3300005578 Unclassified 4461
141 Ga0068856_100053338 3300005614 Bacteria 3986
142 Ga0070702_100011111 3300005615 Unclassified 4468
143 Ga0070702_100014223 3300005615 Unclassified 4035
144 Ga0068859_100020153 3300005617 Bacteria 6696
145 Ga0068859_100024289 3300005617 Bacteria 6082
146 Ga0068859_100037785 3300005617 Bacteria 4845
147 Ga0068859_100043681 3300005617 Unclassified 4504
148 Ga0068859_100054833 3300005617 Bacteria 4010
149 Ga0068859_100066980 3300005617 Bacteria 3626
150 Ga0068859_100167153 3300005617 Unclassified 2279
151 Ga0068859_100177103 3300005617 Bacteria 2214
152 Ga0068859_100189891 3300005617 Bacteria 2139
153 Ga0068859_100193106 3300005617 Unclassified 2120
154 Ga0068859_100246236 3300005617 Unclassified 1877
155 Ga0068859_100448249 3300005617 Unclassified 1387
156 Ga0068864_100003679 3300005618 Bacteria 12658
157 Ga0068864_100023378 3300005618 Bacteria 5189
158 Ga0068864_100052151 3300005618 Bacteria 3525
159 Ga0068864_100120358 3300005618 Bacteria 2347
160 Ga0068866_10001903 3300005718 Bacteria 8722
161 Ga0068866_10015127 3300005718 Unclassified 3424
162 Ga0068861_100008890 3300005719 Bacteria 6923
163 Ga0068861_100013125 3300005719 Bacteria 5793
164 Ga0068861_100014800 3300005719 Bacteria 5482
165 Ga0068861_100019588 3300005719 Bacteria 4833
166 Ga0068861_100022522 3300005719 Bacteria 4541
167 Ga0068851_10001068 3300005834 Bacteria 11855
168 Ga0068863_100040477 3300005841 Bacteria 4431
169 Ga0068858_100000566 3300005842 Bacteria 38612
170 Ga0068858_100021821 3300005842 Bacteria 5980
171 Ga0068858_100053565 3300005842 Bacteria 3732
172 Ga0068858_100137673 3300005842 Bacteria 2292
173 Ga0068858_100191753 3300005842 Bacteria 1931
174 Ga0068860_100005822 3300005843 Bacteria 12409
175 Ga0068860_100012765 3300005843 Bacteria 8260
176 Ga0068862_100032424 3300005844 Bacteria 4415
177 Ga0068862_100042220 3300005844 Bacteria 3884
178 Ga0081455_10212699 3300005937 Unclassified 1439
179 Ga0081539_10000119 3300005985 Bacteria 184136
180 Ga0081539_10000149 3300005985 Bacteria 161420
181 Ga0081539_10001119 3300005985 Bacteria 48656
182 Ga0070715_10000007 3300006163 Bacteria 192075
183 Ga0070716_100000007 3300006173 Bacteria 256300
184 Ga0097621_100001897 3300006237 Bacteria 14278
185 Ga0097621_100008040 3300006237 Bacteria 7572
186 Ga0097621_100008893 3300006237 Bacteria 7260
187 Ga0068871_100003863 3300006358 Bacteria 10329
188 Ga0068871_100005390 3300006358 Bacteria 8963
189 Ga0075428_100014391 3300006844 Bacteria 8793
190 Ga0075433_10023505 3300006852 Bacteria 5189
191 Ga0075433_10109580 3300006852 Bacteria 2450
192 Ga0075433_10109715 3300006852 Bacteria 2448
193 Ga0075433_10145006 3300006852 Unclassified 2111
194 Ga0075433_10168243 3300006852 Bacteria 1951
195 Ga0075433_10230453 3300006852 Bacteria 1645
196 Ga0075434_100028990 3300006871 Bacteria 5443
197 Ga0075434_100093655 3300006871 Unclassified 3008
198 Ga0075434_100141967 3300006871 Bacteria 2422
199 Ga0075434_100280280 3300006871 Unclassified 1686
200 Ga0075429_100006652 3300006880 Bacteria 10018
201 Ga0068865_100004156 3300006881 Bacteria 8706
202 Ga0068865_100019672 3300006881 Bacteria 4371
203 Ga0075436_100085887 3300006914 Unclassified 2185
204 Ga0097620_100020153 3300006931 Bacteria 6696
205 Ga0097620_100024288 3300006931 Bacteria 6082
206 Ga0097620_100037784 3300006931 Bacteria 4845
207 Ga0097620_100043682 3300006931 Unclassified 4504
208 Ga0097620_100054833 3300006931 Bacteria 4010
209 Ga0097620_100066980 3300006931 Bacteria 3626
210 Ga0097620_100167148 3300006931 Unclassified 2279
211 Ga0097620_100177101 3300006931 Bacteria 2214
212 Ga0097620_100189888 3300006931 Bacteria 2139
213 Ga0097620_100193126 3300006931 Unclassified 2120
214 Ga0097620_100246254 3300006931 Unclassified 1877
215 Ga0097620_100448245 3300006931 Unclassified 1387
216 Ga0075435_100047925 3300007076 Bacteria 3431
217 Ga0105240_10024946 3300009093 Bacteria 7869
218 Ga0111539_10006063 3300009094 Bacteria 15600
219 Ga0111539_10017945 3300009094 Bacteria 8765
220 Ga0111539_10097206 3300009094 Bacteria 3459
221 Ga0111539_10101308 3300009094 Bacteria 3381
222 Ga0111539_10216560 3300009094 Bacteria 2230
223 Ga0105245_10349548 3300009098 Unclassified 1464
224 Ga0105247_10000001 3300009101 Bacteria 739726
225 Ga0105247_10018155 3300009101 Bacteria 4219
226 Ga0114129_10002382 3300009147 Bacteria 26108
227 Ga0114129_10020976 3300009147 Bacteria 9280
228 Ga0114129_10117862 3300009147 Bacteria 3657
229 Ga0114129_10122314 3300009147 Bacteria 3581
230 Ga0114129_10124873 3300009147 Unclassified 3539
231 Ga0114129_10130979 3300009147 Unclassified 3445
232 Ga0114129_10308118 3300009147 Bacteria 2109
233 Ga0114129_10345234 3300009147 Bacteria 1973
234 Ga0105243_10000024 3300009148 Bacteria 197391
