F461944

General Info

Members Datasets Scaffolds Average Seq Length
546 330 1092 124

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10489214|Ga0065712_104892141
Length 147
Sequence MSSSATARSTLPSDHDVLVQLNTDYINSVQRSDVKRFDEILASEFYCSNPDGTLVDRAAFLKQTAKPVAIRDLRAEDVVIRIFSSAHDLVREAVSTSRDHAQGDFAIIHARTAYTKPDGSAGGGRYTDVWAKQNGRWRAVSAHVTRL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
208 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
209 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
210 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
211 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
212 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
213 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
214 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
312 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
315 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
318 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
319 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
322 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
323 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
324 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.96
Nodule 0
Rhizoplane 7.51
Rhizosphere 84.8
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10489214 3300005290 Bacteria 657
2 JGI24744J21845_10021833 3300002077 Bacteria 1258
3 Ga0065715_10629955 3300005293 Unclassified 690
4 Ga0070690_100064242 3300005330 Bacteria 2370
5 Ga0070690_100127423 3300005330 Bacteria 1715
6 Ga0070690_100195222 3300005330 Bacteria 1405
7 Ga0070670_100991996 3300005331 Bacteria 764
8 Ga0070670_101636511 3300005331 Unclassified 592
9 Ga0070677_10098338 3300005333 Bacteria 1286
10 Ga0068869_100097655 3300005334 Bacteria 2218
11 Ga0070666_10143348 3300005335 Bacteria 1664
12 Ga0068868_100114904 3300005338 Bacteria 2190
13 Ga0070660_100357151 3300005339 Bacteria 1204
14 Ga0070689_100120188 3300005340 Bacteria 2098
15 Ga0070689_100413192 3300005340 Unclassified 1142
16 Ga0070687_100762275 3300005343 Bacteria 682
17 Ga0070661_100153772 3300005344 Bacteria 1740
18 Ga0070692_10094101 3300005345 Bacteria 1633
19 Ga0070692_10135687 3300005345 Bacteria 1387
20 Ga0070668_100298881 3300005347 Bacteria 1350
21 Ga0070668_101051349 3300005347 Bacteria 733
22 Ga0070669_100039401 3300005353 Bacteria 3434
23 Ga0070669_101309084 3300005353 Unclassified 627
24 Ga0070675_100123482 3300005354 Bacteria 2201
25 Ga0070671_100196199 3300005355 Bacteria 1711
26 Ga0070671_100212771 3300005355 Bacteria 1640
27 Ga0070671_100260000 3300005355 Bacteria 1475
28 Ga0070674_100127406 3300005356 Bacteria 1893
29 Ga0070673_100236211 3300005364 Bacteria 1587
30 Ga0070673_100979834 3300005364 Bacteria 786
31 Ga0070673_102138462 3300005364 Bacteria 532
32 Ga0070688_100920525 3300005365 Bacteria 690
33 Ga0070688_101061439 3300005365 Bacteria 646
34 Ga0070659_100189343 3300005366 Bacteria 1690
35 Ga0070659_100407502 3300005366 Bacteria 1148
36 Ga0070667_100306063 3300005367 Bacteria 1432
37 Ga0070667_100342826 3300005367 Bacteria 1352
38 Ga0070667_100378510 3300005367 Bacteria 1285
39 Ga0070703_10061746 3300005406 Bacteria 1228
40 Ga0070703_10148650 3300005406 Bacteria 878
41 Ga0070709_10140761 3300005434 Bacteria 1657
42 Ga0070709_11036909 3300005434 Bacteria 654
43 Ga0070713_102465301 3300005436 Bacteria 503
44 Ga0070710_10618033 3300005437 Bacteria 756
45 Ga0070710_11327778 3300005437 Bacteria 536
46 Ga0070701_10618496 3300005438 Bacteria 719
47 Ga0070711_100353851 3300005439 Bacteria 1181
48 Ga0070711_100461403 3300005439 Bacteria 1041
49 Ga0070705_100759697 3300005440 Bacteria 767
50 Ga0070694_100222141 3300005444 Bacteria 1417
51 Ga0070694_101583343 3300005444 Bacteria 556
52 Ga0070708_100062697 3300005445 Bacteria 3326
53 Ga0070708_101217692 3300005445 Unclassified 704
54 Ga0070708_101480087 3300005445 Bacteria 633
55 Ga0070708_101760118 3300005445 Unclassified 575
56 Ga0070663_100701398 3300005455 Bacteria 860
57 Ga0070678_100004019 3300005456 Bacteria 8277
58 Ga0070678_100100115 3300005456 Bacteria 2244
59 Ga0070678_100157420 3300005456 Bacteria 1836
60 Ga0070678_102122400 3300005456 Bacteria 532
61 Ga0070681_10758843 3300005458 Bacteria 887
62 Ga0070681_11267019 3300005458 Bacteria 660
63 Ga0068867_101135941 3300005459 Bacteria 715
64 Ga0068867_102205523 3300005459 Bacteria 523
65 Ga0070685_10446089 3300005466 Bacteria 905
66 Ga0070685_10834619 3300005466 Bacteria 682
67 Ga0070706_100118310 3300005467 Bacteria 2468
68 Ga0070706_100139283 3300005467 Bacteria 2265
69 Ga0070706_100262655 3300005467 Unclassified 1611
70 Ga0070706_100499879 3300005467 Bacteria 1131
71 Ga0070707_100105819 3300005468 Bacteria 2728
72 Ga0070707_100258996 3300005468 Bacteria 1692
73 Ga0070707_100314853 3300005468 Bacteria 1521
74 Ga0070698_100032926 3300005471 Bacteria 5369
75 Ga0070698_100688156 3300005471 Bacteria 964
76 Ga0070698_101035512 3300005471 Unclassified 768
77 Ga0070698_101053881 3300005471 Bacteria 761
78 Ga0070698_101995140 3300005471 Bacteria 533
79 Ga0070699_100440349 3300005518 Bacteria 1181
80 Ga0070699_100494726 3300005518 Bacteria 1110
81 Ga0070699_100840386 3300005518 Unclassified 840
82 Ga0070679_100133253 3300005530 Bacteria 2466
