F461910

General Info

Members Datasets Scaffolds Average Seq Length
545 293 1090 229

Family's Representative Sequence

Representative Sequence 3300048923|Ga0496120_0029080|Ga0496120_0029080_2609_3298
Length 221
Sequence MRVLVVEDEPYLAEAIRDGLRLEAIAADIAGDGHAALELLRINSYDIAVLDRDIPGPSGDEIAASIVASLTAADRIDDKASGFELGADDYLTKPFELRELVLRLRALDRRRARRRPPVHELAGLRLDPFRREVYRDGRYVGLTRKQFAVLEVLMAAEGGVVSAEDLLEQAWDENADPFTNAVRITVSALRKRLGEPWVITTVPGVGYRIGATIPPEQDVHD

Samples

Sample ID Description Type Environment
1 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
158 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
159 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
274 2643221561 Nocardioides sp. Root151 Isolate Unclassified
275 2643221696 Nocardioides sp. Root140 Isolate Unclassified
276 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
277 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
278 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
279 2808606394 Promicromonospora sp. C35 Isolate Unclassified
280 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
281 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
282 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
283 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
284 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
285 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
286 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
287 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
288 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
289 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
290 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
291 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
292 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
293 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 0.18
Isolates 4.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.44
Nodule 0.37
Rhizoplane 8.62
Rhizosphere 75.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496120_0029080 3300048923 Bacteria 3377
2 JGI25405J52794_10025448 3300003911 Bacteria 1213
3 Ga0070658_10170588 3300005327 Bacteria 1828
4 Ga0070658_10290902 3300005327 Bacteria 1392
5 Ga0070683_100723143 3300005329 Bacteria 954
6 Ga0070683_100845351 3300005329 Bacteria 878
7 Ga0070682_100029267 3300005337 Bacteria 3316
8 Ga0068868_100628976 3300005338 Bacteria 954
9 Ga0070689_100954013 3300005340 Bacteria 761
10 Ga0070661_100125947 3300005344 Bacteria 1922
11 Ga0070668_100386126 3300005347 Bacteria 1193
12 Ga0070671_100001630 3300005355 Bacteria 16927
13 Ga0070674_100017322 3300005356 Bacteria 4529
14 Ga0070659_100470957 3300005366 Bacteria 1068
15 Ga0070667_100008457 3300005367 Bacteria 8534
16 Ga0070714_100536384 3300005435 Bacteria 1119
17 Ga0070714_101099182 3300005435 Bacteria 775
18 Ga0070713_100138429 3300005436 Bacteria 2154
19 Ga0070713_100424151 3300005436 Bacteria 1246
20 Ga0070710_10348892 3300005437 Bacteria 979
21 Ga0070708_100046858 3300005445 Bacteria 3816
22 Ga0070663_100054052 3300005455 Bacteria 2869
23 Ga0070663_100813907 3300005455 Bacteria 802
24 Ga0070662_100297279 3300005457 Bacteria 1311
25 Ga0070681_10205184 3300005458 Bacteria 1888
26 Ga0070707_100027778 3300005468 Bacteria 5383
27 Ga0070698_100085959 3300005471 Bacteria 3132
28 Ga0070679_100043054 3300005530 Bacteria 4497
29 Ga0070684_100139976 3300005535 Bacteria 2188
30 Ga0068853_100378807 3300005539 Bacteria 1321
31 Ga0070665_100000151 3300005548 Bacteria 127579
32 Ga0070665_100000583 3300005548 Bacteria 50878
33 Ga0070665_100003955 3300005548 Bacteria 15630
34 Ga0068855_100166024 3300005563 Bacteria 2502
35 Ga0068855_100570054 3300005563 Bacteria 1224
