metagRoot

F462049

General Info

Members	Datasets	Scaffolds	Average Seq Length
546	250	546	483

Family's Representative Sequence

Representative Sequence	3300050514\|nmdc:mga08x19_51900_c1\|nmdc:mga08x19_51900_c1_710_2167
Length	485
Sequence	MSTNVNTIQDLANREYKWGFVTEVEQEKIAKGLNEDVVRVISAKKNEPEFMLEWRLKAYRHWASLEKAQAEPKWANIHYPPIDYQDIHYYSAPKMKKSKASIEEVDPEILKTYEKLGIPLEEQKMLQGVAVDAVFDSVSVATTFKHKLAEAGVIFCSFSEAVQKHPELVKKYLGSVVPYSDNFFAALNAAVFSDGSFVYVPKGVRCPMELSTYFRINASETGQFERTLIVADEGAYVSYLEGCTAPIRDENQLHAAVVELVAMDNAQIKYSTVQNWYPGDKQGKGGIYNFVTKRGKCAGVNSKISWTQVETGSAITWKYPSCILQGDNSVGEFYSVALTNNYQQADTGTKMIHIGKNTKSTVVSKGISAGHGQNTYRGQVKILKNAAAARNYTQCDSLLIGDQCGAHTFPYIEVRNASAHMEHEASTSKIGEDQMFYLRQRGLKTEDAVSMIVNGFCKQVFRELPMEFAVEAQKLLSVSLEGSVG

Samples

	Sample ID	Description	Type	Environment
1	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
2	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
3	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
4	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
5	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
6	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
8	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
9	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
13	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
14	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
17	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
18	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
19	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
20	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
21	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
22	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
23	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
24	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
25	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
26	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
27	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
28	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
29	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
30	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
31	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
32	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
33	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
34	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
35	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
38	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
39	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
40	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
41	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
42	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
43	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
44	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
47	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
48	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
49	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
50	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
51	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
52	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
53	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
54	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
55	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
56	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
57	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
58	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
59	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
60	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
61	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
62	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
63	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
64	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
65	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
66	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
67	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
69	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
71	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
73	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
74	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
75	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
76	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
77	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
78	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
79	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
80	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
81	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
82	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
83	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
84	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
85	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
86	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
87	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
88	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
89	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
90	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
91	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
92	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
93	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
94	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
95	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
96	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
97	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
143	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
147	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
148	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
149	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
150	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
151	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
152	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
153	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
154	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
155	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
156	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
157	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
158	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
159	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
160	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
161	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
162	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
163	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
164	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
165	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
166	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
167	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
168	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
169	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
170	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
171	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
172	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
173	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
174	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
175	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
176	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
177	3300032120	Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
178	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
179	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
180	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
181	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
182	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
183	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
184	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
185	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
186	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
187	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
188	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
189	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
190	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
191	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
192	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
193	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
194	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
195	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
196	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
197	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
198	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
199	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
200	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
201	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
202	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
203	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
204	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
205	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
206	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
207	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
208	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
209	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
210	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
221	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
223	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
226	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
229	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
232	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
236	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
237	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
238	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
239	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
240	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
241	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
242	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
243	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
244	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
245	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
246	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
247	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
248	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
249	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
250	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.34
Metatranscriptomes	3.66
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	1.28
Rhizosphere	98.35
Stem	0
Stem Tuber	0
Unclassified	0.37