83 Ga0070684_100076182 3300005535 Bacteria 2960
84 Ga0070684_100920210 3300005535 Bacteria 820
85 Ga0070697_100166026 3300005536 Bacteria 1867
86 Ga0070697_100500069 3300005536 Bacteria 1063
87 Ga0068853_100242381 3300005539 Bacteria 1653
88 Ga0068853_100887549 3300005539 Bacteria 856
89 Ga0070686_101564852 3300005544 Bacteria 557
90 Ga0070695_100114052 3300005545 Bacteria 1839
91 Ga0070695_100450098 3300005545 Bacteria 986
92 Ga0070693_100498108 3300005547 Bacteria 864
93 Ga0070693_101096878 3300005547 Bacteria 607
94 Ga0070665_100107631 3300005548 Bacteria 2790
95 Ga0070665_101395656 3300005548 Unclassified 710
96 Ga0070704_101122595 3300005549 Bacteria 715
97 Ga0070704_102144784 3300005549 Bacteria 519
98 Ga0068855_101427593 3300005563 Bacteria 713
99 Ga0068854_101308958 3300005578 Bacteria 652
100 Ga0068852_100040053 3300005616 Bacteria 3950
101 Ga0068859_100074206 3300005617 Bacteria 3440
102 Ga0068859_100076282 3300005617 Bacteria 3393
103 Ga0068859_101077574 3300005617 Bacteria 883
104 Ga0068859_101351153 3300005617 Bacteria 786
105 Ga0068864_100080078 3300005618 Bacteria 2861
106 Ga0068864_102287259 3300005618 Bacteria 547
107 Ga0068866_10184542 3300005718 Bacteria 1235
108 Ga0068861_100166784 3300005719 Bacteria 1821
109 Ga0068861_101522331 3300005719 Bacteria 657
110 Ga0068870_10058623 3300005840 Bacteria 2061
111 Ga0068870_10478685 3300005840 Bacteria 826
112 Ga0068863_100238901 3300005841 Bacteria 1754
113 Ga0068863_100259364 3300005841 Bacteria 1680
114 Ga0068863_100437262 3300005841 Bacteria 1283
115 Ga0068858_100170576 3300005842 Bacteria 2052
116 Ga0068860_100212789 3300005843 Bacteria 1875
117 Ga0068860_100264977 3300005843 Bacteria 1676
118 Ga0068860_100511152 3300005843 Bacteria 1200
119 Ga0068862_100458020 3300005844 Bacteria 1203
120 Ga0068862_101953077 3300005844 Bacteria 597
121 Ga0081455_10020605 3300005937 Bacteria 6203
122 Ga0081455_10039689 3300005937 Bacteria 4157
123 Ga0081455_10369517 3300005937 Bacteria 1006
124 Ga0081540_1003592 3300005983 Bacteria 12172
125 Ga0081540_1088129 3300005983 Bacteria 1373
126 Ga0070717_10025148 3300006028 Bacteria 4731
127 Ga0075365_10109466 3300006038 Unclassified 1898
128 Ga0075365_10298952 3300006038 Bacteria 1133
129 Ga0075365_10651932 3300006038 Bacteria 744
130 Ga0075368_10300213 3300006042 Bacteria 693
131 Ga0075363_100017007 3300006048 Bacteria 3601
132 Ga0075364_10297757 3300006051 Unclassified 1098
133 Ga0070716_100596831 3300006173 Bacteria 830
134 Ga0070712_100317772 3300006175 Bacteria 1265
135 Ga0070712_100355029 3300006175 Bacteria 1201
136 Ga0075362_10009515 3300006177 Bacteria 3762
137 Ga0075362_10083371 3300006177 Bacteria 1476
138 Ga0075367_10017399 3300006178 Bacteria 3946
139 Ga0075369_10011960 3300006186 Bacteria 3421
140 Ga0075369_10177827 3300006186 Bacteria 978
141 Ga0097621_100244231 3300006237 Bacteria 1570
142 Ga0075370_10289249 3300006353 Unclassified 974
143 Ga0075370_10303505 3300006353 Bacteria 950
144 Ga0068871_101143519 3300006358 Bacteria 729
145 Ga0075428_100122649 3300006844 Bacteria 2829
146 Ga0075428_100239767 3300006844 Bacteria 1956
147 Ga0075430_100096935 3300006846 Bacteria 2464
148 Ga0075430_101571925 3300006846 Bacteria 540
149 Ga0075431_100396653 3300006847 Bacteria 1381
150 Ga0075434_100430497 3300006871 Bacteria 1340
151 Ga0075434_100907649 3300006871 Bacteria 896
152 Ga0068865_100056239 3300006881 Bacteria 2740
153 Ga0068865_100104089 3300006881 Bacteria 2083
154 Ga0068865_100183291 3300006881 Bacteria 1614
155 Ga0068865_100890254 3300006881 Bacteria 773
156 Ga0068865_101485240 3300006881 Bacteria 607
157 Ga0097620_100074205 3300006931 Bacteria 3440
158 Ga0097620_100076282 3300006931 Bacteria 3393
159 Ga0097620_101077571 3300006931 Bacteria 883
160 Ga0097620_101351082 3300006931 Bacteria 786
161 Ga0099794_10038639 3300007265 Bacteria 2262
162 Ga0099794_10058964 3300007265 Bacteria 1861
163 Ga0099794_10074472 3300007265 Bacteria 1667
164 Ga0099794_10112861 3300007265 Bacteria 1363
165 Ga0099794_10298416 3300007265 Bacteria 834
166 Ga0099794_10740295 3300007265 Bacteria 525
167 Ga0099795_10011943 3300007788 Bacteria 2616
168 Ga0099795_10057470 3300007788 Bacteria 1434
169 Ga0105251_10100887 3300009011 Bacteria 1319
170 Ga0105250_10528763 3300009092 Bacteria 538
171 Ga0111539_10096402 3300009094 Bacteria 3474
172 Ga0111539_10369750 3300009094 Unclassified 1669
173 Ga0111539_10651650 3300009094 Bacteria 1226
174 Ga0105245_10162037 3300009098 Bacteria 2123
175 Ga0105245_12171100 3300009098 Bacteria 609
176 Ga0105247_10632732 3300009101 Bacteria 797
177 Ga0105247_11176414 3300009101 Bacteria 609
178 Ga0114129_10649187 3300009147 Bacteria 1362
179 Ga0105243_10012652 3300009148 Bacteria 6374
180 Ga0105243_10465431 3300009148 Bacteria 1190
181 Ga0105243_12271392 3300009148 Unclassified 580
182 Ga0105241_12176775 3300009174 Bacteria 549
183 Ga0105242_10039348 3300009176 Bacteria 3805
184 Ga0105248_10174140 3300009177 Bacteria 2426
185 Ga0105248_10230462 3300009177 Bacteria 2085
186 Ga0105248_11318682 3300009177 Bacteria 816
187 Ga0105248_11804647 3300009177 Bacteria 694
188 Ga0105238_10447110 3300009551 Bacteria 1289
189 Ga0105238_10654023 3300009551 Bacteria 1061