36 Ga0070664_100057338 3300005564 Bacteria 3311
37 Ga0070664_100633744 3300005564 Bacteria 993
38 Ga0070664_101003549 3300005564 Bacteria 785
39 Ga0068856_100024530 3300005614 Bacteria 5871
40 Ga0068856_100892778 3300005614 Bacteria 908
41 Ga0070702_100058560 3300005615 Bacteria 2232
42 Ga0068852_100500449 3300005616 Bacteria 1210
43 Ga0068859_100006971 3300005617 Bacteria 11471
44 Ga0068864_100079017 3300005618 Bacteria 2880
45 Ga0068861_100181477 3300005719 Bacteria 1752
46 Ga0068863_100000675 3300005841 Bacteria 34506
47 Ga0068863_100106729 3300005841 Bacteria 2665
48 Ga0068858_100000209 3300005842 Bacteria 63108
49 Ga0068858_100032809 3300005842 Bacteria 4823
50 Ga0068860_100000214 3300005843 Bacteria 90752
51 Ga0068860_100000669 3300005843 Bacteria 39653
52 Ga0068862_100000009 3300005844 Bacteria 298620
53 Ga0081455_10001559 3300005937 Bacteria 28153
54 Ga0081455_10004637 3300005937 Bacteria 15313
55 Ga0081455_10075782 3300005937 Bacteria 2774
56 Ga0081538_10041476 3300005981 Bacteria 2921
57 Ga0081538_10159184 3300005981 Bacteria 1007
58 Ga0081539_10038588 3300005985 Bacteria 2828
59 Ga0081539_10100683 3300005985 Bacteria 1473
60 Ga0081539_10163861 3300005985 Bacteria 1057
61 Ga0075365_10000393 3300006038 Bacteria 15999
62 Ga0075365_10006069 3300006038 Bacteria 6601
63 Ga0075365_10046159 3300006038 Bacteria 2860
64 Ga0075365_10047537 3300006038 Bacteria 2821
65 Ga0075365_10069520 3300006038 Bacteria 2366
66 Ga0075365_10121587 3300006038 Bacteria 1801
67 Ga0075368_10001237 3300006042 Bacteria 8070
68 Ga0075368_10032725 3300006042 Bacteria 2021
69 Ga0075363_100005322 3300006048 Bacteria 5712
70 Ga0075363_100018011 3300006048 Bacteria 3512
71 Ga0075363_100187260 3300006048 Bacteria 1180
72 Ga0075364_10011197 3300006051 Bacteria 5445
73 Ga0075364_10011797 3300006051 Bacteria 5319
74 Ga0075364_10034354 3300006051 Bacteria 3270
75 Ga0075364_10068219 3300006051 Bacteria 2339
76 Ga0075364_10163703 3300006051 Bacteria 1502
77 Ga0075364_10228486 3300006051 Bacteria 1264
78 Ga0075364_10233524 3300006051 Bacteria 1249
79 Ga0075432_10016139 3300006058 Bacteria 2550
80 Ga0070715_10156916 3300006163 Bacteria 1121
81 Ga0075362_10079478 3300006177 Bacteria 1510
82 Ga0075367_10018094 3300006178 Bacteria 3881
83 Ga0075367_10321714 3300006178 Bacteria 975
84 Ga0075369_10225821 3300006186 Bacteria 867
85 Ga0075370_10005476 3300006353 Bacteria 6318
86 Ga0075370_10091950 3300006353 Bacteria 1751
87 Ga0075428_100002979 3300006844 Bacteria 18450
88 Ga0075428_100733323 3300006844 Bacteria 1052
89 Ga0075430_100039792 3300006846 Bacteria 3979
90 Ga0075431_100000561 3300006847 Bacteria 31306
91 Ga0075431_100000598 3300006847 Bacteria 30383
92 Ga0075433_10008956 3300006852 Bacteria 7990
93 Ga0075433_10023586 3300006852 Bacteria 5180
94 Ga0075433_10072680 3300006852 Bacteria 3025
95 Ga0075433_10095505 3300006852 Bacteria 2631
96 Ga0075433_10106026 3300006852 Bacteria 2490
97 Ga0075434_100011587 3300006871 Bacteria 8324
98 Ga0075434_100020948 3300006871 Bacteria 6350
99 Ga0075434_100149642 3300006871 Bacteria 2354
100 Ga0075429_100004839 3300006880 Bacteria 11599
101 Ga0075429_100193352 3300006880 Bacteria 1782
102 Ga0075436_100018088 3300006914 Bacteria 4826
103 Ga0075436_100278395 3300006914 Bacteria 1196
104 Ga0075436_100332060 3300006914 Bacteria 1094
105 Ga0097620_100006971 3300006931 Bacteria 11471
106 Ga0075435_100014847 3300007076 Bacteria 5840
107 Ga0075435_100044492 3300007076 Bacteria 3555
108 Ga0105240_10024506 3300009093 Bacteria 7950
109 Ga0105240_10278382 3300009093 Bacteria 1923
110 Ga0111539_10039524 3300009094 Bacteria 5685
111 Ga0111539_10093355 3300009094 Bacteria 3535
112 Ga0111539_10094071 3300009094 Bacteria 3521