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	ARcpr5oldR_c001952	3300000041	Bacteria	1972
2	ARcpr5yngRDRAFT_c002404	3300000043	Bacteria	1948
3	JGI25405J52794_10002104	3300003911	Bacteria	3383
4	Ga0058863_10127816	3300004799	Bacteria	7581
5	Ga0058862_10034373	3300004803	Bacteria	7297
6	Ga0065714_10097707	3300005288	Bacteria	1729
7	Ga0065712_10000313	3300005290	Bacteria	13868
8	Ga0065712_10002275	3300005290	Bacteria	7928
9	Ga0065715_10000451	3300005293	Bacteria	11798
10	Ga0065715_10103901	3300005293	Bacteria	3000
11	Ga0065707_10001496	3300005295	Bacteria	11548
12	Ga0070690_100120619	3300005330	Bacteria	1759
13	Ga0070670_100001082	3300005331	Bacteria	21598
14	Ga0070670_100006141	3300005331	Bacteria	10156
15	Ga0070670_100040121	3300005331	Bacteria	4026
16	Ga0068869_100020226	3300005334	Bacteria	4562
17	Ga0070680_100034481	3300005336	Bacteria	4080
18	Ga0070680_100077728	3300005336	Bacteria	2733
19	Ga0070682_100060000	3300005337	Bacteria	2404
20	Ga0070689_100059548	3300005340	Bacteria	2968
21	Ga0070668_100087964	3300005347	Bacteria	2445
22	Ga0070675_100110149	3300005354	Bacteria	2328
23	Ga0070674_100004344	3300005356	Bacteria	8078
24	Ga0070674_100056673	3300005356	Bacteria	2717
25	Ga0070688_100134806	3300005365	Bacteria	1670
26	Ga0070659_100158209	3300005366	Bacteria	1851
27	Ga0070703_10001025	3300005406	Bacteria	8761
28	Ga0070709_10000021	3300005434	Bacteria	135637
29	Ga0070713_100041843	3300005436	Bacteria	3736
30	Ga0070713_100043773	3300005436	Bacteria	3662
31	Ga0070711_100000544	3300005439	Bacteria	19677
32	Ga0070705_100001406	3300005440	Bacteria	12746
33	Ga0070705_100098183	3300005440	Bacteria	1842
34	Ga0070694_100000001	3300005444	Bacteria	226104
35	Ga0070694_100013761	3300005444	Bacteria	5057
36	Ga0070694_100034834	3300005444	Bacteria	3324
37	Ga0070708_100002626	3300005445	Bacteria	13911
38	Ga0070708_100084116	3300005445	Bacteria	2886
39	Ga0070663_100148149	3300005455	Bacteria	1797
40	Ga0070678_100056042	3300005456	Bacteria	2880
41	Ga0070681_10003073	3300005458	Bacteria	15489
42	Ga0070681_10005645	3300005458	Bacteria	12091
43	Ga0070681_10024948	3300005458	Bacteria	6015
44	Ga0070681_10146440	3300005458	Bacteria	2291
45	Ga0070681_10161417	3300005458	Bacteria	2165
46	Ga0068867_100179749	3300005459	Bacteria	1681
47	Ga0070706_100000656	3300005467	Bacteria	39553
48	Ga0070706_100001700	3300005467	Bacteria	22911
49	Ga0070706_100006733	3300005467	Bacteria	10848
50	Ga0070706_100030008	3300005467	Bacteria	5007
51	Ga0070706_100040184	3300005467	Bacteria	4318
52	Ga0070707_100002436	3300005468	Bacteria	17719
53	Ga0070707_100002550	3300005468	Bacteria	17313
54	Ga0070707_100020683	3300005468	Bacteria	6210
55	Ga0070707_100096721	3300005468	Bacteria	2860
56	Ga0070698_100002386	3300005471	Bacteria	20723
57	Ga0070698_100003585	3300005471	Bacteria	17060
58	Ga0070698_100047290	3300005471	Bacteria	4399
59	Ga0070698_100131128	3300005471	Bacteria	2462
60	Ga0070699_100000005	3300005518	Bacteria	384287
61	Ga0070699_100000062	3300005518	Bacteria	101909
62	Ga0070699_100093486	3300005518	Bacteria	2631
63	Ga0070679_100007026	3300005530	Bacteria	10499
64	Ga0070679_100008982	3300005530	Bacteria	9431
65	Ga0070679_100017081	3300005530	Bacteria	7014
66	Ga0070679_100154346	3300005530	Bacteria	2271
67	Ga0070684_100051812	3300005535	Bacteria	3567
68	Ga0070697_100008441	3300005536	Bacteria	8039
69	Ga0070697_100010794	3300005536	Bacteria	7133
70	Ga0070697_100024249	3300005536	Bacteria	4828
71	Ga0070697_100032034	3300005536	Bacteria	4228
72	Ga0068853_100114334	3300005539	Bacteria	2401
73	Ga0070672_100095015	3300005543	Bacteria	2410
74	Ga0070695_100004622	3300005545	Bacteria	8086
75	Ga0070695_100016786	3300005545	Bacteria	4436
76	Ga0070695_100019708	3300005545	Bacteria	4112
77	Ga0070695_100079551	3300005545	Bacteria	2164
78	Ga0070696_100000026	3300005546	Bacteria	68402
79	Ga0070696_100026243	3300005546	Bacteria	3963
80	Ga0070696_100086991	3300005546	Bacteria	2220
81	Ga0070696_100087994	3300005546	Bacteria	2207
82	Ga0070693_100009470	3300005547	Bacteria	4847
83	Ga0070693_100096198	3300005547	Bacteria	1795
84	Ga0070693_100101856	3300005547	Bacteria	1751
85	Ga0070665_100058284	3300005548	Bacteria	3872
86	Ga0070665_100090385	3300005548	Bacteria	3068
87	Ga0070704_100030212	3300005549	Bacteria	3629
88	Ga0070704_100103172	3300005549	Bacteria	2154
89	Ga0068855_100011235	3300005563	Bacteria	10813
90	Ga0068855_100018035	3300005563	Bacteria	8481
91	Ga0068855_100083910	3300005563	Bacteria	3690
92	Ga0068855_100110028	3300005563	Bacteria	3163
93	Ga0068855_100148868	3300005563	Bacteria	2662
94	Ga0070664_100002612	3300005564	Bacteria	14539
95	Ga0070664_100034205	3300005564	Bacteria	4262
96	Ga0068852_100033355	3300005616	Bacteria	4273
97	Ga0068859_100005263	3300005617	Bacteria	13147
98	Ga0068859_100069667	3300005617	Bacteria	3552
99	Ga0068866_10037712	3300005718	Bacteria	2376
100	Ga0068860_100021308	3300005843	Bacteria	6278
101	Ga0081455_10000428	3300005937	Bacteria	55173
102	Ga0081455_10056661	3300005937	Bacteria	3326
103	Ga0081538_10004248	3300005981	Bacteria	13285
104	Ga0081538_10010829	3300005981	Bacteria	7445
105	Ga0081538_10033293	3300005981	Bacteria	3434
106	Ga0081540_1044596	3300005983	Bacteria	2262
107	Ga0070717_10003519	3300006028	Bacteria	11221
108	Ga0070717_10007708	3300006028	Bacteria	8008
109	Ga0070717_10022599	3300006028	Bacteria	4972
110	Ga0070717_10151306	3300006028	Bacteria	2008
111	Ga0070716_100069916	3300006173	Bacteria	2059
112	Ga0070712_100027555	3300006175	Bacteria	3794
113	Ga0097621_100000105	3300006237	Bacteria	47605
114	Ga0097621_100025876	3300006237	Bacteria	4597
115	Ga0075428_100001950	3300006844	Bacteria	22174
116	Ga0075428_100002804	3300006844	Bacteria	18967
117	Ga0075428_100010610	3300006844	Bacteria	10239
118	Ga0075428_100011361	3300006844	Bacteria	9905
119	Ga0075428_100026304	3300006844	Bacteria	6442
120	Ga0075428_100033570	3300006844	Bacteria	5665
121	Ga0075428_100051034	3300006844	Bacteria	4535
122	Ga0075428_100070055	3300006844	Bacteria	3834
123	Ga0075428_100142630	3300006844	Bacteria	2604
124	Ga0075428_100188548	3300006844	Bacteria	2231
125	Ga0075428_100191562	3300006844	Bacteria	2211
126	Ga0075430_100015804	3300006846	Bacteria	6428
127	Ga0075431_100005499	3300006847	Bacteria	12511
128	Ga0075431_100017177	3300006847	Bacteria	7353
129	Ga0075431_100017309	3300006847	Bacteria	7325
130	Ga0075431_100045140	3300006847	Bacteria	4544
131	Ga0075433_10000284	3300006852	Bacteria	30215
132	Ga0075433_10001441	3300006852	Bacteria	17547
133	Ga0075433_10001794	3300006852	Bacteria	16083
134	Ga0075433_10004331	3300006852	Bacteria	11025
135	Ga0075433_10015607	3300006852	Bacteria	6238
136	Ga0075433_10017048	3300006852	Bacteria	6005
137	Ga0075433_10022415	3300006852	Bacteria	5300
138	Ga0075433_10051318	3300006852	Bacteria	3591
139	Ga0075433_10102678	3300006852	Bacteria	2533
140	Ga0075433_10270313	3300006852	Bacteria	1506
141	Ga0075434_100005604	3300006871	Bacteria	11441
142	Ga0075434_100005943	3300006871	Bacteria	11171
143	Ga0075434_100007563	3300006871	Bacteria	10065
144	Ga0075434_100007819	3300006871	Bacteria	9906
145	Ga0075434_100011196	3300006871	Bacteria	8443
146	Ga0075434_100011505	3300006871	Bacteria	8347
147	Ga0075434_100015358	3300006871	Bacteria	7337
148	Ga0075434_100052420	3300006871	Bacteria	4054
149	Ga0075434_100066492	3300006871	Bacteria	3590
150	Ga0075434_100070046	3300006871	Bacteria	3497
151	Ga0075429_100000616	3300006880	Bacteria	27440
152	Ga0075429_100018924	3300006880	Bacteria	5966
153	Ga0075429_100029751	3300006880	Bacteria	4745
154	Ga0075429_100054600	3300006880	Bacteria	3475
155	Ga0075429_100162391	3300006880	Bacteria	1956
156	Ga0068865_100056969	3300006881	Bacteria	2725
157	Ga0075436_100004187	3300006914	Bacteria	9901
158	Ga0075436_100009149	3300006914	Bacteria	6777
159	Ga0075436_100011722	3300006914	Bacteria	6017
160	Ga0075436_100054037	3300006914	Bacteria	2772
161	Ga0097620_100005263	3300006931	Bacteria	13147
162	Ga0097620_100069668	3300006931	Bacteria	3552
163	Ga0075435_100005005	3300007076	Bacteria	9197
164	Ga0075435_100011509	3300007076	Bacteria	6513
165	Ga0075435_100053989	3300007076	Bacteria	3242
166	Ga0075435_100054961	3300007076	Bacteria	3214
167	Ga0075435_100091956	3300007076	Bacteria	2504
168	Ga0111539_10004509	3300009094	Bacteria	18211
169	Ga0111539_10047173	3300009094	Bacteria	5150
170	Ga0111539_10063600	3300009094	Bacteria	4366
171	Ga0111539_10072248	3300009094	Bacteria	4069
172	Ga0105245_10010341	3300009098	Bacteria	8128
173	Ga0114129_10002610	3300009147	Bacteria	25066
174	Ga0114129_10004080	3300009147	Bacteria	20630
175	Ga0114129_10013746	3300009147	Bacteria	11540
176	Ga0114129_10017177	3300009147	Bacteria	10305
177	Ga0114129_10020673	3300009147	Bacteria	9358
178	Ga0114129_10064210	3300009147	Bacteria	5123
179	Ga0114129_10403480	3300009147	Bacteria	1801
180	Ga0105243_10158760	3300009148	Bacteria	1948
181	Ga0105241_10040013	3300009174	Bacteria	3538
182	Ga0105241_10043740	3300009174	Bacteria	3393
183	Ga0105241_10140429	3300009174	Bacteria	1966
184	Ga0105242_10077796	3300009176	Bacteria	2768
185	Ga0105242_10105772	3300009176	Bacteria	2390
186	Ga0105248_10033406	3300009177	Bacteria	5747
187	Ga0105238_10089697	3300009551	Bacteria	3062
188	Ga0105249_10035009	3300009553	Bacteria	4552
189	Ga0105239_10269999	3300010375	Bacteria	1913
190	Ga0105246_10009016	3300011119	Bacteria	6144
191	Ga0157373_10034571	3300013100	Bacteria	3630
192	Ga0157370_10024890	3300013104	Bacteria	5926
193	Ga0157369_10022318	3300013105	Bacteria	7065
194	Ga0157369_10043764	3300013105	Bacteria	4879
195	Ga0157369_10151448	3300013105	Bacteria	2451
196	Ga0157374_10009945	3300013296	Bacteria	8167
197	Ga0157374_10096844	3300013296	Bacteria	2822
198	Ga0157378_10000383	3300013297	Bacteria	43831
199	Ga0157378_10011518	3300013297	Bacteria	7742
200	Ga0157378_10079293	3300013297	Bacteria	2964
201	Ga0157378_10190453	3300013297	Bacteria	1934
202	Ga0163162_10028553	3300013306	Bacteria	5521
203	Ga0163162_10112731	3300013306	Bacteria	2818
204	Ga0163163_10151235	3300014325	Bacteria	2365
205	Ga0157376_10012012	3300014969	Bacteria	6408
206	Ga0197907_10275585	3300020069	Bacteria	2179
207	Ga0197907_11219713	3300020069	Bacteria	2189