190 Ga0105238_11983926 3300009551 Bacteria 615
191 Ga0105249_10128405 3300009553 Bacteria 2417
192 Ga0105249_13088063 3300009553 Bacteria 535
193 Ga0099796_10079925 3300010159 Bacteria 1197
194 Ga0099796_10140339 3300010159 Bacteria 944
195 Ga0105246_10116598 3300011119 Bacteria 1972
196 Ga0105246_10920752 3300011119 Bacteria 785
197 Ga0157373_10460137 3300013100 Bacteria 916
198 Ga0157371_10449604 3300013102 Bacteria 947
199 Ga0157370_11198389 3300013104 Bacteria 685
200 Ga0157374_10166276 3300013296 Bacteria 2150
201 Ga0157378_10974147 3300013297 Bacteria 881
202 Ga0163162_10136290 3300013306 Bacteria 2566
203 Ga0163162_10210670 3300013306 Bacteria 2073
204 Ga0157372_11486963 3300013307 Bacteria 780
205 Ga0157375_10135456 3300013308 Bacteria 2586
206 Ga0157375_10142651 3300013308 Bacteria 2523
207 Ga0157375_11936269 3300013308 Bacteria 700
208 Ga0163163_10564822 3300014325 Bacteria 1201
209 Ga0163163_10909003 3300014325 Bacteria 944
210 Ga0157380_10204747 3300014326 Bacteria 1754
211 Ga0157380_10813948 3300014326 Unclassified 952
212 Ga0157380_10844629 3300014326 Bacteria 937
213 Ga0157380_11626779 3300014326 Bacteria 702
214 Ga0157377_10166878 3300014745 Bacteria 1374
215 Ga0157377_10212691 3300014745 Bacteria 1234
216 Ga0157379_10043466 3300014968 Bacteria 4011
217 Ga0157379_11623007 3300014968 Bacteria 632
218 Ga0157376_10444053 3300014969 Bacteria 1264
219 Ga0157376_10887489 3300014969 Bacteria 909
220 Ga0163161_10270415 3300017792 Bacteria 1330
221 Ga0163161_10723987 3300017792 Bacteria 830
222 Ga0224712_10126185 3300022467 Unclassified 1113
223 Ga0207653_10053145 3300025885 Bacteria 1353
224 Ga0207682_10222975 3300025893 Bacteria 872
225 Ga0207682_10224629 3300025893 Bacteria 869
226 Ga0207688_10051376 3300025901 Bacteria 2309
227 Ga0207680_10279262 3300025903 Bacteria 1160
228 Ga0207647_10147331 3300025904 Bacteria 1377
229 Ga0207647_10195017 3300025904 Bacteria 1173
230 Ga0207699_10625323 3300025906 Bacteria 785
231 Ga0207643_10088729 3300025908 Bacteria 1800
232 Ga0207643_10112122 3300025908 Bacteria 1607
233 Ga0207705_10199112 3300025909 Bacteria 1517
234 Ga0207684_10146312 3300025910 Bacteria 2032
235 Ga0207684_10192838 3300025910 Bacteria 1757
236 Ga0207684_10325248 3300025910 Bacteria 1325
237 Ga0207654_10988423 3300025911 Bacteria 612
238 Ga0207707_10170187 3300025912 Bacteria 1904
239 Ga0207707_11635891 3300025912 Unclassified 506
240 Ga0207671_10291637 3300025914 Bacteria 1288
241 Ga0207671_10541584 3300025914 Bacteria 928
242 Ga0207693_10585098 3300025915 Bacteria 869
243 Ga0207663_10012046 3300025916 Bacteria 4663
244 Ga0207663_10364949 3300025916 Bacteria 1096
245 Ga0207660_10018533 3300025917 Bacteria 4641
246 Ga0207660_10882118 3300025917 Bacteria 730
247 Ga0207657_10052273 3300025919 Bacteria 3547
248 Ga0207657_10384965 3300025919 Bacteria 1104
249 Ga0207649_10245800 3300025920 Bacteria 1286
250 Ga0207646_10062089 3300025922 Bacteria 3335
251 Ga0207646_10159377 3300025922 Bacteria 2036
252 Ga0207646_10194999 3300025922 Bacteria 1829
253 Ga0207681_10040524 3300025923 Unclassified 3100
254 Ga0207681_11800848 3300025923 Unclassified 511
255 Ga0207694_10423464 3300025924 Bacteria 1109
256 Ga0207694_10488244 3300025924 Bacteria 1031
257 Ga0207650_10748821 3300025925 Bacteria 827
258 Ga0207687_10536434 3300025927 Bacteria 980
259 Ga0207687_10916773 3300025927 Bacteria 750
260 Ga0207687_11016989 3300025927 Bacteria 711
261 Ga0207644_10036693 3300025931 Bacteria 3443
262 Ga0207690_10219249 3300025932 Bacteria 1455
263 Ga0207706_10025687 3300025933 Bacteria 5277
264 Ga0207686_11041391 3300025934 Bacteria 665
265 Ga0207670_10561695 3300025936 Bacteria 934
266 Ga0207670_11419729 3300025936 Unclassified 589
267 Ga0207669_10324676 3300025937 Bacteria 1179
268 Ga0207669_11375158 3300025937 Unclassified 601
269 Ga0207704_10149752 3300025938 Bacteria 1645
270 Ga0207704_10353250 3300025938 Bacteria 1145
271 Ga0207704_10823727 3300025938 Bacteria 776
272 Ga0207665_10093696 3300025939 Bacteria 2085
273 Ga0207665_10974997 3300025939 Bacteria 674
274 Ga0207691_10064525 3300025940 Bacteria 3318
275 Ga0207691_10158162 3300025940 Bacteria 1989
276 Ga0207691_10316327 3300025940 Bacteria 1339
277 Ga0207711_10082209 3300025941 Bacteria 2815
278 Ga0207711_10795663 3300025941 Bacteria 881
279 Ga0207689_10600770 3300025942 Bacteria 926
280 Ga0207661_10421891 3300025944 Bacteria 1212
281 Ga0207679_10865943 3300025945 Bacteria 826
282 Ga0207667_10655971 3300025949 Bacteria 1054
283 Ga0207651_10050071 3300025960 Bacteria 2834
284 Ga0207651_10168009 3300025960 Bacteria 1727
285 Ga0207651_10488516 3300025960 Bacteria 1062
286 Ga0207668_10730102 3300025972 Bacteria 872
287 Ga0207640_10331824 3300025981 Bacteria 1215
288 Ga0207640_10415848 3300025981 Bacteria 1099
289 Ga0207658_10012012 3300025986 Bacteria 5907
290 Ga0207658_10176143 3300025986 Bacteria 1766
291 Ga0207658_10876670 3300025986 Bacteria 817
292 Ga0207677_10061422 3300026023 Bacteria 2602
293 Ga0207703_10138696 3300026035 Bacteria 2108
294 Ga0207639_10307943 3300026041 Bacteria 1402
295 Ga0207639_10436248 3300026041 Bacteria 1187
296 Ga0207639_10922346 3300026041 Bacteria 817
297 Ga0207678_10282411 3300026067 Bacteria 1425