113 Ga0111539_10498132 3300009094 Bacteria 1419
114 Ga0105245_10036514 3300009098 Bacteria 4366
115 Ga0105245_10129173 3300009098 Bacteria 2369
116 Ga0105247_10002111 3300009101 Bacteria 13744
117 Ga0105247_10722070 3300009101 Bacteria 752
118 Ga0114129_10014342 3300009147 Bacteria 11295
119 Ga0105243_10395332 3300009148 Bacteria 1282
120 Ga0105243_10460324 3300009148 Bacteria 1196
121 Ga0105248_10244978 3300009177 Bacteria 2018
122 Ga0105238_10177495 3300009551 Bacteria 2107
123 Ga0105239_10760689 3300010375 Bacteria 1109
124 Ga0105239_10818926 3300010375 Bacteria 1067
125 Ga0157335_1010390 3300012492 Bacteria 747
126 Ga0157370_10048698 3300013104 Bacteria 4059
127 Ga0157370_10082246 3300013104 Bacteria 3029
128 Ga0157369_10016081 3300013105 Bacteria 8418
129 Ga0157369_10028744 3300013105 Bacteria 6149
130 Ga0157369_10092871 3300013105 Bacteria 3222
131 Ga0157369_10312115 3300013105 Bacteria 1635
132 Ga0157374_10995108 3300013296 Bacteria 857
133 Ga0157374_11380154 3300013296 Bacteria 727
134 Ga0163162_10682213 3300013306 Bacteria 1150
135 Ga0157372_10022342 3300013307 Bacteria 6844
136 Ga0157372_10051630 3300013307 Bacteria 4576
137 Ga0157372_10153545 3300013307 Bacteria 2658
138 Ga0157372_10212954 3300013307 Bacteria 2239
139 Ga0157372_10219247 3300013307 Bacteria 2205
140 Ga0157375_10252680 3300013308 Bacteria 1924
141 Ga0157379_10000611 3300014968 Bacteria 28845
142 Ga0157379_10254267 3300014968 Bacteria 1596
143 Ga0157376_10280270 3300014969 Bacteria 1570
144 Ga0183367_1012 3300015688 Bacteria 347438
145 Ga0163161_10361049 3300017792 Bacteria 1157
146 Ga0206353_10720512 3300020082 Bacteria 1386
147 Ga0213874_10038945 3300021377 Bacteria 1414
148 Ga0213876_10000836 3300021384 Bacteria 20742
149 Ga0213876_10033648 3300021384 Bacteria 2702
150 Ga0213876_10113900 3300021384 Bacteria 1435
151 Ga0213875_10030759 3300021388 Bacteria 2541
152 Ga0213875_10193908 3300021388 Bacteria 955
153 Ga0207692_10188146 3300025898 Bacteria 1207
154 Ga0207710_10000108 3300025900 Bacteria 105251
155 Ga0207688_10513313 3300025901 Bacteria 751
156 Ga0207680_10016272 3300025903 Bacteria 3901
157 Ga0207685_10129893 3300025905 Bacteria 1117
158 Ga0207705_10230419 3300025909 Bacteria 1409
159 Ga0207707_10018464 3300025912 Bacteria 6080
160 Ga0207707_10598919 3300025912 Bacteria 933
161 Ga0207695_10090313 3300025913 Bacteria 3079
162 Ga0207660_10037781 3300025917 Bacteria 3367
163 Ga0207649_10097522 3300025920 Bacteria 1939
164 Ga0207652_10023548 3300025921 Bacteria 5101
165 Ga0207646_10192069 3300025922 Bacteria 1844
166 Ga0207694_10127944 3300025924 Bacteria 2034
167 Ga0207687_10050928 3300025927 Bacteria 2885
168 Ga0207687_10277977 3300025927 Bacteria 1341
169 Ga0207700_10046277 3300025928 Bacteria 3216
170 Ga0207700_10362889 3300025928 Bacteria 1263
171 Ga0207644_10065014 3300025931 Bacteria 2651
172 Ga0207690_10113211 3300025932 Bacteria 1958
173 Ga0207706_10217423 3300025933 Bacteria 1674
174 Ga0207709_10281602 3300025935 Bacteria 1228
175 Ga0207670_10505472 3300025936 Bacteria 982
176 Ga0207669_10241937 3300025937 Bacteria 1338
177 Ga0207689_10126078 3300025942 Bacteria 2106
178 Ga0207661_10100205 3300025944 Bacteria 2431
179 Ga0207661_10115092 3300025944 Bacteria 2281
180 Ga0207679_10013912 3300025945 Bacteria 5275
181 Ga0207679_11022093 3300025945 Bacteria 758
182 Ga0207667_10842997 3300025949 Bacteria 911
183 Ga0207712_10004245 3300025961 Bacteria 9039
184 Ga0207712_10176930 3300025961 Bacteria 1672
185 Ga0207668_10120582 3300025972 Bacteria 1985
186 Ga0207668_10190147 3300025972 Bacteria 1626
187 Ga0207640_10029354 3300025981 Bacteria 3375
188 Ga0207658_10027346 3300025986 Bacteria 4006
189 Ga0207677_10168611 3300026023 Bacteria 1709