235 Ga0105243_10002873 3300009148 Bacteria 14277
236 Ga0105243_10005373 3300009148 Bacteria 9996
237 Ga0105243_10033471 3300009148 Bacteria 3975
238 Ga0105243_10168953 3300009148 Bacteria 1892
239 Ga0105241_10011231 3300009174 Bacteria 6566
240 Ga0105241_10019050 3300009174 Bacteria 5061
241 Ga0105242_10000081 3300009176 Bacteria 65802
242 Ga0105242_10000502 3300009176 Bacteria 30880
243 Ga0105242_10001371 3300009176 Bacteria 19204
244 Ga0105242_10012081 3300009176 Bacteria 6644
245 Ga0105248_10020598 3300009177 Archaea 7309
246 Ga0105248_10021507 3300009177 Bacteria 7146
247 Ga0105248_10027350 3300009177 Bacteria 6349
248 Ga0105248_10068646 3300009177 Bacteria 3980
249 Ga0105248_10084919 3300009177 Unclassified 3562
250 Ga0105248_10098022 3300009177 Bacteria 3302
251 Ga0105248_10123571 3300009177 Bacteria 2919
252 Ga0105248_10433900 3300009177 Bacteria 1480
253 Ga0105237_10001297 3300009545 Bacteria 33271
254 Ga0105237_10489824 3300009545 Bacteria 1236
255 Ga0105238_10005166 3300009551 Bacteria 12904
256 Ga0105238_10021313 3300009551 Bacteria 6605
257 Ga0105249_10000139 3300009553 Bacteria 94384
258 Ga0105249_10001657 3300009553 Bacteria 19517
259 Ga0105249_10030651 3300009553 Unclassified 4863
260 Ga0105249_10040658 3300009553 Bacteria 4224
261 Ga0105249_10065749 3300009553 Unclassified 3337
262 Ga0105239_10016582 3300010375 Bacteria 8143
263 Ga0105239_10196092 3300010375 Bacteria 2261
264 Ga0105239_10350929 3300010375 Bacteria 1666
265 Ga0105246_10045814 3300011119 Bacteria 2980
266 Ga0105246_10103447 3300011119 Bacteria 2078
267 Ga0157373_10007590 3300013100 Bacteria 8059
268 Ga0157374_10049079 3300013296 Bacteria 3919
269 Ga0157374_10081196 3300013296 Bacteria 3077
270 Ga0157374_10318541 3300013296 Bacteria 1541
271 Ga0157378_10000001 3300013297 Bacteria 352632
272 Ga0157378_10000124 3300013297 Bacteria 74694
273 Ga0157378_10004222 3300013297 Bacteria 12679
274 Ga0157378_10022090 3300013297 Bacteria 5598
275 Ga0157378_10073143 3300013297 Bacteria 3081
276 Ga0157378_10124801 3300013297 Bacteria 2377
277 Ga0157378_10146621 3300013297 Bacteria 2196
278 Ga0157378_10221987 3300013297 Unclassified 1797
279 Ga0157378_10452864 3300013297 Bacteria 1274
280 Ga0163162_10000045 3300013306 Bacteria 127819
281 Ga0163162_10076750 3300013306 Unclassified 3404
282 Ga0163162_10334306 3300013306 Bacteria 1647
283 Ga0157372_10012948 3300013307 Bacteria 8894
284 Ga0157372_10154632 3300013307 Unclassified 2649
285 Ga0157375_10001076 3300013308 Bacteria 23672
286 Ga0157375_10018756 3300013308 Bacteria 6278
287 Ga0157375_10173415 3300013308 Bacteria 2305
288 Ga0157375_10346384 3300013308 Bacteria 1651
289 Ga0163163_10000359 3300014325 Bacteria 43790
290 Ga0163163_10003575 3300014325 Bacteria 13199
291 Ga0163163_10017000 3300014325 Bacteria 6774
292 Ga0163163_10073387 3300014325 Unclassified 3412
293 Ga0163163_10176245 3300014325 Unclassified 2185
294 Ga0157380_10001576 3300014326 Bacteria 14997
295 Ga0157380_10002219 3300014326 Bacteria 13066
296 Ga0157380_10048764 3300014326 Bacteria 3337
297 Ga0157380_10052552 3300014326 Unclassified 3227
298 Ga0157380_10136666 3300014326 Bacteria 2099
299 Ga0157379_10054592 3300014968 Bacteria 3570
300 Ga0157379_10079468 3300014968 Bacteria 2937
301 Ga0157376_10011222 3300014969 Bacteria 6595
302 Ga0157376_10095174 3300014969 Bacteria 2589
303 Ga0163161_10300334 3300017792 Bacteria 1264
304 Ga0213876_10000325 3300021384 Bacteria 41745
305 Ga0207672_1000333 3300025223 Bacteria 6266
306 Ga0207697_10002003 3300025315 Bacteria 10793
307 Ga0207656_10000624 3300025321 Bacteria 11604
308 Ga0207653_10000303 3300025885 Bacteria 28140
309 Ga0207653_10000707 3300025885 Bacteria 11454
310 Ga0207710_10000003 3300025900 Bacteria 1071597
311 Ga0207710_10000470 3300025900 Bacteria 25792
312 Ga0207647_10008775 3300025904 Bacteria 7217
313 Ga0207685_10000007 3300025905 Bacteria 278341
314 Ga0207645_10024559 3300025907 Bacteria 3906
315 Ga0207645_10031099 3300025907 Unclassified 3436
316 Ga0207643_10002879 3300025908 Bacteria 9286
317 Ga0207684_10000065 3300025910 Bacteria 194463
318 Ga0207684_10002404 3300025910 Bacteria 18924
319 Ga0207684_10010735 3300025910 Bacteria 8042
320 Ga0207684_10066816 3300025910 Bacteria 3054
321 Ga0207707_10000320 3300025912 Bacteria 50788
322 Ga0207707_10088953 3300025912 Unclassified 2698
323 Ga0207707_10350425 3300025912 Bacteria 1272
324 Ga0207695_10155259 3300025913 Bacteria 2224
325 Ga0207671_10006617 3300025914 Bacteria 10281
326 Ga0207660_10000187 3300025917 Bacteria 39221
327 Ga0207660_10185840 3300025917 Bacteria 1616
328 Ga0207662_10003334 3300025918 Bacteria 8244
329 Ga0207662_10043219 3300025918 Bacteria 2657
330 Ga0207662_10216351 3300025918 Bacteria 1246
331 Ga0207652_10000066 3300025921 Bacteria 110924