298 Ga0207708_10050103 3300026075 Bacteria 3179
299 Ga0207708_10388754 3300026075 Bacteria 1151
300 Ga0207641_10024950 3300026088 Bacteria 4929
301 Ga0207641_11125445 3300026088 Bacteria 784
302 Ga0207648_10138634 3300026089 Bacteria 2143
303 Ga0207648_10274027 3300026089 Bacteria 1508
304 Ga0207648_10284048 3300026089 Bacteria 1480
305 Ga0207676_10016103 3300026095 Bacteria 5408
306 Ga0207676_10722077 3300026095 Bacteria 967
307 Ga0207676_11332994 3300026095 Bacteria 713
308 Ga0207675_100024047 3300026118 Bacteria 5664
309 Ga0207675_101513545 3300026118 Bacteria 692
310 Ga0207675_101533160 3300026118 Bacteria 687
311 Ga0207683_10007219 3300026121 Bacteria 9527
312 Ga0207698_10494294 3300026142 Bacteria 1189
313 Ga0209588_1114299 3300027671 Bacteria 866
314 Ga0268266_10237831 3300028379 Bacteria 1679
315 Ga0268266_10754032 3300028379 Bacteria 939
316 Ga0268265_10012758 3300028380 Bacteria 5705
317 Ga0268265_11650250 3300028380 Bacteria 646
318 Ga0268264_10120124 3300028381 Bacteria 2315
319 Ga0268264_10608528 3300028381 Bacteria 1077
320 Ga0268264_10744214 3300028381 Bacteria 976
321 Ga0307508_10088970 3300031616 Bacteria 2673
322 Ga0307407_10078362 3300031903 Unclassified 1991
323 Ga0307409_100411046 3300031995 Bacteria 1295
324 Ga0307411_10065280 3300032005 Unclassified 2441
325 Ga0307510_10025120 3300033180 Bacteria 6876
326 Ga0373930_0091657 3300034816 Bacteria 713
327 Ga0373940_0343101 3300035088 Bacteria 523
328 Ga0373949_0192904 3300035090 Bacteria 608
329 Ga0373951_0012018 3300035091 Bacteria 1947
330 Ga0373923_0013844 3300035111 Bacteria 3015
331 Ga0373936_0056486 3300035113 Bacteria 1595
332 Ga0373953_0047618 3300035117 Bacteria 1725
333 Ga0373954_0034007 3300035118 Bacteria 2359
334 Ga0373956_0135008 3300035119 Bacteria 1157
335 Ga0373960_0022651 3300035121 Bacteria 1685
336 Ga0373943_0068773 3300035170 Bacteria 1788
337 Ga0373943_0156427 3300035170 Bacteria 1238
338 Ga0373943_0376081 3300035170 Bacteria 817
339 Ga0373946_0002941 3300035171 Bacteria 6039
340 Ga0373955_0480425 3300035172 Bacteria 758
341 Ga0373955_1031690 3300035172 Bacteria 507
342 Ga0373962_0023627 3300035242 Bacteria 1639
343 Ga0373931_0000725 3300035691 Bacteria 13714
344 Ga0373935_0000583 3300035692 Bacteria 19030
345 Ga0373935_0410455 3300035692 Bacteria 974
346 Ga0373927_0000464 3300035695 Bacteria 30987
347 Ga0373927_0348120 3300035695 Bacteria 976
348 Ga0373933_0135352 3300035724 Bacteria 1552
349 Ga0373947_0004527 3300035725 Bacteria 8151
350 Ga0373947_1003401 3300035725 Bacteria 569
351 Ga0373937_0014146 3300036401 Bacteria 7038
352 Ga0373937_0715485 3300036401 Bacteria 948
353 Ga0373925_0001896 3300037068 Bacteria 17364
354 Ga0373925_0129552 3300037068 Bacteria 1966
355 Ga0395900_0928876 3300037418 Bacteria 792
356 Ga0395898_0254543 3300037466 Bacteria 1674
357 Ga0395905_0066261 3300037471 Bacteria 3382
358 Ga0395905_0154417 3300037471 Bacteria 2159
359 Ga0395905_0200646 3300037471 Bacteria 1870
360 Ga0395905_0297419 3300037471 Bacteria 1501
361 Ga0395901_0128352 3300038443 Bacteria 2665
362 Ga0395901_0373548 3300038443 Bacteria 1468
363 Ga0242420_028644 3300038996 Bacteria 1026
364 Ga0436365_1834697 3300039437 Bacteria 1050
365 Ga0436361_0485903 3300039447 Bacteria 1066
366 Ga0436362_0640009 3300039453 Bacteria 7758
367 Ga0439453_0000426 3300041408 Bacteria 4572
368 Ga0439465_0058048 3300041413 Bacteria 1278
369 Ga0451797_0747677 3300041453 Bacteria 1118
370 Ga0451845_0080544 3300041501 Bacteria 694
371 Ga0439441_184439 3300042001 Bacteria 503
372 Ga0439443_030671 3300042003 Bacteria 885
373 Ga0439435_0002578 3300042436 Bacteria 3628
374 Ga0439444_0030627 3300042437 Bacteria 1008
375 Ga0439464_0179640 3300042439 Bacteria 670
376 Ga0439460_0022723 3300042461 Bacteria 1723
377 Ga0439460_0362675 3300042461 Bacteria 512
378 Ga0439440_0244389 3300042993 Bacteria 545
379 Ga0453684_1710078 3300044712 Bacteria 642
380 Ga0451576_0822976 3300045051 Bacteria 975
381 Ga0495592_0017029 3300046454 Bacteria 5517
382 Ga0495603_0000029 3300046455 Bacteria 60872
383 Ga0495603_0004050 3300046455 Bacteria 8723
384 Ga0495603_0273702 3300046455 Bacteria 971
385 Ga0495629_0000029 3300046459 Bacteria 127000
386 Ga0495629_0009098 3300046459 Bacteria 7274
387 Ga0495638_0014004 3300046460 Bacteria 5436
388 Ga0495638_0433661 3300046460 Bacteria 675
389 Ga0495641_0001748 3300046461 Bacteria 18118
390 Ga0495580_0000321 3300046472 Bacteria 39093
391 Ga0495580_0253205 3300046472 Bacteria 1205
392 Ga0495580_0835428 3300046472 Bacteria 595
393 Ga0495582_0000024 3300046473 Bacteria 82444
394 Ga0495582_0348389 3300046473 Bacteria 853
395 Ga0495639_0000006 3300046475 Bacteria 100361
396 Ga0495662_0000068 3300046476 Bacteria 36559
397 Ga0495662_0218734 3300046476 Bacteria 939
398 Ga0495664_0003926 3300046477 Bacteria 8113
399 Ga0495664_0739908 3300046477 Bacteria 580
400 Ga0495594_0000806 3300046499 Bacteria 16204
401 Ga0495628_0056201 3300046516 Bacteria 3099
402 Ga0495630_0000497 3300046517 Bacteria 29123
403 Ga0495631_0528192 3300046518 Bacteria 503
404 Ga0495663_0319819 3300046525 Bacteria 561
405 Ga0495666_0025453 3300046526 Bacteria 2922
406 Ga0495652_0049962 3300046529 Bacteria 3578
407 Ga0495665_0260743 3300046531 Bacteria 891