190 Ga0207703_10000235 3300026035 Bacteria 63296
191 Ga0207703_10007328 3300026035 Bacteria 8770
192 Ga0207678_10079081 3300026067 Bacteria 2816
193 Ga0207678_10278651 3300026067 Bacteria 1435
194 Ga0207708_10414324 3300026075 Bacteria 1116
195 Ga0207702_10024318 3300026078 Bacteria 5025
196 Ga0207641_10002292 3300026088 Bacteria 17819
197 Ga0207676_10136001 3300026095 Bacteria 2097
198 Ga0209813_10002370 3300027866 Bacteria 4320
199 Ga0209813_10151880 3300027866 Bacteria 830
200 Ga0207428_10001600 3300027907 Bacteria 23543
201 Ga0207428_10008318 3300027907 Bacteria 9376
202 Ga0207428_10086352 3300027907 Bacteria 2442
203 Ga0268266_10005006 3300028379 Bacteria 12517
204 Ga0268266_10005991 3300028379 Bacteria 11219
205 Ga0268266_10009215 3300028379 Bacteria 8709
206 Ga0268265_10000173 3300028380 Bacteria 77372
207 Ga0268265_10166276 3300028380 Bacteria 1880
208 Ga0268264_10000027 3300028381 Bacteria 440852
209 Ga0268264_10000510 3300028381 Bacteria 50047
210 Ga0307512_10226871 3300030522 Bacteria 966
211 Ga0265325_10061537 3300031241 Bacteria 1904
212 Ga0307513_10096384 3300031456 Bacteria 2996
213 Ga0307514_10015051 3300031649 Bacteria 6389
214 Ga0307514_10044158 3300031649 Bacteria 3494
215 Ga0307516_10014114 3300031730 Bacteria 8469
216 Ga0307405_10000334 3300031731 Bacteria 17497
217 Ga0307405_10163166 3300031731 Bacteria 1581
218 Ga0307405_10412315 3300031731 Bacteria 1061
219 Ga0307413_10484036 3300031824 Bacteria 990
220 Ga0307518_10000537 3300031838 Bacteria 28756
221 Ga0307410_10210200 3300031852 Bacteria 1490
222 Ga0307406_10030726 3300031901 Bacteria 3264
223 Ga0307406_10333672 3300031901 Bacteria 1178
224 Ga0307409_100000066 3300031995 Bacteria 38497
225 Ga0307409_100061403 3300031995 Bacteria 2937
226 Ga0307409_100182309 3300031995 Bacteria 1860
227 Ga0307409_100294946 3300031995 Bacteria 1505
228 Ga0307416_100003023 3300032002 Bacteria 9824
229 Ga0307416_100326126 3300032002 Bacteria 1540
230 Ga0307411_10062381 3300032005 Bacteria 2486
231 Ga0307411_10068975 3300032005 Bacteria 2386
232 Ga0307415_100000199 3300032126 Bacteria 26672
233 Ga0307415_100068395 3300032126 Bacteria 2486
234 Ga0307415_100364747 3300032126 Bacteria 1221
235 Ga0307510_10042351 3300033180 Bacteria 4963
236 Ga0373953_0179272 3300035117 Bacteria 914
237 Ga0373931_0094329 3300035691 Bacteria 1673
238 Ga0373947_0058096 3300035725 Bacteria 2343
239 Ga0373937_0246137 3300036401 Bacteria 1685
240 Ga0395899_0109235 3300037312 Bacteria 1990
241 Ga0395899_0189524 3300037312 Bacteria 1439
242 Ga0395900_0039851 3300037418 Bacteria 4841
243 Ga0395900_0154857 3300037418 Bacteria 2341
244 Ga0395900_0165342 3300037418 Bacteria 2255
245 Ga0395900_0254869 3300037418 Bacteria 1754
246 Ga0395900_0336722 3300037418 Bacteria 1485
247 Ga0395898_0001953 3300037466 Bacteria 26076
248 Ga0395898_0043019 3300037466 Bacteria 4452
249 Ga0395898_0076734 3300037466 Bacteria 3226
250 Ga0395898_0099799 3300037466 Bacteria 2788
251 Ga0395898_0238918 3300037466 Bacteria 1733
252 Ga0395905_0148135 3300037471 Bacteria 2208
253 Ga0395905_0250738 3300037471 Bacteria 1653
254 Ga0436364_0070967 3300037853 Bacteria 8272
255 Ga0436364_0427145 3300037853 Bacteria 1288
256 Ga0436364_1537202 3300037853 Bacteria 4540
257 Ga0395901_0042302 3300038443 Bacteria 4723
258 Ga0395901_0059020 3300038443 Bacteria 3991
259 Ga0395901_0061173 3300038443 Bacteria 3918
260 Ga0395901_0065444 3300038443 Bacteria 3785
261 Ga0395901_0102264 3300038443 Bacteria 3007
262 Ga0395901_0110022 3300038443 Bacteria 2892
263 Ga0395901_0116677 3300038443 Bacteria 2804
264 Ga0395901_0874607 3300038443 Bacteria 882
265 Ga0436365_0643996 3300039437 Bacteria 957
266 Ga0436365_1334006 3300039437 Bacteria 20730