332 Ga0207646_10040824 3300025922 Bacteria 4172
333 Ga0207646_10260419 3300025922 Unclassified 1567
334 Ga0207681_10002679 3300025923 Bacteria 11274
335 Ga0207681_10003764 3300025923 Bacteria 9421
336 Ga0207681_10028141 3300025923 Unclassified 3639
337 Ga0207681_10163023 3300025923 Unclassified 1682
338 Ga0207650_10000080 3300025925 Bacteria 129319
339 Ga0207650_10011456 3300025925 Bacteria 6105
340 Ga0207650_10033876 3300025925 Bacteria 3702
341 Ga0207659_10040131 3300025926 Unclassified 3270
342 Ga0207644_10003142 3300025931 Bacteria 10638
343 Ga0207644_10007215 3300025931 Bacteria 7233
344 Ga0207644_10013295 3300025931 Bacteria 5484
345 Ga0207706_10037179 3300025933 Unclassified 4323
346 Ga0207706_10067050 3300025933 Bacteria 3157
347 Ga0207706_10086778 3300025933 Bacteria 2751
348 Ga0207686_10000011 3300025934 Bacteria 216046
349 Ga0207686_10000012 3300025934 Bacteria 209763
350 Ga0207686_10004897 3300025934 Bacteria 7201
351 Ga0207686_10016265 3300025934 Unclassified 4173
352 Ga0207709_10000042 3300025935 Bacteria 254145
353 Ga0207709_10002713 3300025935 Bacteria 10939
354 Ga0207670_10004230 3300025936 Bacteria 7701
355 Ga0207670_10133616 3300025936 Bacteria 1821
356 Ga0207670_10149615 3300025936 Bacteria 1731
357 Ga0207670_10338541 3300025936 Bacteria 1188
358 Ga0207669_10010974 3300025937 Unclassified 4387
359 Ga0207704_10000605 3300025938 Bacteria 15862
360 Ga0207665_10000027 3300025939 Bacteria 96926
361 Ga0207691_10000799 3300025940 Bacteria 31267
362 Ga0207691_10091050 3300025940 Bacteria 2733
363 Ga0207691_10144228 3300025940 Bacteria 2097
364 Ga0207691_10207431 3300025940 Bacteria 1703
365 Ga0207711_10022592 3300025941 Bacteria 5262
366 Ga0207711_10036498 3300025941 Bacteria 4171
367 Ga0207711_10058389 3300025941 Bacteria 3320
368 Ga0207711_10107430 3300025941 Bacteria 2478
369 Ga0207711_10162435 3300025941 Bacteria 2023
370 Ga0207689_10004166 3300025942 Bacteria 13144
371 Ga0207689_10005100 3300025942 Bacteria 11813
372 Ga0207689_10005285 3300025942 Bacteria 11572
373 Ga0207689_10042388 3300025942 Bacteria 3765
374 Ga0207689_10134912 3300025942 Unclassified 2032
375 Ga0207661_10031163 3300025944 Bacteria 4115
376 Ga0207661_10260396 3300025944 Bacteria 1545
377 Ga0207679_10171994 3300025945 Bacteria 1784
378 Ga0207651_10015969 3300025960 Bacteria 4382
379 Ga0207651_10077902 3300025960 Unclassified 2375
380 Ga0207651_10351974 3300025960 Bacteria 1240
381 Ga0207712_10000139 3300025961 Bacteria 76388
382 Ga0207640_10030230 3300025981 Unclassified 3334
383 Ga0207658_10108671 3300025986 Bacteria 2188
384 Ga0207677_10014297 3300026023 Bacteria 4631
385 Ga0207677_10145214 3300026023 Unclassified 1822
386 Ga0207703_10000545 3300026035 Bacteria 38626
387 Ga0207703_10015170 3300026035 Bacteria 6013
388 Ga0207703_10033151 3300026035 Bacteria 4092
389 Ga0207703_10183971 3300026035 Bacteria 1846
390 Ga0207703_10210504 3300026035 Bacteria 1733
391 Ga0207703_10239271 3300026035 Bacteria 1631
392 Ga0207703_10357651 3300026035 Bacteria 1346
393 Ga0207703_10458980 3300026035 Bacteria 1191
394 Ga0207708_10000063 3300026075 Bacteria 87390
395 Ga0207708_10003435 3300026075 Bacteria 11669
396 Ga0207708_10005654 3300026075 Bacteria 9232
397 Ga0207708_10018707 3300026075 Bacteria 5218
398 Ga0207708_10026232 3300026075 Bacteria 4408
399 Ga0207708_10040304 3300026075 Bacteria 3561
400 Ga0207708_10236474 3300026075 Bacteria 1468
401 Ga0207641_10091332 3300026088 Unclassified 2664
402 Ga0207641_10425161 3300026088 Unclassified 1280
403 Ga0207648_10001538 3300026089 Bacteria 25397
404 Ga0207648_10006427 3300026089 Bacteria 11681
405 Ga0207648_10060009 3300026089 Bacteria 3317
406 Ga0207648_10067914 3300026089 Unclassified 3107
407 Ga0207676_10006513 3300026095 Bacteria 8255
408 Ga0207676_10079867 3300026095 Bacteria 2654
409 Ga0207676_10189977 3300026095 Bacteria 1806
410 Ga0207676_10205151 3300026095 Bacteria 1744
411 Ga0207676_10310269 3300026095 Bacteria 1444
412 Ga0207674_10000006 3300026116 Bacteria 233530
413 Ga0207674_10021209 3300026116 Bacteria 7003
414 Ga0207674_10153160 3300026116 Bacteria 2262
415 Ga0207674_10544721 3300026116 Bacteria 1121
416 Ga0207675_100000501 3300026118 Bacteria 38076
417 Ga0207675_100002425 3300026118 Bacteria 18463
418 Ga0207675_100011680 3300026118 Bacteria 8211
419 Ga0207675_100016312 3300026118 Bacteria 6934
420 Ga0207675_100023463 3300026118 Bacteria 5739
421 Ga0207675_100091101 3300026118 Bacteria 2867
422 Ga0207683_10136126 3300026121 Bacteria 2211
423 Ga0207683_10513403 3300026121 Unclassified 1107
424 Ga0207698_10196896 3300026142 Bacteria 1801
425 Ga0207428_10006379 3300027907 Bacteria 10903
426 Ga0207428_10013787 3300027907 Bacteria 7044
427 Ga0207428_10025115 3300027907 Bacteria 4990