408 Ga0495640_0208675 3300046533 Bacteria 1236
409 Ga0495598_0161635 3300046537 Bacteria 788
410 Ga0495621_0036579 3300046539 Bacteria 1704
411 Ga0495622_0001732 3300046557 Bacteria 10795
412 Ga0495667_0025100 3300046559 Bacteria 4018
413 Ga0495667_0552434 3300046559 Bacteria 719
414 Ga0495668_0735177 3300046616 Bacteria 546
415 Ga0495634_0002262 3300046642 Bacteria 16141
416 Ga0495634_0034366 3300046642 Bacteria 3479
417 Ga0495635_0000179 3300046663 Bacteria 40014
418 Ga0495635_0152634 3300046663 Bacteria 1572
419 Ga0495588_0018170 3300046674 Bacteria 3424
420 Ga0495599_0007169 3300046678 Bacteria 6750
421 Ga0495647_0010234 3300046681 Bacteria 3192
422 Ga0495658_0000736 3300046683 Bacteria 17637
423 Ga0495613_0003681 3300046689 Bacteria 11490
424 Ga0495613_0053699 3300046689 Bacteria 2964
425 Ga0495624_0000698 3300046690 Bacteria 26344
426 Ga0495671_0242325 3300046692 Bacteria 871
427 Ga0495600_0108153 3300046809 Bacteria 1811
428 Ga0495581_0000004 3300047315 Bacteria 84424
429 Ga0495581_0085544 3300047315 Bacteria 1828
430 Ga0495674_0005737 3300047319 Bacteria 11900
431 Ga0495674_0178031 3300047319 Bacteria 1772
432 Ga0495674_0341802 3300047319 Bacteria 1216
433 Ga0495672_0062656 3300047320 Bacteria 2138
434 Ga0495672_0556948 3300047320 Bacteria 502
435 Ga0495676_0692719 3300047321 Bacteria 659
436 Ga0495676_0701904 3300047321 Bacteria 654
437 Ga0495675_0144299 3300047444 Bacteria 1474
438 Ga0495673_0026889 3300047469 Bacteria 2744
439 Ga0495684_0058056 3300047471 Bacteria 2948
440 Ga0495684_0160966 3300047471 Bacteria 1674
441 Ga0495593_0000278 3300047673 Bacteria 27906
442 Ga0495614_0030345 3300048089 Bacteria 2326
443 Ga0495615_0136684 3300048090 Bacteria 720
444 Ga0496100_0010922 3300048903 Bacteria 5155
445 Ga0496100_1496634 3300048903 Bacteria 533
446 Ga0496101_0057645 3300048904 Bacteria 2810
447 Ga0496101_0222969 3300048904 Bacteria 1463
448 Ga0496101_0481971 3300048904 Bacteria 979
449 Ga0496102_0026551 3300048905 Bacteria 5167
450 Ga0496102_0177082 3300048905 Bacteria 2008
451 Ga0496102_0456223 3300048905 Bacteria 1199
452 Ga0496102_1174933 3300048905 Bacteria 687
453 Ga0496103_0049684 3300048906 Bacteria 2594
454 Ga0496103_0343731 3300048906 Bacteria 960
455 Ga0496103_0381137 3300048906 Bacteria 906
456 Ga0496104_0119084 3300048907 Bacteria 2535
457 Ga0496104_0525339 3300048907 Bacteria 1094
458 Ga0496105_0223213 3300048908 Bacteria 1533
459 Ga0496105_0379989 3300048908 Bacteria 1124
460 Ga0496106_0043896 3300048909 Bacteria 3356
461 Ga0496106_0185087 3300048909 Bacteria 1654
462 Ga0496106_0211948 3300048909 Bacteria 1543
463 Ga0496106_0279461 3300048909 Bacteria 1337
464 Ga0496107_0486515 3300048910 Bacteria 915
465 Ga0496108_0016722 3300048911 Bacteria 5992
466 Ga0496108_0078073 3300048911 Bacteria 2802
467 Ga0496108_0629408 3300048911 Bacteria 934
468 Ga0496108_1188572 3300048911 Bacteria 645
469 Ga0496109_0028862 3300048912 Bacteria 4966
470 Ga0496109_0149021 3300048912 Bacteria 2190
471 Ga0496109_1209387 3300048912 Bacteria 692
472 Ga0496110_0080092 3300048913 Bacteria 2909
473 Ga0496110_0161957 3300048913 Bacteria 2028
474 Ga0496111_0209108 3300048914 Bacteria 1449
475 Ga0496112_0000169 3300048915 Bacteria 41507
476 Ga0496112_0044821 3300048915 Bacteria 4334
477 Ga0496113_0026716 3300048916 Bacteria 4130
478 Ga0496113_0038058 3300048916 Bacteria 3534
479 Ga0496114_0224189 3300048917 Bacteria 1650
480 Ga0496115_0097362 3300048918 Bacteria 2409
481 Ga0496115_0203027 3300048918 Bacteria 1637
482 Ga0496115_0229987 3300048918 Bacteria 1529
483 Ga0496115_1056311 3300048918 Bacteria 618
484 Ga0501034_0188216 3300049571 Unclassified 2027
485 Ga0501036_0031700 3300049572 Bacteria 4467
486 Ga0501038_0224562 3300049574 Bacteria 1497
487 Ga0501039_0886823 3300049575 Unclassified 694
488 Ga0501039_1289853 3300049575 Unclassified 564
489 Ga0501040_0039841 3300049576 Bacteria 3197
490 Ga0501042_0042832 3300049578 Bacteria 3223
491 Ga0501043_0313304 3300049579 Bacteria 1197
492 Ga0501046_0086217 3300049580 Bacteria 2421
493 Ga0501068_0177331 3300049584 Bacteria 1347
494 Ga0501071_1172043 3300049587 Unclassified 594
495 Ga0501073_0301828 3300049589 Bacteria 1105
496 Ga0501075_0085719 3300049591 Bacteria 2386
497 Ga0501076_0010475 3300049592 Bacteria 6882
498 Ga0501077_0181043 3300049593 Bacteria 1339
499 Ga0501079_0034975 3300049741 Bacteria 3866
500 Ga0501080_0093948 3300049742 Bacteria 2785
501 Ga0501081_0036279 3300049743 Bacteria 3361
502 Ga0501083_0656394 3300049744 Bacteria 682
503 Ga0501045_0202549 3300049824 Bacteria 1479
504 nmdc:mga03683_109078_c1 3300050489 Unclassified 1222
505 nmdc:mga03683_33825_c1 3300050489 Bacteria 2066
506 nmdc:mga03n38_221186_c1 3300050490 Bacteria 988
507 nmdc:mga0yw44_109676_c1 3300050492 Unclassified 1767
508 nmdc:mga0yw44_464273_c1 3300050492 Bacteria 858
509 nmdc:mga06z11_58970_c1 3300050494 Bacteria 1993
510 nmdc:mga04h51_245678_c1 3300050495 Bacteria 716
511 nmdc:mga07m45_373588_c1 3300050496 Bacteria 828
512 nmdc:mga07m45_536771_c1 3300050496 Bacteria 677
513 nmdc:mga05p37_2105724_c1 3300050507 Bacteria 528
514 nmdc:mga05p37_482899_c1 3300050507 Bacteria 1427
515 nmdc:mga05p37_643581_c1 3300050507 Bacteria 1189
516 nmdc:mga09592_680226_c1 3300050508 Bacteria 877