208	Ga0206356_11374921	3300020070	Bacteria	1515
209	Ga0206356_11419372	3300020070	Bacteria	1992
210	Ga0206349_1697191	3300020075	Bacteria	3248
211	Ga0206351_10096246	3300020077	Bacteria	1919
212	Ga0206351_10817426	3300020077	Bacteria	1507
213	Ga0206350_10253816	3300020080	Bacteria	2984
214	Ga0206350_10319129	3300020080	Bacteria	1974
215	Ga0206350_10424972	3300020080	Bacteria	1836
216	Ga0206350_10939692	3300020080	Bacteria	4288
217	Ga0206353_10459664	3300020082	Bacteria	2060
218	Ga0213875_10005602	3300021388	Bacteria	6712
219	Ga0224712_10001025	3300022467	Bacteria	6117
220	Ga0224712_10002257	3300022467	Bacteria	4715
221	Ga0228598_1005971	3300024227	Bacteria	2531
222	Ga0207697_10010525	3300025315	Bacteria	3950
223	Ga0207697_10014990	3300025315	Bacteria	3207
224	Ga0207653_10000331	3300025885	Bacteria	24921
225	Ga0207692_10062361	3300025898	Bacteria	1934
226	Ga0207688_10039142	3300025901	Bacteria	2634
227	Ga0207680_10063243	3300025903	Bacteria	2264
228	Ga0207647_10038025	3300025904	Bacteria	3046
229	Ga0207699_10000005	3300025906	Bacteria	534560
230	Ga0207645_10000928	3300025907	Bacteria	24291
231	Ga0207645_10028101	3300025907	Bacteria	3632
232	Ga0207684_10000700	3300025910	Bacteria	39574
233	Ga0207684_10000735	3300025910	Bacteria	38479
234	Ga0207684_10002137	3300025910	Bacteria	20256
235	Ga0207684_10003831	3300025910	Bacteria	14484
236	Ga0207684_10012833	3300025910	Bacteria	7260
237	Ga0207684_10025923	3300025910	Bacteria	4997
238	Ga0207684_10026220	3300025910	Bacteria	4969
239	Ga0207684_10067581	3300025910	Bacteria	3038
240	Ga0207654_10053602	3300025911	Bacteria	2329
241	Ga0207707_10002951	3300025912	Bacteria	15147
242	Ga0207707_10009842	3300025912	Bacteria	8289
243	Ga0207707_10013278	3300025912	Bacteria	7177
244	Ga0207695_10071393	3300025913	Bacteria	3546
245	Ga0207693_10013694	3300025915	Bacteria	6533
246	Ga0207663_10000009	3300025916	Bacteria	196493
247	Ga0207663_10001864	3300025916	Bacteria	9977
248	Ga0207660_10000046	3300025917	Bacteria	61187
249	Ga0207660_10010890	3300025917	Bacteria	5913
250	Ga0207657_10004867	3300025919	Bacteria	14132
251	Ga0207652_10001327	3300025921	Bacteria	21959
252	Ga0207652_10181386	3300025921	Bacteria	1892
253	Ga0207646_10004008	3300025922	Bacteria	16295
254	Ga0207646_10010268	3300025922	Bacteria	9167
255	Ga0207646_10083548	3300025922	Bacteria	2856
256	Ga0207646_10240118	3300025922	Bacteria	1637
257	Ga0207650_10000709	3300025925	Bacteria	25995
258	Ga0207650_10001518	3300025925	Bacteria	16598
259	Ga0207650_10162108	3300025925	Bacteria	1772
260	Ga0207659_10091964	3300025926	Bacteria	2267
261	Ga0207687_10000753	3300025927	Bacteria	21897
262	Ga0207700_10003376	3300025928	Bacteria	9269
263	Ga0207700_10017532	3300025928	Bacteria	4786
264	Ga0207700_10032004	3300025928	Bacteria	3745
265	Ga0207700_10062080	3300025928	Bacteria	2837
266	Ga0207664_10012835	3300025929	Bacteria	6001
267	Ga0207664_10036549	3300025929	Bacteria	3796
268	Ga0207664_10076053	3300025929	Bacteria	2716
269	Ga0207706_10001213	3300025933	Bacteria	26051
270	Ga0207706_10095145	3300025933	Bacteria	2620
271	Ga0207665_10002075	3300025939	Bacteria	13523
272	Ga0207665_10021722	3300025939	Bacteria	4222
273	Ga0207691_10019868	3300025940	Bacteria	6354
274	Ga0207689_10022342	3300025942	Bacteria	5320
275	Ga0207689_10061785	3300025942	Bacteria	3081
276	Ga0207661_10118478	3300025944	Bacteria	2250
277	Ga0207679_10000936	3300025945	Bacteria	18659
278	Ga0207679_10030947	3300025945	Bacteria	3742
279	Ga0207667_10101576	3300025949	Bacteria	2967
280	Ga0207667_10103674	3300025949	Bacteria	2934
281	Ga0207667_10163283	3300025949	Bacteria	2290
282	Ga0207712_10051389	3300025961	Bacteria	2882
283	Ga0207712_10073441	3300025961	Bacteria	2467
284	Ga0207668_10039234	3300025972	Bacteria	3186
285	Ga0207640_10032671	3300025981	Bacteria	3228
286	Ga0207678_10103246	3300026067	Bacteria	2433
287	Ga0207708_10074963	3300026075	Bacteria	2594
288	Ga0207702_10045254	3300026078	Bacteria	3702
289	Ga0207648_10043717	3300026089	Bacteria	3932
290	Ga0207648_10191091	3300026089	Bacteria	1814
291	Ga0207683_10000467	3300026121	Bacteria	37592
292	Ga0207683_10033616	3300026121	Bacteria	4455
293	Ga0209968_1001585	3300027526	Bacteria	3441
294	Ga0209968_1004232	3300027526	Bacteria	2156
295	Ga0209970_1002001	3300027614	Bacteria	3501
296	Ga0210002_1000793	3300027617	Bacteria	4301
297	Ga0209983_1000004	3300027665	Bacteria	26935
298	Ga0209971_1000515	3300027682	Bacteria	10204
299	Ga0209971_1001125	3300027682	Bacteria	6782
300	Ga0209971_1006035	3300027682	Bacteria	2871
301	Ga0209998_10002408	3300027717	Bacteria	4296
302	Ga0209974_10000094	3300027876	Bacteria	24930
303	Ga0209974_10001540	3300027876	Bacteria	8372
304	Ga0207428_10028315	3300027907	Bacteria	4656
305	Ga0207428_10042104	3300027907	Bacteria	3694
306	Ga0207428_10044842	3300027907	Bacteria	3565
307	Ga0207428_10079984	3300027907	Bacteria	2554
308	Ga0207428_10106244	3300027907	Bacteria	2165
309	Ga0268266_10011258	3300028379	Bacteria	7786
310	Ga0268266_10033893	3300028379	Bacteria	4340
311	Ga0268266_10138556	3300028379	Bacteria	2182
312	Ga0268265_10068319	3300028380	Bacteria	2755
313	Ga0268264_10007951	3300028381	Bacteria	8824
314	Ga0265337_1001252	3300028556	Bacteria	12795
315	Ga0265326_10001074	3300028558	Bacteria	9741
316	Ga0265319_1000100	3300028563	Bacteria	66728
317	Ga0265319_1000169	3300028563	Bacteria	49406
318	Ga0265334_10001411	3300028573	Bacteria	11555
319	Ga0265334_10003087	3300028573	Bacteria	7610
320	Ga0265318_10001487	3300028577	Bacteria	13701
321	Ga0265318_10021431	3300028577	Bacteria	2594
322	Ga0265323_10000218	3300028653	Bacteria	33811
323	Ga0265322_10000549	3300028654	Bacteria	14431
324	Ga0265322_10002031	3300028654	Bacteria	6379
325	Ga0265336_10000115	3300028666	Bacteria	59960
326	Ga0265338_10001654	3300028800	Bacteria	35526
327	Ga0265338_10005397	3300028800	Bacteria	16701
328	Ga0265338_10005519	3300028800	Bacteria	16487
329	Ga0265338_10005708	3300028800	Bacteria	16097
330	Ga0265324_10001167	3300029957	Bacteria	15643
331	Ga0265324_10040149	3300029957	Bacteria	1622
332	Ga0265762_1001640	3300030760	Bacteria	4074
333	Ga0265330_10000319	3300031235	Bacteria	34472
334	Ga0265330_10000781	3300031235	Bacteria	20009
335	Ga0265332_10000382	3300031238	Bacteria	32426
336	Ga0265328_10006143	3300031239	Bacteria	5109
337	Ga0265320_10002134	3300031240	Bacteria	13874
338	Ga0265325_10000781	3300031241	Bacteria	23042
339	Ga0265325_10001352	3300031241	Bacteria	17364
340	Ga0265325_10004251	3300031241	Bacteria	9088
341	Ga0265325_10015601	3300031241	Bacteria	4268
342	Ga0265329_10000073	3300031242	Bacteria	44995
343	Ga0265340_10004960	3300031247	Bacteria	7398
344	Ga0265339_10000297	3300031249	Bacteria	40447
345	Ga0265339_10000581	3300031249	Bacteria	28517
346	Ga0265339_10006344	3300031249	Bacteria	7772
347	Ga0265331_10000963	3300031250	Bacteria	22892
348	Ga0265316_10000247	3300031344	Bacteria	62442
349	Ga0265316_10000717	3300031344	Bacteria	36575
350	Ga0265316_10012465	3300031344	Bacteria	7622
351	Ga0265313_10000580	3300031595	Bacteria	38083
352	Ga0265314_10000285	3300031711	Bacteria	73539
353	Ga0265342_10000764	3300031712	Bacteria	32819
354	Ga0265342_10002715	3300031712	Bacteria	15069
355	Ga0265342_10007035	3300031712	Bacteria	8296
356	Ga0307405_10006122	3300031731	Bacteria	5890
357	Ga0307413_10017150	3300031824	Bacteria	3765
358	Ga0307413_10017691	3300031824	Bacteria	3719
359	Ga0307410_10020984	3300031852	Bacteria	4010
360	Ga0307412_10057057	3300031911	Bacteria	2605
361	Ga0307409_100002917	3300031995	Bacteria	9085
362	Ga0307409_100018552	3300031995	Bacteria	4682
363	Ga0307416_100005250	3300032002	Bacteria	7925
364	Ga0307416_100019470	3300032002	Bacteria	4813
365	Ga0307416_100074905	3300032002	Bacteria	2830
366	Ga0307411_10100212	3300032005	Bacteria	2046
367	Ga0316053_100112	3300032120	Bacteria	2736
368	Ga0373936_0001853	3300035113	Bacteria	7795
369	Ga0373945_0001941	3300035116	Bacteria	6419
370	Ga0373946_0055007	3300035171	Bacteria	1677
371	Ga0373924_0000274	3300035410	Bacteria	15809
372	Ga0373935_0013036	3300035692	Bacteria	5012
373	Ga0373927_0100317	3300035695	Bacteria	1883
374	Ga0373927_0106028	3300035695	Bacteria	1830
375	Ga0373947_0016165	3300035725	Bacteria	4288
376	Ga0373947_0042678	3300035725	Bacteria	2707
377	Ga0373947_0071392	3300035725	Bacteria	2129
378	Ga0373937_0001803	3300036401	Bacteria	17999
379	Ga0373937_0051926	3300036401	Bacteria	3758
380	Ga0373925_0012924	3300037068	Bacteria	6047
381	Ga0373925_0061644	3300037068	Bacteria	2817
382	Ga0373925_0095612	3300037068	Bacteria	2276
383	Ga0395898_0269079	3300037466	Bacteria	1625
384	Ga0451577_0074164	3300042876	Bacteria	3035
385	Ga0453683_0002927	3300044673	Bacteria	12871
386	Ga0453683_0003894	3300044673	Bacteria	10818
387	Ga0466963_0005380	3300044694	Bacteria	7494
388	Ga0453684_0196586	3300044712	Bacteria	2354
389	Ga0451576_0306447	3300045051	Bacteria	1661
390	Ga0495580_0026710	3300046472	Bacteria	4205
391	Ga0495580_0040014	3300046472	Bacteria	3352
392	Ga0495580_0117685	3300046472	Bacteria	1845
393	Ga0495580_0206862	3300046472	Bacteria	1351
394	Ga0495582_0030746	3300046473	Bacteria	2949
395	Ga0495628_0109024	3300046516	Bacteria	2131
396	Ga0495665_0049995	3300046531	Bacteria	2216
397	Ga0495647_0003237	3300046681	Bacteria	5210
398	Ga0495658_0047170	3300046683	Bacteria	2425
399	Ga0495669_0025563	3300046684	Bacteria	2575
400	Ga0495581_0062074	3300047315	Bacteria	2159
401	Ga0496104_0040183	3300048907	Bacteria	4384
402	Ga0496104_0154310	3300048907	Bacteria	2204
403	Ga0496105_0001295	3300048908	Bacteria	17503
404	Ga0496109_0129584	3300048912	Bacteria	2354
405	Ga0496112_0117369	3300048915	Bacteria	2631
406	Ga0496112_0157396	3300048915	Bacteria	2239
407	Ga0496115_0015243	3300048918	Bacteria	5827
408	Ga0496124_0125462	3300048927	Bacteria	2046
409	Ga0495682_0000299	3300049460	Bacteria	37573
410	Ga0501031_0042352	3300049568	Bacteria	2972
411	Ga0501032_0071262	3300049569	Bacteria	2316
412	Ga0501033_0014572	3300049570	Bacteria	5969
413	Ga0501033_0017684	3300049570	Bacteria	5384
414	Ga0501036_0035786	3300049572	Bacteria	4201
415	Ga0501036_0091992	3300049572	Bacteria	2562
416	Ga0501037_0036340	3300049573	Bacteria	3630