428 Ga0207428_10191433 3300027907 Unclassified 1542
429 Ga0268265_10025716 3300028380 Bacteria 4182
430 Ga0268265_10062016 3300028380 Unclassified 2871
431 Ga0268265_10067149 3300028380 Bacteria 2775
432 Ga0268265_10083907 3300028380 Unclassified 2524
433 Ga0268265_10108505 3300028380 Bacteria 2260
434 Ga0268265_10284239 3300028380 Bacteria 1482
435 Ga0268264_10185651 3300028381 Bacteria 1892
436 Ga0268264_10221850 3300028381 Unclassified 1740
437 Ga0307513_10003602 3300031456 Bacteria 20953
438 Ga0307408_100012510 3300031548 Bacteria 5625
439 Ga0307408_100116195 3300031548 Bacteria 2065
440 Ga0307408_100243248 3300031548 Unclassified 1480
441 Ga0307405_10002592 3300031731 Bacteria 8019
442 Ga0307405_10142856 3300031731 Bacteria 1672
443 Ga0307413_10026506 3300031824 Archaea 3195
444 Ga0307406_10009480 3300031901 Bacteria 5460
445 Ga0307406_10183909 3300031901 Bacteria 1524
446 Ga0307407_10023916 3300031903 Archaea 3194
447 Ga0307412_10008848 3300031911 Bacteria 5765
448 Ga0307409_100033902 3300031995 Unclassified 3722
449 Ga0307416_100007782 3300032002 Bacteria 6850
450 Ga0307416_100097939 3300032002 Bacteria 2542
451 Ga0307416_100248967 3300032002 Bacteria 1728
452 Ga0307416_100331544 3300032002 Unclassified 1529
453 Ga0307416_100483350 3300032002 Bacteria 1299
454 Ga0307416_100504566 3300032002 Unclassified 1275
455 Ga0307414_10008387 3300032004 Bacteria 5856
456 Ga0307411_10008550 3300032005 Bacteria 5313
457 Ga0307411_10216431 3300032005 Unclassified 1483
458 Ga0307415_100002856 3300032126 Bacteria 8649
459 Ga0307415_100018005 3300032126 Bacteria 4253
460 Ga0307415_100119807 3300032126 Unclassified 1971
461 Ga0307415_100208841 3300032126 Bacteria 1556
462 Ga0373943_0140097 3300035170 Bacteria 1302
463 Ga0373942_0003080 3300035207 Bacteria 3948
464 Ga0373931_0150100 3300035691 Unclassified 1358
465 Ga0395900_0062212 3300037418 Unclassified 3837
466 Ga0395898_0022159 3300037466 Bacteria 6436
467 Ga0395901_0054699 3300038443 Unclassified 4149
468 Ga0395901_0329726 3300038443 Bacteria 1578
469 Ga0242420_001702 3300038996 Viruses 3005
470 Ga0436365_0407503 3300039437 Bacteria 219857
471 Ga0436365_0785613 3300039437 Bacteria 45802
472 Ga0439455_0008715 3300042012 Unclassified 2181
473 Ga0451576_0066258 3300045051 Bacteria 3760
474 Ga0451576_0159438 3300045051 Viruses 2354
475 Ga0451576_0248550 3300045051 Bacteria 1859
476 Ga0451576_0418467 3300045051 Bacteria 1406
477 Ga0495639_0053484 3300046475 Unclassified 1840
478 Ga0495664_0009518 3300046477 Bacteria 5440
479 Ga0495632_0023747 3300046519 Bacteria 3269
480 Ga0495663_0000935 3300046525 Bacteria 9753
481 Ga0495586_0020870 3300046535 Bacteria 3490
482 Ga0495621_0000315 3300046539 Bacteria 11702
483 Ga0495656_0118648 3300046615 Bacteria 1246
484 Ga0495668_0001291 3300046616 Bacteria 24736
485 Ga0495634_0005050 3300046642 Bacteria 10190
486 Ga0495672_0079973 3300047320 Unclassified 1824
487 Ga0496102_0129521 3300048905 Unclassified 2360
488 Ga0496104_0032936 3300048907 Bacteria 4825
489 Ga0496104_0169184 3300048907 Bacteria 2096
490 Ga0496106_0000719 3300048909 Bacteria 23847
491 Ga0496106_0227028 3300048909 Bacteria 1490
492 Ga0496109_0217998 3300048912 Unclassified 1795
493 Ga0496112_0198246 3300048915 Bacteria 1968
494 Ga0496112_0507576 3300048915 Bacteria 1141
495 Ga0496113_0228325 3300048916 Unclassified 1484
496 Ga0496114_0026089 3300048917 Bacteria 4781
497 Ga0496115_0136187 3300048918 Bacteria 2025
498 Ga0501291_001060 3300049514 Unclassified 3164
499 Ga0501292_011322 3300049515 Unclassified 1348
500 Ga0501299_022785 3300049522 Bacteria 1158
501 Ga0501038_0006931 3300049574 Bacteria 10461
502 Ga0501067_0014077 3300049583 Bacteria 4431
503 Ga0501073_0044774 3300049589 Bacteria 3119
504 Ga0501073_0099431 3300049589 Bacteria 2020
505 Ga0501075_0127287 3300049591 Unclassified 1940
506 Ga0501077_0129681 3300049593 Bacteria 1599
507 Ga0501206_008290 3300049653 Bacteria 1372
508 Ga0501207_001569 3300049654 Archaea 2867
509 Ga0501217_017881 3300049661 Unclassified 1639
510 Ga0501223_002372 3300049663 Archaea 4204
511 Ga0501223_007716 3300049663 Unclassified 2197
512 Ga0501227_006419 3300049665 Unclassified 2528
513 Ga0501233_000484 3300049668 Bacteria 6358
514 Ga0501233_004510 3300049668 Unclassified 2554
515 Ga0501233_030780 3300049668 Bacteria 1212
516 Ga0501249_004241 3300049679 Unclassified 2908
517 Ga0501225_0001382 3300049705 Bacteria 7573
518 Ga0501225_0007712 3300049705 Unclassified 3114
519 Ga0501225_0027593 3300049705 Unclassified 1561
520 Ga0501283_000186 3300049779 Bacteria 8086
521 Ga0501283_001349 3300049779 Bacteria 3207
522 nmdc:mga05p37_100462_c1 3300050507 Unclassified 3563
523 nmdc:mga05p37_107956_c1 3300050507 Bacteria 3424
524 nmdc:mga05p37_143377_c1 3300050507 Bacteria 2926