267 Ga0436365_1900929 3300039437 Bacteria 2481
268 Ga0436362_0179562 3300039453 Bacteria 1208
269 Ga0439439_0000790 3300041406 Bacteria 5745
270 Ga0439466_0116770 3300041411 Bacteria 825
271 Ga0451791_1746377 3300041451 Bacteria 1510
272 Ga0439449_0036060 3300042007 Bacteria 1839
273 Ga0439457_015329 3300042014 Bacteria 1712
274 Ga0439459_0024195 3300042438 Bacteria 1189
275 Ga0439464_0013535 3300042439 Bacteria 2186
276 Ga0466969_0117054 3300044656 Bacteria 1243
277 Ga0466972_0066376 3300044658 Bacteria 1725
278 Ga0466972_0219241 3300044658 Bacteria 890
279 Ga0466965_0037285 3300044683 Bacteria 2387
280 Ga0466966_0208863 3300044684 Bacteria 1180
281 Ga0466961_0063741 3300044693 Bacteria 2342
282 Ga0466961_0235386 3300044693 Bacteria 1126
283 Ga0466963_0009960 3300044694 Bacteria 5742
284 Ga0466963_0014997 3300044694 Bacteria 4789
285 Ga0466963_0062528 3300044694 Bacteria 2490
286 Ga0466963_0083975 3300044694 Bacteria 2160
287 Ga0466963_0131050 3300044694 Bacteria 1732
288 Ga0466963_0489765 3300044694 Bacteria 868
289 Ga0466964_0014531 3300044706 Bacteria 2994
290 Ga0466964_0296146 3300044706 Bacteria 814
291 Ga0466971_0014969 3300044719 Bacteria 3412
292 Ga0466971_0032614 3300044719 Bacteria 2333
293 Ga0466971_0180554 3300044719 Bacteria 992
294 Ga0466970_0077183 3300044765 Bacteria 1795
295 Ga0466970_0089589 3300044765 Bacteria 1669
296 Ga0466970_0234716 3300044765 Bacteria 1026
297 Ga0466957_0064084 3300044842 Bacteria 2260
298 Ga0466957_0097097 3300044842 Bacteria 1853
299 Ga0466957_0234024 3300044842 Bacteria 1217
300 Ga0466957_0283462 3300044842 Bacteria 1109
301 Ga0466957_0338974 3300044842 Bacteria 1018
302 Ga0466957_0548984 3300044842 Bacteria 805
303 Ga0466957_0594869 3300044842 Bacteria 774
304 Ga0466960_0159399 3300044901 Bacteria 1211
305 Ga0466959_0029320 3300045049 Bacteria 4077
306 Ga0466959_0116871 3300045049 Bacteria 1899
307 Ga0466959_0232622 3300045049 Bacteria 1275
308 Ga0451576_0895151 3300045051 Bacteria 931
309 Ga0466958_0025773 3300045836 Bacteria 3470
310 Ga0466958_0081154 3300045836 Bacteria 1995
311 Ga0466967_0001962 3300045976 Bacteria 12456
312 Ga0466967_0031564 3300045976 Bacteria 4461
313 Ga0466967_0115508 3300045976 Bacteria 2472
314 Ga0466967_0259847 3300045976 Bacteria 1661
315 Ga0466967_0372489 3300045976 Bacteria 1385
316 Ga0466967_0401895 3300045976 Bacteria 1333
317 Ga0466967_0447213 3300045976 Bacteria 1262
318 Ga0466967_0705701 3300045976 Bacteria 999
319 Ga0466967_0826821 3300045976 Bacteria 920
320 Ga0495627_007487 3300046453 Bacteria 4175
321 Ga0495592_0019850 3300046454 Bacteria 5110
322 Ga0495592_0021813 3300046454 Bacteria 4872
323 Ga0495603_0001645 3300046455 Bacteria 13102
324 Ga0495603_0016911 3300046455 Bacteria 4414
325 Ga0495603_0036038 3300046455 Bacteria 2970
326 Ga0495603_0168501 3300046455 Bacteria 1269
327 Ga0495629_0029584 3300046459 Bacteria 3883
328 Ga0495629_0145602 3300046459 Bacteria 1648
329 Ga0495651_0024419 3300046462 Bacteria 4702
330 Ga0495651_0133070 3300046462 Bacteria 1813
331 Ga0495653_0348669 3300046463 Bacteria 953
332 Ga0495650_0000063 3300046471 Bacteria 277841
333 Ga0495580_0285737 3300046472 Bacteria 1125
334 Ga0495582_0214631 3300046473 Bacteria 1100
335 Ga0495639_0305331 3300046475 Bacteria 794
336 Ga0495594_0180741 3300046499 Bacteria 1201
337 Ga0495607_0189028 3300046501 Bacteria 1027
338 Ga0495608_0009284 3300046511 Bacteria 6877
339 Ga0495618_0040486 3300046514 Bacteria 2933
340 Ga0495618_0132149 3300046514 Bacteria 1597
341 Ga0495618_0428472 3300046514 Bacteria 806
342 Ga0495628_0011328 3300046516 Bacteria 7547
343 Ga0495630_0036347 3300046517 Bacteria 3682
344 Ga0495652_0112001 3300046529 Bacteria 2193
345 Ga0495652_0246550 3300046529 Bacteria 1326