417	Ga0501037_0071646	3300049573	Bacteria	2521
418	Ga0501038_0029484	3300049574	Bacteria	4861
419	Ga0501039_0000803	3300049575	Bacteria	22634
420	Ga0501039_0009856	3300049575	Bacteria	7285
421	Ga0501040_0001648	3300049576	Bacteria	14254
422	Ga0501040_0005436	3300049576	Bacteria	8244
423	Ga0501040_0026058	3300049576	Bacteria	3933
424	Ga0501041_0000471	3300049577	Bacteria	20456
425	Ga0501041_0028920	3300049577	Bacteria	3343
426	Ga0501042_0005763	3300049578	Bacteria	8002
427	Ga0501042_0049577	3300049578	Bacteria	2995
428	Ga0501043_0014099	3300049579	Bacteria	6254
429	Ga0501046_0004662	3300049580	Bacteria	12380
430	Ga0501046_0023220	3300049580	Bacteria	5104
431	Ga0501046_0090276	3300049580	Bacteria	2357
432	Ga0501048_0004857	3300049582	Bacteria	10249
433	Ga0501048_0010810	3300049582	Bacteria	6805
434	Ga0501071_0015388	3300049587	Bacteria	5251
435	Ga0501071_0028762	3300049587	Bacteria	3918
436	Ga0501072_0002815	3300049588	Bacteria	13054
437	Ga0501072_0003218	3300049588	Bacteria	12254
438	Ga0501073_0034453	3300049589	Bacteria	3603
439	Ga0501074_0014070	3300049590	Bacteria	5817
440	Ga0501075_0002513	3300049591	Bacteria	12228
441	Ga0501075_0026249	3300049591	Bacteria	4285
442	Ga0501075_0034017	3300049591	Bacteria	3793
443	Ga0501076_0002920	3300049592	Bacteria	11849
444	Ga0501076_0003383	3300049592	Bacteria	11202
445	Ga0501076_0020381	3300049592	Bacteria	5076
446	Ga0501076_0103754	3300049592	Bacteria	2294
447	Ga0501076_0144489	3300049592	Bacteria	1934
448	Ga0501077_0000169	3300049593	Bacteria	37313
449	Ga0501077_0001537	3300049593	Bacteria	13910
450	Ga0501077_0006747	3300049593	Bacteria	7065
451	Ga0501077_0085062	3300049593	Bacteria	2005
452	Ga0501249_003600	3300049679	Bacteria	3117
453	Ga0501079_0003480	3300049741	Bacteria	11573
454	Ga0501079_0005169	3300049741	Bacteria	9700
455	Ga0501079_0038535	3300049741	Bacteria	3686
456	Ga0501080_0088785	3300049742	Bacteria	2871
457	Ga0501080_0282979	3300049742	Bacteria	1507
458	Ga0501081_0000045	3300049743	Bacteria	47062
459	Ga0501081_0009144	3300049743	Bacteria	6448
460	Ga0501081_0012373	3300049743	Bacteria	5605
461	Ga0501081_0096469	3300049743	Bacteria	2085
462	Ga0501081_0113680	3300049743	Bacteria	1923
463	Ga0501083_0051483	3300049744	Bacteria	2769
464	Ga0501035_0031658	3300049822	Bacteria	4817
465	Ga0501044_0024720	3300049823	Bacteria	6372
466	Ga0501044_0041090	3300049823	Bacteria	4815
467	nmdc:mga05p37_110605_c1	3300050507	Bacteria	3379
468	nmdc:mga05p37_138663_c1	3300050507	Bacteria	2981
469	nmdc:mga05p37_222892_c1	3300050507	Bacteria	2275
470	nmdc:mga05p37_23759_c1	3300050507	Bacteria	7443
471	nmdc:mga05p37_248151_c1	3300050507	Bacteria	2137
472	nmdc:mga05p37_25995_c1	3300050507	Bacteria	7116
473	nmdc:mga05p37_268214_c1	3300050507	Bacteria	2041
474	nmdc:mga05p37_29506_c1	3300050507	Bacteria	6692
475	nmdc:mga05p37_47059_c2	3300050507	Bacteria	3779
476	nmdc:mga05p37_5019_c1	3300050507	Bacteria	15514
477	nmdc:mga05p37_556_c1	3300050507	Bacteria	41090
478	nmdc:mga05p37_84223_c1	3300050507	Bacteria	3917
479	nmdc:mga09592_12776_c1	3300050508	Bacteria	6844
480	nmdc:mga09592_35539_c1	3300050508	Bacteria	4172
481	nmdc:mga09592_39406_c1	3300050508	Bacteria	3969
482	nmdc:mga09592_4423_c1	3300050508	Bacteria	11379
483	nmdc:mga09592_74934_c1	3300050508	Bacteria	2877
484	nmdc:mga0qj67_39206_c1	3300050509	Bacteria	3719
485	nmdc:mga06r32_11808_c1	3300050510	Bacteria	7866
486	nmdc:mga06r32_130630_c1	3300050510	Bacteria	2484
487	nmdc:mga06r32_21772_c1	3300050510	Bacteria	5918
488	nmdc:mga06r32_38135_c1	3300050510	Bacteria	4550
489	nmdc:mga06r32_96386_c1	3300050510	Bacteria	2897
490	nmdc:mga08y16_114623_c1	3300050511	Bacteria	2806
491	nmdc:mga08y16_51731_c1	3300050511	Bacteria	4299
492	nmdc:mga08y16_7005_c1	3300050511	Bacteria	11821
493	nmdc:mga08y16_72181_c1	3300050511	Bacteria	3597
494	nmdc:mga08y16_965_c1	3300050511	Bacteria	27990
495	nmdc:mga0n895_1092_c1	3300050512	Bacteria	19820
496	nmdc:mga0n895_11291_c1	3300050512	Bacteria	7960
497	nmdc:mga0n895_113119_c1	3300050512	Bacteria	2732
498	nmdc:mga0n895_128822_c1	3300050512	Bacteria	2555
499	nmdc:mga0n895_13233_c1	3300050512	Bacteria	7435
500	nmdc:mga0n895_13518_c1	3300050512	Bacteria	7370
501	nmdc:mga0n895_16332_c1	3300050512	Bacteria	6808
502	nmdc:mga0n895_17582_c1	3300050512	Bacteria	6595
503	nmdc:mga0n895_19859_c1	3300050512	Bacteria	6254
504	nmdc:mga0n895_3735_c2	3300050512	Bacteria	4363
505	nmdc:mga0n895_38141_c1	3300050512	Bacteria	4654
506	nmdc:mga0n895_4508_c1	3300050512	Bacteria	11453
507	nmdc:mga0n895_80448_c1	3300050512	Bacteria	3247
508	nmdc:mga0rr50_106620_c1	3300050513	Bacteria	2211
509	nmdc:mga0rr50_114380_c1	3300050513	Bacteria	2140
510	nmdc:mga0rr50_138929_c1	3300050513	Bacteria	1953
511	nmdc:mga0rr50_27618_c1	3300050513	Bacteria	3977
512	nmdc:mga0rr50_3441_c1	3300050513	Bacteria	9110
513	nmdc:mga0rr50_4461_c1	3300050513	Bacteria	8238
514	nmdc:mga0rr50_79207_c1	3300050513	Bacteria	2530
515	nmdc:mga0rr50_81649_c1	3300050513	Bacteria	2495
516	nmdc:mga08x19_126993_c1	3300050514	Bacteria	1713
517	nmdc:mga08x19_3198_c1	3300050514	Bacteria	9822
518	nmdc:mga08x19_4092_c1	3300050514	Bacteria	8653
519	nmdc:mga08x19_51900_c1	3300050514	Bacteria	2636
520	nmdc:mga08x19_73098_c1	3300050514	Bacteria	2238
521	nmdc:mga0a205_105033_c1	3300050515	Bacteria	2724
522	nmdc:mga0a205_12447_c1	3300050515	Bacteria	7870
523	nmdc:mga0a205_133483_c1	3300050515	Bacteria	2383
524	nmdc:mga0a205_14068_c1	3300050515	Bacteria	7466
525	nmdc:mga0a205_153724_c1	3300050515	Bacteria	2200
526	nmdc:mga0a205_163561_c1	3300050515	Bacteria	2121
527	nmdc:mga0a205_193265_c1	3300050515	Bacteria	1927
528	nmdc:mga0a205_22_c1	3300050515	Bacteria	88689
529	nmdc:mga0a205_2306_c1	3300050515	Bacteria	16848
530	nmdc:mga0a205_28193_c1	3300050515	Bacteria	5368
531	nmdc:mga0a205_30807_c1	3300050515	Bacteria	5138
532	nmdc:mga0a205_42082_c1	3300050515	Bacteria	4401
533	nmdc:mga0a205_59676_c1	3300050515	Bacteria	3685
534	nmdc:mga0a205_75893_c1	3300050515	Bacteria	3248
535	nmdc:mga0a205_77349_c1	3300050515	Bacteria	3215
536	nmdc:mga0a205_8475_c1	3300050515	Bacteria	9355
537	Ga0495601_0033077	3300053077	Bacteria	3221
538	Ga0501084_0010018	3300054114	Bacteria	7830
539	Ga0590071_010648	3300059421	Bacteria	2151
540	Ga0587088_002624	3300059508	Bacteria	2076
541	Ga0587128_001823	3300059630	Bacteria	2101
542	Ga0501082_0011956	3300060353	Bacteria	7464
543	Ga0501082_0039065	3300060353	Bacteria	4094
544	Ga0530510_0002338	3300061734	Bacteria	13016
545	Ga0530510_0023450	3300061734	Bacteria	4397
546	Ga0530510_0029938	3300061734	Bacteria	3908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300046472	Ga0495580_0206862	Ga0495580_0206862_56_1312	418
2	3300049742	Ga0501080_0282979	Ga0501080_0282979_178_1434	418
3	3300059508	Ga0587088_002624	Ga0587088_002624_97_1368	422
4	3300050513	nmdc:mga0rr50_138929_c1	nmdc:mga0rr50_138929_c1_499_1848	449
5	3300049679	Ga0501249_003600	Ga0501249_003600_1220_2584	454
6	3300049580	Ga0501046_0004662	Ga0501046_0004662_1162_2574	459
7	3300005563	Ga0068855_100148868	Ga0068855_1001488684	461
8	3300009551	Ga0105238_10089697	Ga0105238_100896974	461
9	3300013105	Ga0157369_10022318	Ga0157369_100223184	461
10	3300020069	Ga0197907_10275585	Ga0197907_102755852	461
11	3300025913	Ga0207695_10071393	Ga0207695_100713934	461
12	3300025949	Ga0207667_10103674	Ga0207667_101036744	461
13	3300035116	Ga0373945_0001941	Ga0373945_0001941_719_2176	461
14	3300035410	Ga0373924_0000274	Ga0373924_0000274_8254_9711	461
15	3300036401	Ga0373937_0001803	Ga0373937_0001803_16431_17888	461
16	3300005546	Ga0070696_100086991	Ga0070696_1000869912	462
17	3300009098	Ga0105245_10010341	Ga0105245_100103414	462
18	3300013297	Ga0157378_10079293	Ga0157378_100792933	462
19	3300025927	Ga0207687_10000753	Ga0207687_1000075313	462
20	3300025916	Ga0207663_10001864	Ga0207663_100018644	463
21	3300006028	Ga0070717_10022599	Ga0070717_100225994	466
22	3300006175	Ga0070712_100027555	Ga0070712_1000275554	466
23	3300025928	Ga0207700_10003376	Ga0207700_100033765	466
24	3300025939	Ga0207665_10021722	Ga0207665_100217224	466
25	3300048908	Ga0496105_0001295	Ga0496105_0001295_5009_6466	466
26	3300059630	Ga0587128_001823	Ga0587128_001823_105_1562	466
27	3300005471	Ga0070698_100131128	Ga0070698_1001311282	467
28	3300006028	Ga0070717_10003519	Ga0070717_100035197	467
29	3300037068	Ga0373925_0012924	Ga0373925_0012924_1405_2853	469
30	3300046681	Ga0495647_0003237	Ga0495647_0003237_717_2165	470
31	3300044694	Ga0466963_0005380	Ga0466963_0005380_3487_4941	471
32	3300006852	Ga0075433_10270313	Ga0075433_102703131	472
33	3300036401	Ga0373937_0051926	Ga0373937_0051926_1690_3147	472
34	3300037068	Ga0373925_0095612	Ga0373925_0095612_423_1880	472
35	3300050507	nmdc:mga05p37_138663_c1	nmdc:mga05p37_138663_c1_266_1726	472
36	3300050508	nmdc:mga09592_35539_c1	nmdc:mga09592_35539_c1_2447_3907	472
37	3300050512	nmdc:mga0n895_80448_c1	nmdc:mga0n895_80448_c1_109_1569	472
38	3300050515	nmdc:mga0a205_59676_c1	nmdc:mga0a205_59676_c1_639_2099	472
39	3300049823	Ga0501044_0041090	Ga0501044_0041090_1335_2759	474
40	3300005444	Ga0070694_100034834	Ga0070694_1000348345	475
41	3300005545	Ga0070695_100004622	Ga0070695_1000046222	475
42	3300028800	Ga0265338_10001654	Ga0265338_1000165438	475
43	3300005545	Ga0070695_100016786	Ga0070695_1000167864	477
44	3300006844	Ga0075428_100191562	Ga0075428_1001915622	478
45	3300028556	Ga0265337_1001252	Ga0265337_10012524	478
46	3300028558	Ga0265326_10001074	Ga0265326_100010748	478
47	3300028563	Ga0265319_1000100	Ga0265319_100010029	478
48	3300028563	Ga0265319_1000169	Ga0265319_100016934	478
49	3300028573	Ga0265334_10001411	Ga0265334_100014114	478
50	3300028577	Ga0265318_10001487	Ga0265318_100014874	478
51	3300028577	Ga0265318_10021431	Ga0265318_100214312	478
52	3300028653	Ga0265323_10000218	Ga0265323_1000021823	478
53	3300028654	Ga0265322_10000549	Ga0265322_100005495	478
54	3300028654	Ga0265322_10002031	Ga0265322_100020314	478
55	3300028666	Ga0265336_10000115	Ga0265336_1000011538	478
56	3300028800	Ga0265338_10005397	Ga0265338_1000539713	478
57	3300028800	Ga0265338_10005519	Ga0265338_100055198	478
58	3300028800	Ga0265338_10005708	Ga0265338_100057087	478
59	3300029957	Ga0265324_10001167	Ga0265324_100011676	478