525 nmdc:mga05p37_33017_c1 3300050507 Bacteria 6337
526 nmdc:mga09592_8704_c1 3300050508 Bacteria 8256
527 nmdc:mga0qj67_41700_c1 3300050509 Bacteria 3611
528 nmdc:mga0qj67_82741_c1 3300050509 Bacteria 2574
529 nmdc:mga08y16_103415_c1 3300050511 Bacteria 2966
530 nmdc:mga08y16_10699_c1 3300050511 Bacteria 9627
531 nmdc:mga08y16_150104_c1 3300050511 Bacteria 2423
532 nmdc:mga08y16_2594_c1 3300050511 Bacteria 18556
533 nmdc:mga08y16_512961_c1 3300050511 Unclassified 1217
534 nmdc:mga0n895_1861_c1 3300050512 Bacteria 16112
535 nmdc:mga0n895_207783_c1 3300050512 Unclassified 1988
536 nmdc:mga0n895_51272_c1 3300050512 Bacteria 4048
537 nmdc:mga08x19_15281_c1 3300050514 Bacteria 4669
538 nmdc:mga0a205_237743_c1 3300050515 Unclassified 1703
539 nmdc:mga0a205_314320_c1 3300050515 Unclassified 1438
540 nmdc:mga0a205_331309_c1 3300050515 Bacteria 1392
541 nmdc:mga0a205_40057_c1 3300050515 Bacteria 4510
542 nmdc:mga0a205_452395_c1 3300050515 Bacteria 1144
543 nmdc:mga0a205_47176_c1 3300050515 Unclassified 4156
544 Ga0495601_0218969 3300053077 Unclassified 1243
545 Ga0500616_0003330 3300053153 Bacteria 12380
546 Ga0501084_0168430 3300054114 Unclassified 1849
547 Ga0501084_0211372 3300054114 Bacteria 1637
548 Ga0070696_100114084
549 JGI24748J21848_1000006
550 JGI24034J26672_10000002
551 JGI24751J29686_10000018
552 JGI25406J46586_10015378
553 rootL2_10160894
554 Ga0065714_10064448
555 Ga0065712_10000125
556 Ga0065712_10001631
557 Ga0065712_10079197
558 Ga0065715_10089810
559 Ga0065715_10099752
560 Ga0065715_10100174
561 Ga0065707_10007597
562 Ga0065707_10018880
563 Ga0065707_10091508
564 Ga0065707_10149369
565 Ga0070676_10025721
566 Ga0070676_10103498
567 Ga0070676_10122610
568 Ga0070676_10228696
569 Ga0070683_100003017
570 Ga0070690_100001854
571 Ga0070690_100024360
572 Ga0070670_100000176
573 Ga0070670_100068081
574 Ga0070670_100217529
575 Ga0070670_100218601
576 Ga0070670_100308162
577 Ga0068869_100011841
578 Ga0068869_100067972
579 Ga0070680_100001132
580 Ga0070680_100005449
581 Ga0070682_100000081
582 Ga0070682_100003805
583 Ga0068868_100014580
584 Ga0070660_100167488
585 Ga0070689_100001436
586 Ga0070689_100002981
587 Ga0070689_100007107
588 Ga0070689_100024261
589 Ga0070689_100031881
590 Ga0070689_100051637
591 Ga0070689_100215920
592 Ga0070691_10038264
593 Ga0070687_100005008
594 Ga0070661_100080570
595 Ga0070692_10017026
596 Ga0070692_10201263
597 Ga0070668_100341112
598 Ga0070669_100002368
599 Ga0070669_100033735
600 Ga0070669_100045594
601 Ga0070669_100134126
602 Ga0070669_100137850
603 Ga0070669_100171015
604 Ga0070675_100061774
605 Ga0070675_100191337
606 Ga0070671_100002547
607 Ga0070674_100184302
608 Ga0070673_100013430
609 Ga0070673_100025184
610 Ga0070673_100027819
611 Ga0070673_100041000
612 Ga0070688_100013745
613 Ga0070688_100110096
614 Ga0070659_100002651
615 Ga0070667_100004650
616 Ga0070703_10002466
617 Ga0070703_10004152
618 Ga0070703_10065730
619 Ga0070701_10105470
620 Ga0070705_100027078
621 Ga0070705_100030224
622 Ga0070700_100012641
623 Ga0070700_100020388
624 Ga0070700_100031185
625 Ga0070694_100000316
626 Ga0070694_100003554
627 Ga0070694_100011630
628 Ga0070694_100017601
629 Ga0070694_100030619
630 Ga0070694_100045516
631 Ga0070694_100066717
632 Ga0070694_100237103
633 Ga0070694_100258009
634 Ga0070708_100000223
635 Ga0070662_100038388
636 Ga0070662_100214860
637 Ga0070662_100345469
638 Ga0070681_10001899
639 Ga0070681_10002490
640 Ga0070681_10051321
641 Ga0070681_10109831
642 Ga0068867_100006370
643 Ga0068867_100058745
644 Ga0070685_10052554
645 Ga0070706_100000032
646 Ga0070706_100127036
647 Ga0070707_100035987
648 Ga0070707_100265040
649 Ga0070698_100004185
650 Ga0070698_100012105
651 Ga0070698_100025854
652 Ga0070698_100138416
653 Ga0070699_100000714
654 Ga0070699_100073588
655 Ga0070679_100000215
656 Ga0070684_100001147
657 Ga0070697_100000074
658 Ga0070697_100000171
659 Ga0070697_100001900
660 Ga0070697_100016086
661 Ga0070697_100063706
662 Ga0070697_100216719
663 Ga0068853_100017514
664 Ga0068853_100129902
665 Ga0068853_100150806
666 Ga0070672_100018705
667 Ga0070672_100136222
668 Ga0070672_100240218
669 Ga0070686_100006819
670 Ga0070686_100024392
671 Ga0070686_100113119
672 Ga0070686_100291036
673 Ga0070695_100020906
674 Ga0070695_100078738
675 Ga0070696_100020489
676 Ga0070696_100082659
677 Ga0070696_100086066
678 Ga0070696_100116618
679 Ga0070693_100017807
680 Ga0070693_100030215
681 Ga0070693_100033705
682 Ga0070693_100172649
683 Ga0070704_100050587
684 Ga0070664_100001410
685 Ga0068857_100104779
686 Ga0068857_100436284
687 Ga0068854_100020656
688 Ga0068856_100053338
689 Ga0070702_100011111
690 Ga0070702_100014223
691 Ga0068859_100020153
692 Ga0068859_100024289
693 Ga0068859_100037785
694 Ga0068859_100043681