346 Ga0495640_0006105 3300046533 Bacteria 9551
347 Ga0495640_0051952 3300046533 Bacteria 2815
348 Ga0495640_0208955 3300046533 Bacteria 1235
349 Ga0495587_0242221 3300046536 Bacteria 1015
350 Ga0495667_0003165 3300046559 Bacteria 11040
351 Ga0495667_0404070 3300046559 Bacteria 860
352 Ga0495634_0007161 3300046642 Bacteria 8410
353 Ga0495634_0107798 3300046642 Bacteria 1793
354 Ga0495635_0198310 3300046663 Bacteria 1362
355 Ga0495635_0269768 3300046663 Bacteria 1145
356 Ga0495599_0213078 3300046678 Bacteria 1184
357 Ga0495658_0088816 3300046683 Bacteria 1827
358 Ga0495600_0079170 3300046809 Bacteria 2146
359 Ga0495600_0139384 3300046809 Bacteria 1574
360 Ga0495600_0193699 3300046809 Bacteria 1306
361 Ga0495604_0046716 3300047317 Bacteria 3376
362 Ga0495604_0156473 3300047317 Bacteria 1614
363 Ga0495674_0002756 3300047319 Bacteria 17053
364 Ga0495674_0290132 3300047319 Bacteria 1338
365 Ga0495676_0032010 3300047321 Bacteria 4443
366 Ga0495676_0050445 3300047321 Bacteria 3337
367 Ga0495676_0078251 3300047321 Bacteria 2518
368 Ga0495680_0007746 3300047322 Bacteria 9810
369 Ga0495675_0254805 3300047444 Bacteria 1053
370 Ga0495684_0040243 3300047471 Bacteria 3584
371 Ga0495593_0134714 3300047673 Bacteria 1253
372 Ga0496100_0414774 3300048903 Bacteria 1027
373 Ga0496101_0004027 3300048904 Bacteria 9190
374 Ga0496101_0096542 3300048904 Bacteria 2206
375 Ga0496102_0388825 3300048905 Bacteria 1312
376 Ga0496102_0405297 3300048905 Bacteria 1282
377 Ga0496102_0548527 3300048905 Bacteria 1079
378 Ga0496103_0037680 3300048906 Bacteria 2964
379 Ga0496104_0013302 3300048907 Bacteria 7420
380 Ga0496104_0096455 3300048907 Bacteria 2829
381 Ga0496104_0114644 3300048907 Bacteria 2585
382 Ga0496104_0426883 3300048907 Bacteria 1237
383 Ga0496104_0564760 3300048907 Bacteria 1048
384 Ga0496105_0030482 3300048908 Bacteria 4420
385 Ga0496105_0068808 3300048908 Bacteria 2925
386 Ga0496105_0187398 3300048908 Bacteria 1693
387 Ga0496106_0193090 3300048909 Bacteria 1619
388 Ga0496107_0059333 3300048910 Bacteria 2769
389 Ga0496107_0169197 3300048910 Bacteria 1621
390 Ga0496108_0018874 3300048911 Bacteria 5654
391 Ga0496108_0052365 3300048911 Bacteria 3420
392 Ga0496108_0062669 3300048911 Bacteria 3131
393 Ga0496108_0208532 3300048911 Bacteria 1696
394 Ga0496109_0021633 3300048912 Bacteria 5690
395 Ga0496109_0207309 3300048912 Bacteria 1843
396 Ga0496109_0433799 3300048912 Bacteria 1241
397 Ga0496110_0016374 3300048913 Bacteria 6190
398 Ga0496110_0019687 3300048913 Bacteria 5686
399 Ga0496110_0073578 3300048913 Bacteria 3032
400 Ga0496110_0257846 3300048913 Bacteria 1587
401 Ga0496110_0579131 3300048913 Bacteria 1019
402 Ga0496111_0059590 3300048914 Bacteria 2766
403 Ga0496111_0081299 3300048914 Bacteria 2365
404 Ga0496111_0143916 3300048914 Bacteria 1767
405 Ga0496112_0003269 3300048915 Bacteria 13377
406 Ga0496112_0038428 3300048915 Bacteria 4673
407 Ga0496112_0053582 3300048915 Bacteria 3962
408 Ga0496112_0372565 3300048915 Bacteria 1369
409 Ga0496112_1013793 3300048915 Bacteria 750
410 Ga0496114_0045258 3300048917 Bacteria 3655
411 Ga0496114_0061973 3300048917 Bacteria 3130
412 Ga0496114_0070790 3300048917 Bacteria 2930
413 Ga0496114_0264772 3300048917 Bacteria 1514
414 Ga0496114_0335246 3300048917 Bacteria 1337
415 Ga0496115_0009328 3300048918 Bacteria 7290
416 Ga0496115_0236696 3300048918 Bacteria 1505
417 Ga0496115_0400273 3300048918 Bacteria 1114
418 Ga0496119_0012938 3300048922 Bacteria 6713
419 Ga0496121_0005613 3300048924 Bacteria 15999
420 Ga0496121_0023183 3300048924 Bacteria 5991
421 Ga0496124_0069895 3300048927 Bacteria 2914
422 Ga0501031_0173211 3300049568 Bacteria 1410
423 Ga0501033_0002536 3300049570 Bacteria 15460