60	3300029957	Ga0265324_10040149	Ga0265324_100401491	478
61	3300031235	Ga0265330_10000319	Ga0265330_1000031920	478
62	3300031238	Ga0265332_10000382	Ga0265332_100003829	478
63	3300031239	Ga0265328_10006143	Ga0265328_100061436	478
64	3300031240	Ga0265320_10002134	Ga0265320_100021349	478
65	3300031241	Ga0265325_10004251	Ga0265325_100042515	478
66	3300031241	Ga0265325_10015601	Ga0265325_100156014	478
67	3300031242	Ga0265329_10000073	Ga0265329_100000736	478
68	3300031247	Ga0265340_10004960	Ga0265340_100049604	478
69	3300031249	Ga0265339_10000297	Ga0265339_100002975	478
70	3300031250	Ga0265331_10000963	Ga0265331_1000096326	478
71	3300031344	Ga0265316_10000247	Ga0265316_1000024720	478
72	3300031595	Ga0265313_10000580	Ga0265313_1000058040	478
73	3300031711	Ga0265314_10000285	Ga0265314_1000028544	478
74	3300031712	Ga0265342_10000764	Ga0265342_1000076419	478
75	3300031712	Ga0265342_10002715	Ga0265342_1000271515	478
76	3300005444	Ga0070694_100000001	Ga0070694_100000001132	479
77	3300005843	Ga0068860_100021308	Ga0068860_1000213085	479
78	3300006852	Ga0075433_10001794	Ga0075433_100017946	479
79	3300006852	Ga0075433_10015607	Ga0075433_100156074	479
80	3300027526	Ga0209968_1001585	Ga0209968_10015852	479
81	3300027614	Ga0209970_1002001	Ga0209970_10020013	479
82	3300027665	Ga0209983_1000004	Ga0209983_10000044	479
83	3300027682	Ga0209971_1000515	Ga0209971_10005152	479
84	3300027717	Ga0209998_10002408	Ga0209998_100024083	479
85	3300027876	Ga0209974_10001540	Ga0209974_100015407	479
86	3300028381	Ga0268264_10007951	Ga0268264_100079518	479
87	3300044673	Ga0453683_0002927	Ga0453683_0002927_4121_5560	479
88	3300050515	nmdc:mga0a205_8475_c1	nmdc:mga0a205_8475_c1_2817_4256	479
89	3300005467	Ga0070706_100000656	Ga0070706_1000006564	480
90	3300005468	Ga0070707_100002550	Ga0070707_1000025504	480
91	3300005536	Ga0070697_100024249	Ga0070697_1000242494	480
92	3300005617	Ga0068859_100005263	Ga0068859_10000526311	480
93	3300006844	Ga0075428_100001950	Ga0075428_10000195015	480
94	3300006844	Ga0075428_100070055	Ga0075428_1000700554	480
95	3300006880	Ga0075429_100000616	Ga0075429_10000061613	480
96	3300006931	Ga0097620_100005263	Ga0097620_10000526311	480
97	3300028380	Ga0268265_10068319	Ga0268265_100683192	480
98	3300050507	nmdc:mga05p37_5019_c1	nmdc:mga05p37_5019_c1_13203_14663	480
99	3300050515	nmdc:mga0a205_75893_c1	nmdc:mga0a205_75893_c1_524_1966	480
100	3300005293	Ga0065715_10103901	Ga0065715_101039013	481
101	3300005334	Ga0068869_100020226	Ga0068869_1000202262	481
102	3300005518	Ga0070699_100000005	Ga0070699_100000005263	481
103	3300006852	Ga0075433_10000284	Ga0075433_1000028423	481
104	3300006852	Ga0075433_10001441	Ga0075433_1000144117	481
105	3300006871	Ga0075434_100007563	Ga0075434_1000075634	481
106	3300006871	Ga0075434_100011505	Ga0075434_1000115054	481
107	3300007076	Ga0075435_100011509	Ga0075435_1000115093	481
108	3300009147	Ga0114129_10017177	Ga0114129_100171773	481
109	3300025910	Ga0207684_10000700	Ga0207684_100007004	481
110	3300025933	Ga0207706_10095145	Ga0207706_100951452	481
111	3300028573	Ga0265334_10003087	Ga0265334_100030875	481
112	3300046516	Ga0495628_0109024	Ga0495628_0109024_84_1529	481
113	3300049573	Ga0501037_0071646	Ga0501037_0071646_916_2361	481
114	3300049575	Ga0501039_0000803	Ga0501039_0000803_20618_22063	481
115	3300049576	Ga0501040_0005436	Ga0501040_0005436_6213_7658	481
116	3300049577	Ga0501041_0028920	Ga0501041_0028920_668_2113	481
117	3300049578	Ga0501042_0005763	Ga0501042_0005763_1447_2892	481
118	3300049582	Ga0501048_0004857	Ga0501048_0004857_7403_8848	481
119	3300049587	Ga0501071_0028762	Ga0501071_0028762_796_2241	481
120	3300049588	Ga0501072_0003218	Ga0501072_0003218_518_1963	481
121	3300049590	Ga0501074_0014070	Ga0501074_0014070_3691_5136	481
122	3300049591	Ga0501075_0034017	Ga0501075_0034017_439_1884	481
123	3300049592	Ga0501076_0002920	Ga0501076_0002920_510_1955	481
124	3300049593	Ga0501077_0001537	Ga0501077_0001537_7706_9151	481
125	3300049741	Ga0501079_0005169	Ga0501079_0005169_697_2142	481
126	3300049743	Ga0501081_0009144	Ga0501081_0009144_4312_5757	481
127	3300050507	nmdc:mga05p37_110605_c1	nmdc:mga05p37_110605_c1_738_2183	481
128	3300050507	nmdc:mga05p37_29506_c1	nmdc:mga05p37_29506_c1_4130_5575	481
129	3300050507	nmdc:mga05p37_47059_c2	nmdc:mga05p37_47059_c2_2279_3724	481
130	3300050512	nmdc:mga0n895_11291_c1	nmdc:mga0n895_11291_c1_964_2409	481
131	3300050512	nmdc:mga0n895_13518_c1	nmdc:mga0n895_13518_c1_3536_4981	481
132	3300050513	nmdc:mga0rr50_79207_c1	nmdc:mga0rr50_79207_c1_711_2156	481
133	3300050515	nmdc:mga0a205_14068_c1	nmdc:mga0a205_14068_c1_3282_4727	481
134	3300050515	nmdc:mga0a205_2306_c1	nmdc:mga0a205_2306_c1_9436_10881	481
135	3300053077	Ga0495601_0033077	Ga0495601_0033077_472_1917	481
136	3300054114	Ga0501084_0010018	Ga0501084_0010018_5873_7318	481
137	3300061734	Ga0530510_0002338	Ga0530510_0002338_5271_6716	481
138	3300061734	Ga0530510_0023450	Ga0530510_0023450_2914_4359	481
139	3300005458	Ga0070681_10161417	Ga0070681_101614171	482
140	3300005468	Ga0070707_100002436	Ga0070707_1000024369	482
141	3300005471	Ga0070698_100003585	Ga0070698_1000035859	482
142	3300005518	Ga0070699_100093486	Ga0070699_1000934862	482
143	3300005536	Ga0070697_100008441	Ga0070697_1000084418	482
144	3300005563	Ga0068855_100011235	Ga0068855_1000112358	482
145	3300005617	Ga0068859_100069667	Ga0068859_1000696672	482
146	3300006237	Ga0097621_100025876	Ga0097621_1000258766	482
147	3300006844	Ga0075428_100010610	Ga0075428_1000106108	482
148	3300006844	Ga0075428_100051034	Ga0075428_1000510343	482
149	3300006844	Ga0075428_100188548	Ga0075428_1001885482	482
150	3300006852	Ga0075433_10017048	Ga0075433_100170484	482
151	3300006852	Ga0075433_10102678	Ga0075433_101026783	482
152	3300006871	Ga0075434_100066492	Ga0075434_1000664922	482
153	3300006880	Ga0075429_100018924	Ga0075429_1000189243	482
154	3300006931	Ga0097620_100069668	Ga0097620_1000696682	482
155	3300009094	Ga0111539_10072248	Ga0111539_100722483	482
156	3300009147	Ga0114129_10020673	Ga0114129_100206736	482
157	3300013296	Ga0157374_10096844	Ga0157374_100968443	482
158	3300020070	Ga0206356_11374921	Ga0206356_113749211	482
159	3300020075	Ga0206349_1697191	Ga0206349_16971911	482
160	3300020077	Ga0206351_10817426	Ga0206351_108174261	482
161	3300020080	Ga0206350_10939692	Ga0206350_109396921	482
162	3300020082	Ga0206353_10459664	Ga0206353_104596642	482
163	3300021388	Ga0213875_10005602	Ga0213875_100056026	482
164	3300022467	Ga0224712_10001025	Ga0224712_100010251	482
165	3300025910	Ga0207684_10003831	Ga0207684_100038316	482
166	3300025910	Ga0207684_10012833	Ga0207684_100128332	482
167	3300025910	Ga0207684_10067581	Ga0207684_100675811	482
168	3300025922	Ga0207646_10010268	Ga0207646_100102684	482
169	3300025949	Ga0207667_10101576	Ga0207667_101015762	482
170	3300025961	Ga0207712_10051389	Ga0207712_100513891	482
171	3300027907	Ga0207428_10042104	Ga0207428_100421043	482
172	3300035171	Ga0373946_0055007	Ga0373946_0055007_17_1465	482
173	3300035725	Ga0373947_0071392	Ga0373947_0071392_160_1608	482
174	3300048918	Ga0496115_0015243	Ga0496115_0015243_4038_5486	482
175	3300049460	Ga0495682_0000299	Ga0495682_0000299_18139_19587	482
176	3300050507	nmdc:mga05p37_25995_c1	nmdc:mga05p37_25995_c1_2509_3972	482
177	3300050508	nmdc:mga09592_39406_c1	nmdc:mga09592_39406_c1_1729_3177	482
178	3300050508	nmdc:mga09592_4423_c1	nmdc:mga09592_4423_c1_3135_4598	482
179	3300050510	nmdc:mga06r32_11808_c1	nmdc:mga06r32_11808_c1_285_1733	482
180	3300050511	nmdc:mga08y16_965_c1	nmdc:mga08y16_965_c1_6510_7958	482
181	3300050513	nmdc:mga0rr50_4461_c1	nmdc:mga0rr50_4461_c1_1316_2764	482
182	3300050515	nmdc:mga0a205_30807_c1	nmdc:mga0a205_30807_c1_3340_4788	482
183	3300005937	Ga0081455_10056661	Ga0081455_100566612	483
184	3300005981	Ga0081538_10004248	Ga0081538_100042482	483
185	3300005981	Ga0081538_10033293	Ga0081538_100332931	483
186	3300050511	nmdc:mga08y16_7005_c1	nmdc:mga08y16_7005_c1_8243_9694	483
187	3300004799	Ga0058863_10127816	Ga0058863_101278162	484
188	3300004803	Ga0058862_10034373	Ga0058862_100343732	484
189	3300005336	Ga0070680_100034481	Ga0070680_1000344812	484
190	3300005458	Ga0070681_10003073	Ga0070681_100030732	484
191	3300005458	Ga0070681_10146440	Ga0070681_101464402	484
192	3300005530	Ga0070679_100017081	Ga0070679_1000170816	484
193	3300005530	Ga0070679_100154346	Ga0070679_1001543462	484
194	3300005563	Ga0068855_100110028	Ga0068855_1001100282	484
195	3300005983	Ga0081540_1044596	Ga0081540_10445962	484
196	3300013104	Ga0157370_10024890	Ga0157370_100248905	484
197	3300013105	Ga0157369_10043764	Ga0157369_100437643	484
198	3300013297	Ga0157378_10011518	Ga0157378_100115182	484
199	3300020069	Ga0197907_11219713	Ga0197907_112197132	484
200	3300020070	Ga0206356_11419372	Ga0206356_114193721	484
201	3300020077	Ga0206351_10096246	Ga0206351_100962461	484
202	3300020080	Ga0206350_10319129	Ga0206350_103191292	484
203	3300020080	Ga0206350_10424972	Ga0206350_104249722	484
204	3300022467	Ga0224712_10002257	Ga0224712_100022572	484
205	3300025912	Ga0207707_10009842	Ga0207707_100098424	484
206	3300025917	Ga0207660_10000046	Ga0207660_1000004610	484
207	3300025921	Ga0207652_10181386	Ga0207652_101813862	484
208	3300031731	Ga0307405_10006122	Ga0307405_100061223	484
209	3300031824	Ga0307413_10017691	Ga0307413_100176913	484
210	3300031995	Ga0307409_100018552	Ga0307409_1000185526	484
211	3300032002	Ga0307416_100005250	Ga0307416_1000052504	484
212	3300032002	Ga0307416_100074905	Ga0307416_1000749054	484
213	3300032005	Ga0307411_10100212	Ga0307411_101002121	484
214	3300037466	Ga0395898_0269079	Ga0395898_0269079_126_1580	484
215	3300049591	Ga0501075_0026249	Ga0501075_0026249_187_1641	484
216	3300049592	Ga0501076_0020381	Ga0501076_0020381_1770_3224	484
217	3300049743	Ga0501081_0012373	Ga0501081_0012373_1773_3227	484
218	3300060353	Ga0501082_0039065	Ga0501082_0039065_425_1879	484
219	3300005288	Ga0065714_10097707	Ga0065714_100977071	485
220	3300005331	Ga0070670_100001082	Ga0070670_10000108219	485
221	3300005331	Ga0070670_100040121	Ga0070670_1000401215	485
222	3300005340	Ga0070689_100059548	Ga0070689_1000595483	485
223	3300005347	Ga0070668_100087964	Ga0070668_1000879643	485