517 nmdc:mga08y16_1258726_c1 3300050511 Bacteria 708
518 nmdc:mga08y16_1350928_c1 3300050511 Bacteria 678
519 nmdc:mga08y16_62990_c1 3300050511 Bacteria 3873
520 nmdc:mga08x19_164096_c1 3300050514 Bacteria 1510
521 nmdc:mga0a205_633818_c1 3300050515 Bacteria 921
522 nmdc:mga0sz30_6106_c2 3300050516 Bacteria 3973
523 Ga0495601_0194106 3300053077 Bacteria 1327
524 Ga0500635_0008179 3300053080 Bacteria 2858
525 Ga0495619_0022705 3300053085 Bacteria 4018
526 Ga0495619_0475928 3300053085 Bacteria 860
527 Ga0500646_0015686 3300053090 Bacteria 1975
528 Ga0500647_0233437 3300053091 Bacteria 817
529 Ga0500566_0313816 3300053094 Bacteria 733
530 Ga0500641_0028734 3300053096 Bacteria 2174
531 Ga0500554_001219 3300053102 Bacteria 4991
532 Ga0500642_0188706 3300053130 Bacteria 962
533 Ga0500658_0291080 3300053134 Bacteria 751
534 Ga0500603_001499 3300053150 Bacteria 5325
535 Ga0500604_0066400 3300053151 Bacteria 1143
536 Ga0500616_0002247 3300053153 Bacteria 16514
537 Ga0500638_069292 3300053162 Bacteria 1688
538 Ga0500637_0002478 3300053178 Bacteria 8219
539 Ga0500609_042823 3300053731 Bacteria 627
540 Ga0500552_003608 3300053733 Bacteria 1582
541 Ga0501084_0087269 3300054114 Bacteria 2619
542 Ga0587066_162774 3300059490 Bacteria 562
543 Ga0587073_0114026 3300059492 Bacteria 721
544 Ga0587072_172287 3300059643 Bacteria 535
545 Ga0501082_0041968 3300060353 Bacteria 3944
546 Ga0530510_0204506 3300061734 Bacteria 1467
547 Ga0065712_10489214
548 JGI24744J21845_10021833
549 Ga0065715_10629955
550 Ga0070690_100064242
551 Ga0070690_100127423
552 Ga0070690_100195222
553 Ga0070670_100991996
554 Ga0070670_101636511
555 Ga0070677_10098338
556 Ga0068869_100097655
557 Ga0070666_10143348
558 Ga0068868_100114904
559 Ga0070660_100357151
560 Ga0070689_100120188
561 Ga0070689_100413192
562 Ga0070687_100762275
563 Ga0070661_100153772
564 Ga0070692_10094101
565 Ga0070692_10135687
566 Ga0070668_100298881
567 Ga0070668_101051349
568 Ga0070669_100039401
569 Ga0070669_101309084
570 Ga0070675_100123482
571 Ga0070671_100196199
572 Ga0070671_100212771
573 Ga0070671_100260000
574 Ga0070674_100127406
575 Ga0070673_100236211
576 Ga0070673_100979834
577 Ga0070673_102138462
578 Ga0070688_100920525
579 Ga0070688_101061439
580 Ga0070659_100189343
581 Ga0070659_100407502
582 Ga0070667_100306063
583 Ga0070667_100342826
584 Ga0070667_100378510
585 Ga0070703_10061746
586 Ga0070703_10148650
587 Ga0070709_10140761
588 Ga0070709_11036909
589 Ga0070713_102465301
590 Ga0070710_10618033
591 Ga0070710_11327778
592 Ga0070701_10618496
593 Ga0070711_100353851
594 Ga0070711_100461403
595 Ga0070705_100759697
596 Ga0070694_100222141
597 Ga0070694_101583343
598 Ga0070708_100062697
599 Ga0070708_101217692
600 Ga0070708_101480087
601 Ga0070708_101760118
602 Ga0070663_100701398
603 Ga0070678_100004019
604 Ga0070678_100100115
605 Ga0070678_100157420
606 Ga0070678_102122400
607 Ga0070681_10758843
608 Ga0070681_11267019
609 Ga0068867_101135941
610 Ga0068867_102205523
611 Ga0070685_10446089
612 Ga0070685_10834619
613 Ga0070706_100118310
614 Ga0070706_100139283
615 Ga0070706_100262655
616 Ga0070706_100499879
617 Ga0070707_100105819
618 Ga0070707_100258996
619 Ga0070707_100314853
620 Ga0070698_100032926
621 Ga0070698_100688156
622 Ga0070698_101035512
623 Ga0070698_101053881
624 Ga0070698_101995140
625 Ga0070699_100440349
626 Ga0070699_100494726
627 Ga0070699_100840386
628 Ga0070679_100133253
629 Ga0070684_100076182
630 Ga0070684_100920210
631 Ga0070697_100166026
632 Ga0070697_100500069
633 Ga0068853_100242381
634 Ga0068853_100887549
635 Ga0070686_101564852
636 Ga0070695_100114052
637 Ga0070695_100450098
638 Ga0070693_100498108
639 Ga0070693_101096878
640 Ga0070665_100107631
641 Ga0070665_101395656
642 Ga0070704_101122595
643 Ga0070704_102144784
644 Ga0068855_101427593
645 Ga0068854_101308958
646 Ga0068852_100040053
647 Ga0068859_100074206
648 Ga0068859_100076282
649 Ga0068859_101077574
650 Ga0068859_101351153
651 Ga0068864_100080078
652 Ga0068864_102287259
653 Ga0068866_10184542
654 Ga0068861_100166784
655 Ga0068861_101522331
656 Ga0068870_10058623
657 Ga0068870_10478685
658 Ga0068863_100238901
659 Ga0068863_100259364
660 Ga0068863_100437262
661 Ga0068858_100170576
662 Ga0068860_100212789
663 Ga0068860_100264977
664 Ga0068860_100511152
665 Ga0068862_100458020
666 Ga0068862_101953077
667 Ga0081455_10020605
668 Ga0081455_10039689
669 Ga0081455_10369517
670 Ga0081540_1003592
671 Ga0081540_1088129
672 Ga0070717_10025148
673 Ga0075365_10109466
674 Ga0075365_10298952
675 Ga0075365_10651932
676 Ga0075368_10300213
677 Ga0075363_100017007
678 Ga0075364_10297757
679 Ga0070716_100596831
680 Ga0070712_100317772
681 Ga0070712_100355029
682 Ga0075362_10009515
683 Ga0075362_10083371
684 Ga0075367_10017399
685 Ga0075369_10011960
686 Ga0075369_10177827
687 Ga0097621_100244231
688 Ga0075370_10289249
689 Ga0075370_10303505
690 Ga0068871_101143519
691 Ga0075428_100122649
692 Ga0075428_100239767
693 Ga0075430_100096935
694 Ga0075430_101571925
695 Ga0075431_100396653
696 Ga0075434_100430497
697 Ga0075434_100907649
698 Ga0068865_100056239
699 Ga0068865_100104089
700 Ga0068865_100183291
701 Ga0068865_100890254
702 Ga0068865_101485240
703 Ga0097620_100074205