424 Ga0501034_0002715 3300049571 Bacteria 20849
425 Ga0501034_0549839 3300049571 Bacteria 1064
426 Ga0501034_0777679 3300049571 Bacteria 851
427 Ga0501036_0077258 3300049572 Bacteria 2817
428 Ga0501036_0240240 3300049572 Bacteria 1519
429 Ga0501038_0387684 3300049574 Bacteria 1083
430 Ga0501038_0567750 3300049574 Bacteria 861
431 Ga0501040_0126573 3300049576 Bacteria 1795
432 Ga0501040_0205988 3300049576 Bacteria 1397
433 Ga0501040_0464516 3300049576 Bacteria 911
434 Ga0501042_0456952 3300049578 Bacteria 926
435 Ga0501046_0350496 3300049580 Bacteria 1072
436 Ga0501047_0154890 3300049581 Bacteria 2165
437 Ga0501048_0179835 3300049582 Bacteria 1499
438 Ga0501048_0233815 3300049582 Bacteria 1304
439 Ga0501069_0000034 3300049585 Bacteria 92080
440 Ga0501069_0001592 3300049585 Bacteria 11230
441 Ga0501069_0300875 3300049585 Bacteria 941
442 Ga0501070_0000013 3300049586 Bacteria 180554
443 Ga0501070_0003101 3300049586 Bacteria 14478
444 Ga0501070_0019128 3300049586 Bacteria 5744
445 Ga0501070_0041988 3300049586 Bacteria 3808
446 Ga0501070_0106730 3300049586 Bacteria 2314
447 Ga0501071_0029255 3300049587 Bacteria 3887
448 Ga0501071_0447077 3300049587 Bacteria 989
449 Ga0501072_0044704 3300049588 Bacteria 3482
450 Ga0501072_0280534 3300049588 Bacteria 1325
451 Ga0501072_0498027 3300049588 Bacteria 964
452 Ga0501076_0076417 3300049592 Bacteria 2686
453 Ga0501079_0018815 3300049741 Bacteria 5279
454 Ga0501079_0102902 3300049741 Bacteria 2215
455 Ga0501080_0004897 3300049742 Bacteria 11932
456 Ga0501080_0061196 3300049742 Bacteria 3506
457 Ga0501080_0075011 3300049742 Bacteria 3146
458 Ga0501080_0209336 3300049742 Bacteria 1787
459 Ga0501081_0039545 3300049743 Bacteria 3228
460 Ga0501081_0176129 3300049743 Bacteria 1546
461 Ga0501083_0446065 3300049744 Bacteria 842
462 Ga0501282_009851 3300049778 Bacteria 1025
463 Ga0501045_0223410 3300049824 Bacteria 1402
464 nmdc:mga03683_26612_c1 3300050489 Bacteria 2283
465 nmdc:mga00v17_176516_c1 3300050491 Bacteria 1378
466 nmdc:mga00v17_29001_c1 3300050491 Bacteria 3245
467 nmdc:mga00v17_339836_c1 3300050491 Bacteria 976
468 nmdc:mga00v17_43670_c1 3300050491 Bacteria 2700
469 nmdc:mga00v17_8153_c1 3300050491 Bacteria 5628
470 nmdc:mga0yw44_155540_c1 3300050492 Bacteria 1494
471 nmdc:mga0yw44_218003_c1 3300050492 Bacteria 1264
472 nmdc:mga0yw44_7754_c1 3300050492 Bacteria 5304
473 nmdc:mga0yw44_77885_c1 3300050492 Bacteria 2072
474 nmdc:mga06z11_161385_c1 3300050494 Bacteria 1281
475 nmdc:mga06z11_470182_c1 3300050494 Bacteria 761
476 nmdc:mga04h51_200917_c1 3300050495 Bacteria 783
477 nmdc:mga07m45_26141_c1 3300050496 Bacteria 3206
478 nmdc:mga07m45_4678_c1 3300050496 Bacteria 6718
479 nmdc:mga05p37_1318_c1 3300050507 Bacteria 28884
480 nmdc:mga05p37_439214_c1 3300050507 Bacteria 1514
481 nmdc:mga05p37_66457_c1 3300050507 Bacteria 4436
482 nmdc:mga09592_42045_c1 3300050508 Bacteria 3845
483 nmdc:mga09592_83_c1 3300050508 Bacteria 55635
484 nmdc:mga0qj67_15059_c1 3300050509 Bacteria 5851
485 nmdc:mga0qj67_265782_c1 3300050509 Bacteria 1391
486 nmdc:mga0qj67_8027_c1 3300050509 Bacteria 7810
487 nmdc:mga06r32_20579_c1 3300050510 Bacteria 6076
488 nmdc:mga06r32_3137_c1 3300050510 Bacteria 14810
489 nmdc:mga06r32_8034_c1 3300050510 Bacteria 9491
490 nmdc:mga08y16_282742_c1 3300050511 Bacteria 1711
491 nmdc:mga08y16_3049_c1 3300050511 Bacteria 17312
492 nmdc:mga08y16_50019_c1 3300050511 Bacteria 4374
493 nmdc:mga0n895_3338_c1 3300050512 Bacteria 12902
494 nmdc:mga0n895_36870_c1 3300050512 Bacteria 4724
495 nmdc:mga0n895_37760_c1 3300050512 Bacteria 4675
496 nmdc:mga0n895_86154_c1 3300050512 Bacteria 3137
497 nmdc:mga0rr50_59113_c1 3300050513 Bacteria 2877
498 nmdc:mga0rr50_67715_c1 3300050513 Bacteria 2713