224	3300005354	Ga0070675_100110149	Ga0070675_1001101492	485
225	3300005356	Ga0070674_100056673	Ga0070674_1000566732	485
226	3300005365	Ga0070688_100134806	Ga0070688_1001348061	485
227	3300005366	Ga0070659_100158209	Ga0070659_1001582091	485
228	3300005434	Ga0070709_10000021	Ga0070709_1000002173	485
229	3300005436	Ga0070713_100041843	Ga0070713_1000418433	485
230	3300005436	Ga0070713_100043773	Ga0070713_1000437734	485
231	3300005439	Ga0070711_100000544	Ga0070711_1000005449	485
232	3300005440	Ga0070705_100098183	Ga0070705_1000981831	485
233	3300005445	Ga0070708_100002626	Ga0070708_1000026267	485
234	3300005445	Ga0070708_100084116	Ga0070708_1000841163	485
235	3300005455	Ga0070663_100148149	Ga0070663_1001481491	485
236	3300005456	Ga0070678_100056042	Ga0070678_1000560423	485
237	3300005458	Ga0070681_10024948	Ga0070681_100249483	485
238	3300005467	Ga0070706_100006733	Ga0070706_10000673311	485
239	3300005467	Ga0070706_100040184	Ga0070706_1000401842	485
240	3300005468	Ga0070707_100020683	Ga0070707_1000206835	485
241	3300005468	Ga0070707_100096721	Ga0070707_1000967211	485
242	3300005471	Ga0070698_100002386	Ga0070698_10000238614	485
243	3300005471	Ga0070698_100047290	Ga0070698_1000472904	485
244	3300005530	Ga0070679_100008982	Ga0070679_1000089822	485
245	3300005535	Ga0070684_100051812	Ga0070684_1000518122	485
246	3300005536	Ga0070697_100010794	Ga0070697_1000107949	485
247	3300005536	Ga0070697_100032034	Ga0070697_1000320343	485
248	3300005545	Ga0070695_100019708	Ga0070695_1000197082	485
249	3300005546	Ga0070696_100087994	Ga0070696_1000879942	485
250	3300005547	Ga0070693_100096198	Ga0070693_1000961981	485
251	3300005547	Ga0070693_100101856	Ga0070693_1001018561	485
252	3300005548	Ga0070665_100058284	Ga0070665_1000582843	485
253	3300005549	Ga0070704_100103172	Ga0070704_1001031722	485
254	3300005563	Ga0068855_100083910	Ga0068855_1000839105	485
255	3300005564	Ga0070664_100034205	Ga0070664_1000342052	485
256	3300005616	Ga0068852_100033355	Ga0068852_1000333553	485
257	3300005718	Ga0068866_10037712	Ga0068866_100377121	485
258	3300006028	Ga0070717_10007708	Ga0070717_100077087	485
259	3300006028	Ga0070717_10151306	Ga0070717_101513062	485
260	3300006173	Ga0070716_100069916	Ga0070716_1000699162	485
261	3300006237	Ga0097621_100000105	Ga0097621_10000010533	485
262	3300006844	Ga0075428_100033570	Ga0075428_1000335705	485
263	3300006847	Ga0075431_100017309	Ga0075431_1000173097	485
264	3300006852	Ga0075433_10004331	Ga0075433_100043314	485
265	3300006871	Ga0075434_100005604	Ga0075434_1000056042	485
266	3300006871	Ga0075434_100005943	Ga0075434_1000059435	485
267	3300006871	Ga0075434_100011196	Ga0075434_1000111969	485
268	3300006871	Ga0075434_100070046	Ga0075434_1000700463	485
269	3300006881	Ga0068865_100056969	Ga0068865_1000569694	485
270	3300006914	Ga0075436_100004187	Ga0075436_1000041873	485
271	3300006914	Ga0075436_100009149	Ga0075436_1000091496	485
272	3300006914	Ga0075436_100011722	Ga0075436_1000117223	485
273	3300006914	Ga0075436_100054037	Ga0075436_1000540372	485
274	3300007076	Ga0075435_100005005	Ga0075435_1000050059	485
275	3300009147	Ga0114129_10002610	Ga0114129_1000261017	485
276	3300009147	Ga0114129_10064210	Ga0114129_100642104	485
277	3300009174	Ga0105241_10040013	Ga0105241_100400132	485
278	3300009174	Ga0105241_10140429	Ga0105241_101404291	485
279	3300009176	Ga0105242_10105772	Ga0105242_101057723	485
280	3300009177	Ga0105248_10033406	Ga0105248_100334064	485
281	3300010375	Ga0105239_10269999	Ga0105239_102699992	485
282	3300013105	Ga0157369_10151448	Ga0157369_101514481	485
283	3300013296	Ga0157374_10009945	Ga0157374_100099454	485
284	3300013297	Ga0157378_10000383	Ga0157378_1000038341	485
285	3300013306	Ga0163162_10112731	Ga0163162_101127312	485
286	3300014325	Ga0163163_10151235	Ga0163163_101512352	485
287	3300020080	Ga0206350_10253816	Ga0206350_102538163	485
288	3300024227	Ga0228598_1005971	Ga0228598_10059712	485
289	3300025315	Ga0207697_10014990	Ga0207697_100149904	485
290	3300025898	Ga0207692_10062361	Ga0207692_100623612	485
291	3300025903	Ga0207680_10063243	Ga0207680_100632432	485
292	3300025904	Ga0207647_10038025	Ga0207647_100380253	485
293	3300025906	Ga0207699_10000005	Ga0207699_10000005144	485
294	3300025907	Ga0207645_10028101	Ga0207645_100281012	485
295	3300025910	Ga0207684_10002137	Ga0207684_1000213713	485
296	3300025910	Ga0207684_10026220	Ga0207684_100262203	485
297	3300025911	Ga0207654_10053602	Ga0207654_100536022	485
298	3300025912	Ga0207707_10002951	Ga0207707_100029519	485
299	3300025915	Ga0207693_10013694	Ga0207693_100136944	485
300	3300025916	Ga0207663_10000009	Ga0207663_10000009158	485
301	3300025921	Ga0207652_10001327	Ga0207652_100013274	485
302	3300025922	Ga0207646_10004008	Ga0207646_1000400814	485
303	3300025922	Ga0207646_10083548	Ga0207646_100835482	485
304	3300025925	Ga0207650_10001518	Ga0207650_100015186	485
305	3300025925	Ga0207650_10162108	Ga0207650_101621082	485
306	3300025926	Ga0207659_10091964	Ga0207659_100919641	485
307	3300025928	Ga0207700_10017532	Ga0207700_100175324	485
308	3300025928	Ga0207700_10032004	Ga0207700_100320043	485
309	3300025928	Ga0207700_10062080	Ga0207700_100620802	485
310	3300025929	Ga0207664_10012835	Ga0207664_100128356	485
311	3300025929	Ga0207664_10036549	Ga0207664_100365494	485
312	3300025929	Ga0207664_10076053	Ga0207664_100760532	485
313	3300025939	Ga0207665_10002075	Ga0207665_1000207510	485
314	3300025942	Ga0207689_10061785	Ga0207689_100617852	485
315	3300025944	Ga0207661_10118478	Ga0207661_101184782	485
316	3300025945	Ga0207679_10030947	Ga0207679_100309473	485
317	3300025949	Ga0207667_10163283	Ga0207667_101632832	485
318	3300025972	Ga0207668_10039234	Ga0207668_100392342	485
319	3300025981	Ga0207640_10032671	Ga0207640_100326714	485
320	3300026067	Ga0207678_10103246	Ga0207678_101032461	485
321	3300026089	Ga0207648_10043717	Ga0207648_100437172	485
322	3300026121	Ga0207683_10033616	Ga0207683_100336163	485
323	3300027907	Ga0207428_10044842	Ga0207428_100448422	485
324	3300028379	Ga0268266_10011258	Ga0268266_100112583	485
325	3300028379	Ga0268266_10138556	Ga0268266_101385561	485
326	3300030760	Ga0265762_1001640	Ga0265762_10016403	485
327	3300031235	Ga0265330_10000781	Ga0265330_100007817	485
328	3300031241	Ga0265325_10000781	Ga0265325_100007813	485
329	3300031241	Ga0265325_10001352	Ga0265325_1000135211	485
330	3300031249	Ga0265339_10000581	Ga0265339_1000058123	485
331	3300031249	Ga0265339_10006344	Ga0265339_100063448	485
332	3300031344	Ga0265316_10000717	Ga0265316_1000071733	485
333	3300031344	Ga0265316_10012465	Ga0265316_100124652	485
334	3300031712	Ga0265342_10007035	Ga0265342_100070355	485
335	3300032120	Ga0316053_100112	Ga0316053_1001122	485
336	3300035113	Ga0373936_0001853	Ga0373936_0001853_5980_7437	485
337	3300035725	Ga0373947_0016165	Ga0373947_0016165_2483_3940	485
338	3300037068	Ga0373925_0061644	Ga0373925_0061644_1189_2646	485
339	3300045051	Ga0451576_0306447	Ga0451576_0306447_31_1488	485
340	3300046472	Ga0495580_0026710	Ga0495580_0026710_385_1842	485
341	3300046472	Ga0495580_0040014	Ga0495580_0040014_1023_2480	485
342	3300046473	Ga0495582_0030746	Ga0495582_0030746_86_1543	485
343	3300046531	Ga0495665_0049995	Ga0495665_0049995_189_1646	485
344	3300046684	Ga0495669_0025563	Ga0495669_0025563_925_2382	485
345	3300047315	Ga0495581_0062074	Ga0495581_0062074_459_1916	485
346	3300048907	Ga0496104_0040183	Ga0496104_0040183_2416_3873	485
347	3300048907	Ga0496104_0154310	Ga0496104_0154310_16_1473	485
348	3300048912	Ga0496109_0129584	Ga0496109_0129584_326_1783	485
349	3300048915	Ga0496112_0157396	Ga0496112_0157396_585_2042	485
350	3300048927	Ga0496124_0125462	Ga0496124_0125462_16_1473	485
351	3300050507	nmdc:mga05p37_556_c1	nmdc:mga05p37_556_c1_25751_27208	485
352	3300050507	nmdc:mga05p37_84223_c1	nmdc:mga05p37_84223_c1_832_2289	485
353	3300050509	nmdc:mga0qj67_39206_c1	nmdc:mga0qj67_39206_c1_462_1919	485
354	3300050510	nmdc:mga06r32_96386_c1	nmdc:mga06r32_96386_c1_568_2025	485
355	3300050512	nmdc:mga0n895_128822_c1	nmdc:mga0n895_128822_c1_1072_2529	485
356	3300050512	nmdc:mga0n895_13233_c1	nmdc:mga0n895_13233_c1_1295_2752	485
357	3300050512	nmdc:mga0n895_16332_c1	nmdc:mga0n895_16332_c1_186_1643	485
358	3300050512	nmdc:mga0n895_17582_c1	nmdc:mga0n895_17582_c1_2295_3752	485
359	3300050512	nmdc:mga0n895_19859_c1	nmdc:mga0n895_19859_c1_4352_5809	485
360	3300050512	nmdc:mga0n895_3735_c2	nmdc:mga0n895_3735_c2_968_2425	485
361	3300050512	nmdc:mga0n895_38141_c1	nmdc:mga0n895_38141_c1_3173_4630	485
362	3300050513	nmdc:mga0rr50_106620_c1	nmdc:mga0rr50_106620_c1_574_2031	485
363	3300050513	nmdc:mga0rr50_114380_c1	nmdc:mga0rr50_114380_c1_58_1515	485
364	3300050513	nmdc:mga0rr50_3441_c1	nmdc:mga0rr50_3441_c1_7258_8715	485
365	3300050513	nmdc:mga0rr50_81649_c1	nmdc:mga0rr50_81649_c1_449_1906	485
366	3300050514	nmdc:mga08x19_3198_c1	nmdc:mga08x19_3198_c1_2739_4196	485
367	3300050514	nmdc:mga08x19_4092_c1	nmdc:mga08x19_4092_c1_1006_2463	485
368	3300050514	nmdc:mga08x19_51900_c1	nmdc:mga08x19_51900_c1_710_2167	485
369	3300050514	nmdc:mga08x19_73098_c1	nmdc:mga08x19_73098_c1_115_1572	485
370	3300050515	nmdc:mga0a205_163561_c1	nmdc:mga0a205_163561_c1_184_1641	485
371	3300050515	nmdc:mga0a205_193265_c1	nmdc:mga0a205_193265_c1_302_1759	485
372	3300050515	nmdc:mga0a205_22_c1	nmdc:mga0a205_22_c1_47148_48605	485
373	3300050515	nmdc:mga0a205_28193_c1	nmdc:mga0a205_28193_c1_1156_2613	485
374	3300050515	nmdc:mga0a205_77349_c1	nmdc:mga0a205_77349_c1_239_1696	485
375	3300000041	ARcpr5oldR_c001952	ARcpr5oldR_0019522	486
376	3300000043	ARcpr5yngRDRAFT_c002404	ARcpr5yngRDRAFT_0024042	486
377	3300003911	JGI25405J52794_10002104	JGI25405J52794_100021043	486
378	3300005290	Ga0065712_10000313	Ga0065712_100003132	486
379	3300005290	Ga0065712_10002275	Ga0065712_100022757	486
380	3300005293	Ga0065715_10000451	Ga0065715_100004517	486
381	3300005295	Ga0065707_10001496	Ga0065707_1000149612	486
382	3300005330	Ga0070690_100120619	Ga0070690_1001206192	486
383	3300005331	Ga0070670_100006141	Ga0070670_1000061412	486
384	3300005336	Ga0070680_100077728	Ga0070680_1000777283	486
385	3300005337	Ga0070682_100060000	Ga0070682_1000600002	486
386	3300005356	Ga0070674_100004344	Ga0070674_1000043445	486