704 Ga0097620_100076282
705 Ga0097620_101077571
706 Ga0097620_101351082
707 Ga0099794_10038639
708 Ga0099794_10058964
709 Ga0099794_10074472
710 Ga0099794_10112861
711 Ga0099794_10298416
712 Ga0099794_10740295
713 Ga0099795_10011943
714 Ga0099795_10057470
715 Ga0105251_10100887
716 Ga0105250_10528763
717 Ga0111539_10096402
718 Ga0111539_10369750
719 Ga0111539_10651650
720 Ga0105245_10162037
721 Ga0105245_12171100
722 Ga0105247_10632732
723 Ga0105247_11176414
724 Ga0114129_10649187
725 Ga0105243_10012652
726 Ga0105243_10465431
727 Ga0105243_12271392
728 Ga0105241_12176775
729 Ga0105242_10039348
730 Ga0105248_10174140
731 Ga0105248_10230462
732 Ga0105248_11318682
733 Ga0105248_11804647
734 Ga0105238_10447110
735 Ga0105238_10654023
736 Ga0105238_11983926
737 Ga0105249_10128405
738 Ga0105249_13088063
739 Ga0099796_10079925
740 Ga0099796_10140339
741 Ga0105246_10116598
742 Ga0105246_10920752
743 Ga0157373_10460137
744 Ga0157371_10449604
745 Ga0157370_11198389
746 Ga0157374_10166276
747 Ga0157378_10974147
748 Ga0163162_10136290
749 Ga0163162_10210670
750 Ga0157372_11486963
751 Ga0157375_10135456
752 Ga0157375_10142651
753 Ga0157375_11936269
754 Ga0163163_10564822
755 Ga0163163_10909003
756 Ga0157380_10204747
757 Ga0157380_10813948
758 Ga0157380_10844629
759 Ga0157380_11626779
760 Ga0157377_10166878
761 Ga0157377_10212691
762 Ga0157379_10043466
763 Ga0157379_11623007
764 Ga0157376_10444053
765 Ga0157376_10887489
766 Ga0163161_10270415
767 Ga0163161_10723987
768 Ga0224712_10126185
769 Ga0207653_10053145
770 Ga0207682_10222975
771 Ga0207682_10224629
772 Ga0207688_10051376
773 Ga0207680_10279262
774 Ga0207647_10147331
775 Ga0207647_10195017
776 Ga0207699_10625323
777 Ga0207643_10088729
778 Ga0207643_10112122
779 Ga0207705_10199112
780 Ga0207684_10146312
781 Ga0207684_10192838
782 Ga0207684_10325248
783 Ga0207654_10988423
784 Ga0207707_10170187
785 Ga0207707_11635891
786 Ga0207671_10291637
787 Ga0207671_10541584
788 Ga0207693_10585098
789 Ga0207663_10012046
790 Ga0207663_10364949
791 Ga0207660_10018533
792 Ga0207660_10882118
793 Ga0207657_10052273
794 Ga0207657_10384965
795 Ga0207649_10245800
796 Ga0207646_10062089
797 Ga0207646_10159377
798 Ga0207646_10194999
799 Ga0207681_10040524
800 Ga0207681_11800848
801 Ga0207694_10423464
802 Ga0207694_10488244
803 Ga0207650_10748821
804 Ga0207687_10536434
805 Ga0207687_10916773
806 Ga0207687_11016989
807 Ga0207644_10036693
808 Ga0207690_10219249
809 Ga0207706_10025687
810 Ga0207686_11041391
811 Ga0207670_10561695
812 Ga0207670_11419729
813 Ga0207669_10324676
814 Ga0207669_11375158
815 Ga0207704_10149752
816 Ga0207704_10353250
817 Ga0207704_10823727
818 Ga0207665_10093696
819 Ga0207665_10974997
820 Ga0207691_10064525
821 Ga0207691_10158162
822 Ga0207691_10316327
823 Ga0207711_10082209
824 Ga0207711_10795663
825 Ga0207689_10600770
826 Ga0207661_10421891
827 Ga0207679_10865943
828 Ga0207667_10655971
829 Ga0207651_10050071
830 Ga0207651_10168009
831 Ga0207651_10488516
832 Ga0207668_10730102
833 Ga0207640_10331824
834 Ga0207640_10415848
835 Ga0207658_10012012
836 Ga0207658_10176143
837 Ga0207658_10876670
838 Ga0207677_10061422
839 Ga0207703_10138696
840 Ga0207639_10307943
841 Ga0207639_10436248
842 Ga0207639_10922346
843 Ga0207678_10282411
844 Ga0207708_10050103
845 Ga0207708_10388754
846 Ga0207641_10024950
847 Ga0207641_11125445
848 Ga0207648_10138634
849 Ga0207648_10274027
850 Ga0207648_10284048
851 Ga0207676_10016103
852 Ga0207676_10722077
853 Ga0207676_11332994
854 Ga0207675_100024047
855 Ga0207675_101513545
856 Ga0207675_101533160
857 Ga0207683_10007219
858 Ga0207698_10494294
859 Ga0209588_1114299
860 Ga0268266_10237831
861 Ga0268266_10754032
862 Ga0268265_10012758
863 Ga0268265_11650250
864 Ga0268264_10120124
865 Ga0268264_10608528
866 Ga0268264_10744214
867 Ga0307508_10088970
868 Ga0307407_10078362
869 Ga0307409_100411046
870 Ga0307411_10065280
871 Ga0307510_10025120
872 Ga0373930_0091657
873 Ga0373940_0343101
874 Ga0373949_0192904
875 Ga0373951_0012018
876 Ga0373923_0013844
877 Ga0373936_0056486
878 Ga0373953_0047618
879 Ga0373954_0034007
880 Ga0373956_0135008
881 Ga0373960_0022651
882 Ga0373943_0068773
883 Ga0373943_0156427
884 Ga0373943_0376081
885 Ga0373946_0002941
886 Ga0373955_0480425
887 Ga0373955_1031690
888 Ga0373962_0023627
889 Ga0373931_0000725
890 Ga0373935_0000583
891 Ga0373935_0410455
892 Ga0373927_0000464
893 Ga0373927_0348120
894 Ga0373933_0135352
895 Ga0373947_0004527
896 Ga0373947_1003401
897 Ga0373937_0014146
898 Ga0373937_0715485
899 Ga0373925_0001896
900 Ga0373925_0129552
901 Ga0395900_0928876
902 Ga0395898_0254543
903 Ga0395905_0066261
904 Ga0395905_0154417
905 Ga0395905_0200646
906 Ga0395905_0297419
907 Ga0395901_0128352
908 Ga0395901_0373548
909 Ga0242420_028644
910 Ga0436365_1834697
911 Ga0436361_0485903
912 Ga0436362_0640009
913 Ga0439453_0000426
914 Ga0439465_0058048
915 Ga0451797_0747677
916 Ga0451845_0080544
917 Ga0439441_184439
918 Ga0439443_030671
919 Ga0439435_0002578
920 Ga0439444_0030627
921 Ga0439464_0179640
922 Ga0439460_0022723
923 Ga0439460_0362675
924 Ga0439440_0244389
925 Ga0453684_1710078
926 Ga0451576_0822976
927 Ga0495592_0017029
928 Ga0495603_0000029
929 Ga0495603_0004050
930 Ga0495603_0273702
931 Ga0495629_0000029