695 Ga0068859_100054833
696 Ga0068859_100066980
697 Ga0068859_100167153
698 Ga0068859_100177103
699 Ga0068859_100189891
700 Ga0068859_100193106
701 Ga0068859_100246236
702 Ga0068859_100448249
703 Ga0068864_100003679
704 Ga0068864_100023378
705 Ga0068864_100052151
706 Ga0068864_100120358
707 Ga0068866_10001903
708 Ga0068866_10015127
709 Ga0068861_100008890
710 Ga0068861_100013125
711 Ga0068861_100014800
712 Ga0068861_100019588
713 Ga0068861_100022522
714 Ga0068851_10001068
715 Ga0068863_100040477
716 Ga0068858_100000566
717 Ga0068858_100021821
718 Ga0068858_100053565
719 Ga0068858_100137673
720 Ga0068858_100191753
721 Ga0068860_100005822
722 Ga0068860_100012765
723 Ga0068862_100032424
724 Ga0068862_100042220
725 Ga0081455_10212699
726 Ga0081539_10000119
727 Ga0081539_10000149
728 Ga0081539_10001119
729 Ga0070715_10000007
730 Ga0070716_100000007
731 Ga0097621_100001897
732 Ga0097621_100008040
733 Ga0097621_100008893
734 Ga0068871_100003863
735 Ga0068871_100005390
736 Ga0075428_100014391
737 Ga0075433_10023505
738 Ga0075433_10109580
739 Ga0075433_10109715
740 Ga0075433_10145006
741 Ga0075433_10168243
742 Ga0075433_10230453
743 Ga0075434_100028990
744 Ga0075434_100093655
745 Ga0075434_100141967
746 Ga0075434_100280280
747 Ga0075429_100006652
748 Ga0068865_100004156
749 Ga0068865_100019672
750 Ga0075436_100085887
751 Ga0097620_100020153
752 Ga0097620_100024288
753 Ga0097620_100037784
754 Ga0097620_100043682
755 Ga0097620_100054833
756 Ga0097620_100066980
757 Ga0097620_100167148
758 Ga0097620_100177101
759 Ga0097620_100189888
760 Ga0097620_100193126
761 Ga0097620_100246254
762 Ga0097620_100448245
763 Ga0075435_100047925
764 Ga0105240_10024946
765 Ga0111539_10006063
766 Ga0111539_10017945
767 Ga0111539_10097206
768 Ga0111539_10101308
769 Ga0111539_10216560
770 Ga0105245_10349548
771 Ga0105247_10000001
772 Ga0105247_10018155
773 Ga0114129_10002382
774 Ga0114129_10020976
775 Ga0114129_10117862
776 Ga0114129_10122314
777 Ga0114129_10124873
778 Ga0114129_10130979
779 Ga0114129_10308118
780 Ga0114129_10345234
781 Ga0105243_10000024
782 Ga0105243_10002873
783 Ga0105243_10005373
784 Ga0105243_10033471
785 Ga0105243_10168953
786 Ga0105241_10011231
787 Ga0105241_10019050
788 Ga0105242_10000081
789 Ga0105242_10000502
790 Ga0105242_10001371
791 Ga0105242_10012081
792 Ga0105248_10020598
793 Ga0105248_10021507
794 Ga0105248_10027350
795 Ga0105248_10068646
796 Ga0105248_10084919
797 Ga0105248_10098022
798 Ga0105248_10123571
799 Ga0105248_10433900
800 Ga0105237_10001297
801 Ga0105237_10489824
802 Ga0105238_10005166
803 Ga0105238_10021313
804 Ga0105249_10000139
805 Ga0105249_10001657
806 Ga0105249_10030651
807 Ga0105249_10040658
808 Ga0105249_10065749
809 Ga0105239_10016582
810 Ga0105239_10196092
811 Ga0105239_10350929
812 Ga0105246_10045814
813 Ga0105246_10103447
814 Ga0157373_10007590
815 Ga0157374_10049079
816 Ga0157374_10081196
817 Ga0157374_10318541
818 Ga0157378_10000001
819 Ga0157378_10000124
820 Ga0157378_10004222
821 Ga0157378_10022090
822 Ga0157378_10073143
823 Ga0157378_10124801
824 Ga0157378_10146621
825 Ga0157378_10221987
826 Ga0157378_10452864
827 Ga0163162_10000045
828 Ga0163162_10076750
829 Ga0163162_10334306
830 Ga0157372_10012948
831 Ga0157372_10154632
832 Ga0157375_10001076
833 Ga0157375_10018756
834 Ga0157375_10173415
835 Ga0157375_10346384
836 Ga0163163_10000359
837 Ga0163163_10003575
838 Ga0163163_10017000
839 Ga0163163_10073387
840 Ga0163163_10176245
841 Ga0157380_10001576
842 Ga0157380_10002219
843 Ga0157380_10048764
844 Ga0157380_10052552
845 Ga0157380_10136666
846 Ga0157379_10054592
847 Ga0157379_10079468
848 Ga0157376_10011222
849 Ga0157376_10095174
850 Ga0163161_10300334
851 Ga0213876_10000325
852 Ga0207672_1000333
853 Ga0207697_10002003
854 Ga0207656_10000624
855 Ga0207653_10000303
856 Ga0207653_10000707
857 Ga0207710_10000003
858 Ga0207710_10000470
859 Ga0207647_10008775
860 Ga0207685_10000007
861 Ga0207645_10024559
862 Ga0207645_10031099
863 Ga0207643_10002879
864 Ga0207684_10000065
865 Ga0207684_10002404
866 Ga0207684_10010735
867 Ga0207684_10066816
868 Ga0207707_10000320
869 Ga0207707_10088953
870 Ga0207707_10350425
871 Ga0207695_10155259
872 Ga0207671_10006617
873 Ga0207660_10000187
874 Ga0207660_10185840
875 Ga0207662_10003334
876 Ga0207662_10043219
877 Ga0207662_10216351
878 Ga0207652_10000066
879 Ga0207646_10040824
880 Ga0207646_10260419
881 Ga0207681_10002679
882 Ga0207681_10003764
883 Ga0207681_10028141
884 Ga0207681_10163023
885 Ga0207650_10000080
886 Ga0207650_10011456
887 Ga0207650_10033876
888 Ga0207659_10040131
889 Ga0207644_10003142
890 Ga0207644_10007215
891 Ga0207644_10013295
892 Ga0207706_10037179
893 Ga0207706_10067050
894 Ga0207706_10086778
895 Ga0207686_10000011
896 Ga0207686_10000012
897 Ga0207686_10004897