387	3300005406	Ga0070703_10001025	Ga0070703_100010257	486
388	3300005440	Ga0070705_100001406	Ga0070705_1000014066	486
389	3300005444	Ga0070694_100013761	Ga0070694_1000137612	486
390	3300005458	Ga0070681_10005645	Ga0070681_100056454	486
391	3300005459	Ga0068867_100179749	Ga0068867_1001797492	486
392	3300005467	Ga0070706_100001700	Ga0070706_10000170026	486
393	3300005467	Ga0070706_100030008	Ga0070706_1000300085	486
394	3300005518	Ga0070699_100000062	Ga0070699_10000006256	486
395	3300005530	Ga0070679_100007026	Ga0070679_1000070265	486
396	3300005539	Ga0068853_100114334	Ga0068853_1001143342	486
397	3300005543	Ga0070672_100095015	Ga0070672_1000950152	486
398	3300005545	Ga0070695_100079551	Ga0070695_1000795512	486
399	3300005546	Ga0070696_100000026	Ga0070696_10000002642	486
400	3300005546	Ga0070696_100026243	Ga0070696_1000262431	486
401	3300005547	Ga0070693_100009470	Ga0070693_1000094703	486
402	3300005548	Ga0070665_100090385	Ga0070665_1000903852	486
403	3300005549	Ga0070704_100030212	Ga0070704_1000302123	486
404	3300005563	Ga0068855_100018035	Ga0068855_1000180356	486
405	3300005564	Ga0070664_100002612	Ga0070664_1000026125	486
406	3300005937	Ga0081455_10000428	Ga0081455_1000042836	486
407	3300005981	Ga0081538_10010829	Ga0081538_100108299	486
408	3300006844	Ga0075428_100002804	Ga0075428_10000280417	486
409	3300006844	Ga0075428_100011361	Ga0075428_1000113618	486
410	3300006844	Ga0075428_100026304	Ga0075428_1000263047	486
411	3300006844	Ga0075428_100142630	Ga0075428_1001426302	486
412	3300006846	Ga0075430_100015804	Ga0075430_1000158042	486
413	3300006847	Ga0075431_100005499	Ga0075431_1000054998	486
414	3300006847	Ga0075431_100017177	Ga0075431_1000171773	486
415	3300006847	Ga0075431_100045140	Ga0075431_1000451402	486
416	3300006852	Ga0075433_10022415	Ga0075433_100224153	486
417	3300006852	Ga0075433_10051318	Ga0075433_100513186	486
418	3300006871	Ga0075434_100007819	Ga0075434_1000078194	486
419	3300006871	Ga0075434_100015358	Ga0075434_1000153585	486
420	3300006871	Ga0075434_100052420	Ga0075434_1000524203	486
421	3300006880	Ga0075429_100029751	Ga0075429_1000297514	486
422	3300006880	Ga0075429_100054600	Ga0075429_1000546003	486
423	3300006880	Ga0075429_100162391	Ga0075429_1001623912	486
424	3300007076	Ga0075435_100053989	Ga0075435_1000539892	486
425	3300007076	Ga0075435_100054961	Ga0075435_1000549612	486
426	3300007076	Ga0075435_100091956	Ga0075435_1000919562	486
427	3300009094	Ga0111539_10004509	Ga0111539_1000450910	486
428	3300009094	Ga0111539_10047173	Ga0111539_100471732	486
429	3300009094	Ga0111539_10063600	Ga0111539_100636002	486
430	3300009147	Ga0114129_10004080	Ga0114129_1000408012	486
431	3300009147	Ga0114129_10013746	Ga0114129_100137462	486
432	3300009147	Ga0114129_10403480	Ga0114129_104034801	486
433	3300009148	Ga0105243_10158760	Ga0105243_101587601	486
434	3300009174	Ga0105241_10043740	Ga0105241_100437403	486
435	3300009176	Ga0105242_10077796	Ga0105242_100777963	486
436	3300009553	Ga0105249_10035009	Ga0105249_100350092	486
437	3300011119	Ga0105246_10009016	Ga0105246_100090163	486
438	3300013100	Ga0157373_10034571	Ga0157373_100345712	486
439	3300013297	Ga0157378_10190453	Ga0157378_101904532	486
440	3300013306	Ga0163162_10028553	Ga0163162_100285535	486
441	3300014969	Ga0157376_10012012	Ga0157376_100120127	486
442	3300025315	Ga0207697_10010525	Ga0207697_100105253	486
443	3300025885	Ga0207653_10000331	Ga0207653_100003317	486
444	3300025901	Ga0207688_10039142	Ga0207688_100391422	486
445	3300025907	Ga0207645_10000928	Ga0207645_1000092814	486
446	3300025910	Ga0207684_10000735	Ga0207684_1000073525	486
447	3300025910	Ga0207684_10025923	Ga0207684_100259233	486
448	3300025912	Ga0207707_10013278	Ga0207707_100132783	486
449	3300025917	Ga0207660_10010890	Ga0207660_100108907	486
450	3300025919	Ga0207657_10004867	Ga0207657_100048677	486
451	3300025922	Ga0207646_10240118	Ga0207646_102401181	486
452	3300025925	Ga0207650_10000709	Ga0207650_1000070919	486
453	3300025933	Ga0207706_10001213	Ga0207706_1000121314	486
454	3300025940	Ga0207691_10019868	Ga0207691_100198685	486
455	3300025942	Ga0207689_10022342	Ga0207689_100223424	486
456	3300025945	Ga0207679_10000936	Ga0207679_1000093612	486
457	3300025961	Ga0207712_10073441	Ga0207712_100734413	486
458	3300026075	Ga0207708_10074963	Ga0207708_100749632	486
459	3300026078	Ga0207702_10045254	Ga0207702_100452543	486
460	3300026089	Ga0207648_10191091	Ga0207648_101910911	486
461	3300026121	Ga0207683_10000467	Ga0207683_1000046737	486
462	3300027526	Ga0209968_1004232	Ga0209968_10042321	486
463	3300027617	Ga0210002_1000793	Ga0210002_10007934	486
464	3300027682	Ga0209971_1001125	Ga0209971_10011255	486
465	3300027682	Ga0209971_1006035	Ga0209971_10060353	486
466	3300027876	Ga0209974_10000094	Ga0209974_1000009412	486
467	3300027907	Ga0207428_10028315	Ga0207428_100283153	486
468	3300027907	Ga0207428_10079984	Ga0207428_100799842	486
469	3300027907	Ga0207428_10106244	Ga0207428_101062442	486
470	3300028379	Ga0268266_10033893	Ga0268266_100338935	486
471	3300031824	Ga0307413_10017150	Ga0307413_100171502	486
472	3300031852	Ga0307410_10020984	Ga0307410_100209843	486
473	3300031911	Ga0307412_10057057	Ga0307412_100570574	486
474	3300031995	Ga0307409_100002917	Ga0307409_1000029172	486
475	3300032002	Ga0307416_100019470	Ga0307416_1000194702	486
476	3300035692	Ga0373935_0013036	Ga0373935_0013036_2546_4006	486
477	3300035695	Ga0373927_0100317	Ga0373927_0100317_261_1721	486
478	3300035695	Ga0373927_0106028	Ga0373927_0106028_246_1730	486
479	3300035725	Ga0373947_0042678	Ga0373947_0042678_261_1721	486
480	3300042876	Ga0451577_0074164	Ga0451577_0074164_783_2243	486
481	3300044673	Ga0453683_0003894	Ga0453683_0003894_7666_9126	486
482	3300044712	Ga0453684_0196586	Ga0453684_0196586_462_1922	486
483	3300046472	Ga0495580_0117685	Ga0495580_0117685_175_1635	486
484	3300046683	Ga0495658_0047170	Ga0495658_0047170_674_2134	486
485	3300048915	Ga0496112_0117369	Ga0496112_0117369_753_2213	486
486	3300049568	Ga0501031_0042352	Ga0501031_0042352_885_2345	486
487	3300049569	Ga0501032_0071262	Ga0501032_0071262_422_1882	486
488	3300049570	Ga0501033_0014572	Ga0501033_0014572_2527_4011	486
489	3300049570	Ga0501033_0017684	Ga0501033_0017684_3106_4566	486
490	3300049572	Ga0501036_0035786	Ga0501036_0035786_1414_2874	486
491	3300049572	Ga0501036_0091992	Ga0501036_0091992_133_1617	486
492	3300049573	Ga0501037_0036340	Ga0501037_0036340_1911_3371	486
493	3300049574	Ga0501038_0029484	Ga0501038_0029484_2986_4470	486
494	3300049575	Ga0501039_0009856	Ga0501039_0009856_5746_7230	486
495	3300049576	Ga0501040_0001648	Ga0501040_0001648_6022_7506	486
496	3300049576	Ga0501040_0026058	Ga0501040_0026058_1059_2519	486
497	3300049577	Ga0501041_0000471	Ga0501041_0000471_1046_2530	486
498	3300049578	Ga0501042_0049577	Ga0501042_0049577_1221_2705	486
499	3300049579	Ga0501043_0014099	Ga0501043_0014099_2785_4269	486
500	3300049580	Ga0501046_0023220	Ga0501046_0023220_81_1565	486
501	3300049580	Ga0501046_0090276	Ga0501046_0090276_552_2012	486
502	3300049582	Ga0501048_0010810	Ga0501048_0010810_3221_4705	486
503	3300049587	Ga0501071_0015388	Ga0501071_0015388_725_2209	486
504	3300049588	Ga0501072_0002815	Ga0501072_0002815_2774_4258	486
505	3300049589	Ga0501073_0034453	Ga0501073_0034453_346_1806	486
506	3300049591	Ga0501075_0002513	Ga0501075_0002513_9827_11311	486
507	3300049592	Ga0501076_0003383	Ga0501076_0003383_6869_8353	486
508	3300049592	Ga0501076_0103754	Ga0501076_0103754_720_2180	486
509	3300049592	Ga0501076_0144489	Ga0501076_0144489_29_1489	486
510	3300049593	Ga0501077_0000169	Ga0501077_0000169_29936_31420	486
511	3300049593	Ga0501077_0006747	Ga0501077_0006747_1118_2578	486
512	3300049593	Ga0501077_0085062	Ga0501077_0085062_480_1940	486
513	3300049741	Ga0501079_0003480	Ga0501079_0003480_481_1965	486
514	3300049741	Ga0501079_0038535	Ga0501079_0038535_768_2228	486
515	3300049742	Ga0501080_0088785	Ga0501080_0088785_1085_2545	486
516	3300049743	Ga0501081_0000045	Ga0501081_0000045_27648_29132	486
517	3300049743	Ga0501081_0096469	Ga0501081_0096469_299_1759	486
518	3300049743	Ga0501081_0113680	Ga0501081_0113680_377_1843	486
519	3300049744	Ga0501083_0051483	Ga0501083_0051483_14_1498	486
520	3300049822	Ga0501035_0031658	Ga0501035_0031658_455_1915	486
521	3300049823	Ga0501044_0024720	Ga0501044_0024720_3561_5021	486
522	3300050507	nmdc:mga05p37_222892_c1	nmdc:mga05p37_222892_c1_544_2004	486
523	3300050507	nmdc:mga05p37_23759_c1	nmdc:mga05p37_23759_c1_4421_5881	486
524	3300050507	nmdc:mga05p37_248151_c1	nmdc:mga05p37_248151_c1_568_2028	486
525	3300050507	nmdc:mga05p37_268214_c1	nmdc:mga05p37_268214_c1_472_1932	486
526	3300050508	nmdc:mga09592_12776_c1	nmdc:mga09592_12776_c1_3679_5139	486
527	3300050508	nmdc:mga09592_74934_c1	nmdc:mga09592_74934_c1_813_2273	486
528	3300050510	nmdc:mga06r32_130630_c1	nmdc:mga06r32_130630_c1_401_1888	486
529	3300050510	nmdc:mga06r32_21772_c1	nmdc:mga06r32_21772_c1_1950_3410	486
530	3300050510	nmdc:mga06r32_38135_c1	nmdc:mga06r32_38135_c1_438_1898	486
531	3300050511	nmdc:mga08y16_114623_c1	nmdc:mga08y16_114623_c1_324_1811	486
532	3300050511	nmdc:mga08y16_51731_c1	nmdc:mga08y16_51731_c1_779_2239	486
533	3300050511	nmdc:mga08y16_72181_c1	nmdc:mga08y16_72181_c1_1551_3023	486
534	3300050512	nmdc:mga0n895_1092_c1	nmdc:mga0n895_1092_c1_15566_17038	486
535	3300050512	nmdc:mga0n895_113119_c1	nmdc:mga0n895_113119_c1_1252_2712	486
536	3300050512	nmdc:mga0n895_4508_c1	nmdc:mga0n895_4508_c1_7819_9279	486
537	3300050513	nmdc:mga0rr50_27618_c1	nmdc:mga0rr50_27618_c1_26_1486	486
538	3300050514	nmdc:mga08x19_126993_c1	nmdc:mga08x19_126993_c1_102_1562	486
539	3300050515	nmdc:mga0a205_105033_c1	nmdc:mga0a205_105033_c1_740_2200	486
540	3300050515	nmdc:mga0a205_12447_c1	nmdc:mga0a205_12447_c1_4724_6184	486
541	3300050515	nmdc:mga0a205_133483_c1	nmdc:mga0a205_133483_c1_289_1749	486
542	3300050515	nmdc:mga0a205_153724_c1	nmdc:mga0a205_153724_c1_516_2003	486
543	3300050515	nmdc:mga0a205_42082_c1	nmdc:mga0a205_42082_c1_1998_3458	486
544	3300059421	Ga0590071_010648	Ga0590071_010648_188_1648	486
545	3300060353	Ga0501082_0011956	Ga0501082_0011956_3080_4564	486
546	3300061734	Ga0530510_0029938	Ga0530510_0029938_480_1940	486