932 Ga0495629_0009098
933 Ga0495638_0014004
934 Ga0495638_0433661
935 Ga0495641_0001748
936 Ga0495580_0000321
937 Ga0495580_0253205
938 Ga0495580_0835428
939 Ga0495582_0000024
940 Ga0495582_0348389
941 Ga0495639_0000006
942 Ga0495662_0000068
943 Ga0495662_0218734
944 Ga0495664_0003926
945 Ga0495664_0739908
946 Ga0495594_0000806
947 Ga0495628_0056201
948 Ga0495630_0000497
949 Ga0495631_0528192
950 Ga0495663_0319819
951 Ga0495666_0025453
952 Ga0495652_0049962
953 Ga0495665_0260743
954 Ga0495640_0208675
955 Ga0495598_0161635
956 Ga0495621_0036579
957 Ga0495622_0001732
958 Ga0495667_0025100
959 Ga0495667_0552434
960 Ga0495668_0735177
961 Ga0495634_0002262
962 Ga0495634_0034366
963 Ga0495635_0000179
964 Ga0495635_0152634
965 Ga0495588_0018170
966 Ga0495599_0007169
967 Ga0495647_0010234
968 Ga0495658_0000736
969 Ga0495613_0003681
970 Ga0495613_0053699
971 Ga0495624_0000698
972 Ga0495671_0242325
973 Ga0495600_0108153
974 Ga0495581_0000004
975 Ga0495581_0085544
976 Ga0495674_0005737
977 Ga0495674_0178031
978 Ga0495674_0341802
979 Ga0495672_0062656
980 Ga0495672_0556948
981 Ga0495676_0692719
982 Ga0495676_0701904
983 Ga0495675_0144299
984 Ga0495673_0026889
985 Ga0495684_0058056
986 Ga0495684_0160966
987 Ga0495593_0000278
988 Ga0495614_0030345
989 Ga0495615_0136684
990 Ga0496100_0010922
991 Ga0496100_1496634
992 Ga0496101_0057645
993 Ga0496101_0222969
994 Ga0496101_0481971
995 Ga0496102_0026551
996 Ga0496102_0177082
997 Ga0496102_0456223
998 Ga0496102_1174933
999 Ga0496103_0049684
1000 Ga0496103_0343731
1001 Ga0496103_0381137
1002 Ga0496104_0119084
1003 Ga0496104_0525339
1004 Ga0496105_0223213
1005 Ga0496105_0379989
1006 Ga0496106_0043896
1007 Ga0496106_0185087
1008 Ga0496106_0211948
1009 Ga0496106_0279461
1010 Ga0496107_0486515
1011 Ga0496108_0016722
1012 Ga0496108_0078073
1013 Ga0496108_0629408
1014 Ga0496108_1188572
1015 Ga0496109_0028862
1016 Ga0496109_0149021
1017 Ga0496109_1209387
1018 Ga0496110_0080092
1019 Ga0496110_0161957
1020 Ga0496111_0209108
1021 Ga0496112_0000169
1022 Ga0496112_0044821
1023 Ga0496113_0026716
1024 Ga0496113_0038058
1025 Ga0496114_0224189
1026 Ga0496115_0097362
1027 Ga0496115_0203027
1028 Ga0496115_0229987
1029 Ga0496115_1056311
1030 Ga0501034_0188216
1031 Ga0501036_0031700
1032 Ga0501038_0224562
1033 Ga0501039_0886823
1034 Ga0501039_1289853
1035 Ga0501040_0039841
1036 Ga0501042_0042832
1037 Ga0501043_0313304
1038 Ga0501046_0086217
1039 Ga0501068_0177331
1040 Ga0501071_1172043
1041 Ga0501073_0301828
1042 Ga0501075_0085719
1043 Ga0501076_0010475
1044 Ga0501077_0181043
1045 Ga0501079_0034975
1046 Ga0501080_0093948
1047 Ga0501081_0036279
1048 Ga0501083_0656394
1049 Ga0501045_0202549
1050 nmdc:mga03683_109078_c1
1051 nmdc:mga03683_33825_c1
1052 nmdc:mga03n38_221186_c1
1053 nmdc:mga0yw44_109676_c1
1054 nmdc:mga0yw44_464273_c1
1055 nmdc:mga06z11_58970_c1
1056 nmdc:mga04h51_245678_c1
1057 nmdc:mga07m45_373588_c1
1058 nmdc:mga07m45_536771_c1
1059 nmdc:mga05p37_2105724_c1
1060 nmdc:mga05p37_482899_c1
1061 nmdc:mga05p37_643581_c1
1062 nmdc:mga09592_680226_c1
1063 nmdc:mga08y16_1258726_c1
1064 nmdc:mga08y16_1350928_c1
1065 nmdc:mga08y16_62990_c1
1066 nmdc:mga08x19_164096_c1
1067 nmdc:mga0a205_633818_c1
1068 nmdc:mga0sz30_6106_c2
1069 Ga0495601_0194106
1070 Ga0500635_0008179
1071 Ga0495619_0022705
1072 Ga0495619_0475928
1073 Ga0500646_0015686
1074 Ga0500647_0233437
1075 Ga0500566_0313816
1076 Ga0500641_0028734
1077 Ga0500554_001219
1078 Ga0500642_0188706
1079 Ga0500658_0291080
1080 Ga0500603_001499
1081 Ga0500604_0066400
1082 Ga0500616_0002247
1083 Ga0500638_069292
1084 Ga0500637_0002478
1085 Ga0500609_042823
1086 Ga0500552_003608
1087 Ga0501084_0087269
1088 Ga0587066_162774
1089 Ga0587073_0114026
1090 Ga0587072_172287
1091 Ga0501082_0041968
1092 Ga0530510_0204506

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

18

139

0.83

PF13577

SnoaL_4

SnoaL-like domain

13

143

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.8859 6 116
6of8-assembly1.cif.gz_G-2 structure of thr354asn, glu355gln, thr412asn, ile414met, ile464his, and phe467met mutant human camkii-alpha hub domain 0.8613 1 116
5ig5-assembly1.cif.gz_B-2 crystal structure of n. vectensis camkii-b hub at ph 4.2 0.8594 6 116
3f7s-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution 0.8593 1 116
5ig5-assembly1.cif.gz_D-2 crystal structure of n. vectensis camkii-b hub at ph 4.2 0.8587 1 116
ID Description Score Start End Superfamily
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8887 4 116 3.10.450.50
af_F4IZV9_103_223_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8597 1 112 3.10.450.50
5ig5B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8594 6 116 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8537 4 116 3.10.450.50
af_G5ECA7_6_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8534 8 115 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A537MT40-F1-model_v4 Nuclear transport factor 2 family protein 1 1 117
AF-A0A0D1LKD6-F1-model_v4 deleted 0.9977 1 117
AF-A0A6J4VET5-F1-model_v4 DUF4440 domain-containing protein 0.997 2 117
AF-A0A2V6QE11-F1-model_v4 DUF4440 domain-containing protein 0.9957 4 117
AF-A0A2V6U560-F1-model_v4 DUF4440 domain-containing protein 0.9953 4 108

Map