898 Ga0207686_10016265
899 Ga0207709_10000042
900 Ga0207709_10002713
901 Ga0207670_10004230
902 Ga0207670_10133616
903 Ga0207670_10149615
904 Ga0207670_10338541
905 Ga0207669_10010974
906 Ga0207704_10000605
907 Ga0207665_10000027
908 Ga0207691_10000799
909 Ga0207691_10091050
910 Ga0207691_10144228
911 Ga0207691_10207431
912 Ga0207711_10022592
913 Ga0207711_10036498
914 Ga0207711_10058389
915 Ga0207711_10107430
916 Ga0207711_10162435
917 Ga0207689_10004166
918 Ga0207689_10005100
919 Ga0207689_10005285
920 Ga0207689_10042388
921 Ga0207689_10134912
922 Ga0207661_10031163
923 Ga0207661_10260396
924 Ga0207679_10171994
925 Ga0207651_10015969
926 Ga0207651_10077902
927 Ga0207651_10351974
928 Ga0207712_10000139
929 Ga0207640_10030230
930 Ga0207658_10108671
931 Ga0207677_10014297
932 Ga0207677_10145214
933 Ga0207703_10000545
934 Ga0207703_10015170
935 Ga0207703_10033151
936 Ga0207703_10183971
937 Ga0207703_10210504
938 Ga0207703_10239271
939 Ga0207703_10357651
940 Ga0207703_10458980
941 Ga0207708_10000063
942 Ga0207708_10003435
943 Ga0207708_10005654
944 Ga0207708_10018707
945 Ga0207708_10026232
946 Ga0207708_10040304
947 Ga0207708_10236474
948 Ga0207641_10091332
949 Ga0207641_10425161
950 Ga0207648_10001538
951 Ga0207648_10006427
952 Ga0207648_10060009
953 Ga0207648_10067914
954 Ga0207676_10006513
955 Ga0207676_10079867
956 Ga0207676_10189977
957 Ga0207676_10205151
958 Ga0207676_10310269
959 Ga0207674_10000006
960 Ga0207674_10021209
961 Ga0207674_10153160
962 Ga0207674_10544721
963 Ga0207675_100000501
964 Ga0207675_100002425
965 Ga0207675_100011680
966 Ga0207675_100016312
967 Ga0207675_100023463
968 Ga0207675_100091101
969 Ga0207683_10136126
970 Ga0207683_10513403
971 Ga0207698_10196896
972 Ga0207428_10006379
973 Ga0207428_10013787
974 Ga0207428_10025115
975 Ga0207428_10191433
976 Ga0268265_10025716
977 Ga0268265_10062016
978 Ga0268265_10067149
979 Ga0268265_10083907
980 Ga0268265_10108505
981 Ga0268265_10284239
982 Ga0268264_10185651
983 Ga0268264_10221850
984 Ga0307513_10003602
985 Ga0307408_100012510
986 Ga0307408_100116195
987 Ga0307408_100243248
988 Ga0307405_10002592
989 Ga0307405_10142856
990 Ga0307413_10026506
991 Ga0307406_10009480
992 Ga0307406_10183909
993 Ga0307407_10023916
994 Ga0307412_10008848
995 Ga0307409_100033902
996 Ga0307416_100007782
997 Ga0307416_100097939
998 Ga0307416_100248967
999 Ga0307416_100331544
1000 Ga0307416_100483350
1001 Ga0307416_100504566
1002 Ga0307414_10008387
1003 Ga0307411_10008550
1004 Ga0307411_10216431
1005 Ga0307415_100002856
1006 Ga0307415_100018005
1007 Ga0307415_100119807
1008 Ga0307415_100208841
1009 Ga0373943_0140097
1010 Ga0373942_0003080
1011 Ga0373931_0150100
1012 Ga0395900_0062212
1013 Ga0395898_0022159
1014 Ga0395901_0054699
1015 Ga0395901_0329726
1016 Ga0242420_001702
1017 Ga0436365_0407503
1018 Ga0436365_0785613
1019 Ga0439455_0008715
1020 Ga0451576_0066258
1021 Ga0451576_0159438
1022 Ga0451576_0248550
1023 Ga0451576_0418467
1024 Ga0495639_0053484
1025 Ga0495664_0009518
1026 Ga0495632_0023747
1027 Ga0495663_0000935
1028 Ga0495586_0020870
1029 Ga0495621_0000315
1030 Ga0495656_0118648
1031 Ga0495668_0001291
1032 Ga0495634_0005050
1033 Ga0495672_0079973
1034 Ga0496102_0129521
1035 Ga0496104_0032936
1036 Ga0496104_0169184
1037 Ga0496106_0000719
1038 Ga0496106_0227028
1039 Ga0496109_0217998
1040 Ga0496112_0198246
1041 Ga0496112_0507576
1042 Ga0496113_0228325
1043 Ga0496114_0026089
1044 Ga0496115_0136187
1045 Ga0501291_001060
1046 Ga0501292_011322
1047 Ga0501299_022785
1048 Ga0501038_0006931
1049 Ga0501067_0014077
1050 Ga0501073_0044774
1051 Ga0501073_0099431
1052 Ga0501075_0127287
1053 Ga0501077_0129681
1054 Ga0501206_008290
1055 Ga0501207_001569
1056 Ga0501217_017881
1057 Ga0501223_002372
1058 Ga0501223_007716
1059 Ga0501227_006419
1060 Ga0501233_000484
1061 Ga0501233_004510
1062 Ga0501233_030780
1063 Ga0501249_004241
1064 Ga0501225_0001382
1065 Ga0501225_0007712
1066 Ga0501225_0027593
1067 Ga0501283_000186
1068 Ga0501283_001349
1069 nmdc:mga05p37_100462_c1
1070 nmdc:mga05p37_107956_c1
1071 nmdc:mga05p37_143377_c1
1072 nmdc:mga05p37_33017_c1
1073 nmdc:mga09592_8704_c1
1074 nmdc:mga0qj67_41700_c1
1075 nmdc:mga0qj67_82741_c1
1076 nmdc:mga08y16_103415_c1
1077 nmdc:mga08y16_10699_c1
1078 nmdc:mga08y16_150104_c1
1079 nmdc:mga08y16_2594_c1
1080 nmdc:mga08y16_512961_c1
1081 nmdc:mga0n895_1861_c1
1082 nmdc:mga0n895_207783_c1
1083 nmdc:mga0n895_51272_c1
1084 nmdc:mga08x19_15281_c1
1085 nmdc:mga0a205_237743_c1
1086 nmdc:mga0a205_314320_c1
1087 nmdc:mga0a205_331309_c1
1088 nmdc:mga0a205_40057_c1
1089 nmdc:mga0a205_452395_c1
1090 nmdc:mga0a205_47176_c1
1091 Ga0495601_0218969
1092 Ga0500616_0003330
1093 Ga0501084_0168430
1094 Ga0501084_0211372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