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01458

SUFBD

SUF system FeS cluster assembly, SufBD

222

456

0.96 PF19295

SufBD_N

SufBD protein N-terminal region

124

211

0.84 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5awf-assembly2.cif.gz_E	crystal structure of sufb-sufc-sufd complex from escherichia coli	0.9583	32	486
5awf-assembly1.cif.gz_A	crystal structure of sufb-sufc-sufd complex from escherichia coli	0.9548	29	486
5awf-assembly2.cif.gz_E	crystal structure of sufb-sufc-sufd complex from escherichia coli	0.9534	32	486
5awf-assembly1.cif.gz_A	crystal structure of sufb-sufc-sufd complex from escherichia coli	0.9524	29	486
5awg-assembly2.cif.gz_E	crystal structure of hg-bound sufb-sufc-sufd complex from escherichia coli	0.9504	33	482

ID	Description	Score	Start	End	Superfamily
af_P0A8P6_5_99_1.10.150.130	Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain	0.3886	35	153	1.10.150.130
af_Q4CKJ8_12_259_2.160.20.10	Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like	0.3818	196	430	2.160.20.10
af_Q4CKJ8_12_259_2.160.20.10	Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like	0.3459	196	430	2.160.20.10
af_P0A8P6_5_99_1.10.150.130	Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain	0.34	35	153	1.10.150.130
af_A0A0R0KH96_20_307_2.160.20.10	Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like	0.3232	243	428	2.160.20.10

ID	Description	Score	Start	End	GO Terms
AF-A0A4Q5VQT5-F1-model_v4	deleted	0.9951	152	486
AF-A0A3D2VYE6-F1-model_v4	Fe-S cluster assembly protein SufB	0.9943	206	486	GO:0016226
AF-A0A7Y2UBX7-F1-model_v4	Fe-S cluster assembly protein SufB	0.9942	164	486	GO:0016226
AF-A0A7S3GYF1-F1-model_v4	SUF system FeS cluster assembly SufBD core domain-containing protein	0.9936	258	395	GO:0016226
AF-A0A2V7U733-F1-model_v4	Fe-S cluster assembly protein SufB	0.9932	313	486	GO:0016226

Feature Viewer

pLDDT	pTM	Quality
82.46	0.83	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F462049

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01458

SUFBD

SUF system FeS cluster assembly, SufBD

222

456

0.96

PF19295

SufBD_N

SufBD protein N-terminal region

124

211

0.84

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map