85

204

0.9

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

86

278

0.87

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

85

312

0.86

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

85

202

0.85

PF07993

NAD_binding_4

Male sterility protein

135

283

0.83

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

86

321

0.82

PF13460

NAD_binding_10

NAD(P)H-binding

89

273

0.72

PF08659

KR

KR domain

83

205

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.8647 31 359
2x4g-assembly1.cif.gz_A-2 crystal structure of pa4631, a nucleoside-diphosphate-sugar epimerase from pseudomonas aeruginosa 0.8567 31 359
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.8543 32 359
6jkg-assembly1.cif.gz_A the nad+-free form of human nsdhl 0.8507 31 199
3wj7-assembly1.cif.gz_C crystal structure of gox2253 0.8469 32 359
ID Description Score Start End Superfamily
af_Q94HG6_1_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8857 33 359 3.40.50.720
af_O43050_3_339_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8813 31 354 3.40.50.720
af_P96816_2_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8665 33 351 3.40.50.720
2x4gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8647 31 359 3.40.50.720
af_X1WDV5_63_414_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.863 27 356 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W1C0I7-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9879 92 357 GO:0004029
GO:0005737
AF-A0A2E4FB10-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.961 26 355 GO:0004029
GO:0005737
AF-A0A2E9QQY1-F1-model_v4 Dihydrokaempferol 4-reductase 0.9564 31 359 GO:0004029
GO:0005737
AF-A0A7W1C0I7-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9558 92 357 GO:0004029
GO:0005737
AF-A0A2V9L2Q4-F1-model_v4 NAD-dependent epimerase 0.949 31 354 GO:0004029
GO:0005737

Map