499 nmdc:mga08x19_56277_c1 3300050514 Bacteria 2538
500 nmdc:mga0a205_187476_c1 3300050515 Bacteria 1961
501 nmdc:mga0a205_288192_c1 3300050515 Bacteria 1517
502 nmdc:mga0a205_42200_c1 3300050515 Bacteria 4395
503 nmdc:mga0a205_531163_c1 3300050515 Bacteria 1032
504 nmdc:mga0a205_590059_c1 3300050515 Bacteria 965
505 Ga0495601_0489001 3300053077 Bacteria 795
506 Ga0500635_0122480 3300053080 Bacteria 974
507 Ga0495595_0056520 3300053084 Bacteria 1829
508 Ga0500566_0003366 3300053094 Bacteria 9546
509 Ga0500568_0023333 3300053139 Bacteria 2632
510 Ga0500616_0000081 3300053153 Bacteria 199653
511 Ga0500616_0001925 3300053153 Bacteria 18521
512 Ga0501084_0000257 3300054114 Bacteria 40244
513 Ga0501084_0488008 3300054114 Bacteria 1041
514 Ga0501084_0851284 3300054114 Bacteria 767
515 Ga0590071_030546 3300059421 Bacteria 1283
516 Ga0590075_008278 3300059424 Bacteria 2483
517 Ga0590077_006751 3300059426 Bacteria 2349
518 Ga0466962_0008760 3300061719 Bacteria 4850
519 Ga0466962_0008934 3300061719 Bacteria 4801
520 Ga0466962_0035366 3300061719 Bacteria 2391
521 Ga0466962_0078259 3300061719 Bacteria 1581
522 Ga0530510_0082028 3300061734 Bacteria 2348
523 Ga0530510_0372069 3300061734 Bacteria 1075
524 2586057898 2585427649 Bacteria 9053857
525 2643827029 2643221561 Bacteria 4984412
526 2644534380 2643221696 Bacteria 5431823
527 2739606611 2739367654 Bacteria 6049412
528 2785367375 2784746768 Bacteria 10036182
529 2808915761 2808606375 Bacteria 9466072
530 2809029833 2808606394 Bacteria 6248540
531 2809590415 2808606522 Bacteria 9488490
532 2809593260 2808606522 Bacteria 9488490
533 2812334559 2811994874 Bacteria 5367947
534 2819696165 2818991463 Bacteria 7948711
535 2832006364 2832004796 Bacteria 6538017
536 2862282074 2862281513 Bacteria 9621493
537 2862383326 2862382967 Bacteria 10317375
538 2866070616 2866065130 Bacteria 6518152
539 2867304085 2867302475 Bacteria 7087181
540 2867313079 2867312974 Bacteria 7058875
541 2867325103 2867319477 Bacteria 7069771
542 2873151871 2873151551 Bacteria 8625867
543 3003006103 3002998708 Bacteria 11715108
544 8008563299 8008558824 Bacteria 10610750
545 8056210857 8056207758 Bacteria 8639239
546 Ga0496120_0029080
547 JGI25405J52794_10025448
548 Ga0070658_10170588
549 Ga0070658_10290902
550 Ga0070683_100723143
551 Ga0070683_100845351
552 Ga0070682_100029267
553 Ga0068868_100628976
554 Ga0070689_100954013
555 Ga0070661_100125947
556 Ga0070668_100386126
557 Ga0070671_100001630
558 Ga0070674_100017322
559 Ga0070659_100470957
560 Ga0070667_100008457
561 Ga0070714_100536384
562 Ga0070714_101099182
563 Ga0070713_100138429
564 Ga0070713_100424151
565 Ga0070710_10348892
566 Ga0070708_100046858
567 Ga0070663_100054052
568 Ga0070663_100813907
569 Ga0070662_100297279
570 Ga0070681_10205184
571 Ga0070707_100027778
572 Ga0070698_100085959
573 Ga0070679_100043054
574 Ga0070684_100139976
575 Ga0068853_100378807
576 Ga0070665_100000151
577 Ga0070665_100000583
578 Ga0070665_100003955
579 Ga0068855_100166024
580 Ga0068855_100570054
581 Ga0070664_100057338
582 Ga0070664_100633744
583 Ga0070664_101003549
584 Ga0068856_100024530
585 Ga0068856_100892778
586 Ga0070702_100058560
587 Ga0068852_100500449
588 Ga0068859_100006971
589 Ga0068864_100079017
590 Ga0068861_100181477
591 Ga0068863_100000675
592 Ga0068863_100106729
593 Ga0068858_100000209
594 Ga0068858_100032809
595 Ga0068860_100000214
596 Ga0068860_100000669
597 Ga0068862_100000009
598 Ga0081455_10001559
599 Ga0081455_10004637
600 Ga0081455_10075782
601 Ga0081538_10041476
602 Ga0081538_10159184
603 Ga0081539_10038588
604 Ga0081539_10100683
605 Ga0081539_10163861
606 Ga0075365_10000393
607 Ga0075365_10006069
608 Ga0075365_10046159
609 Ga0075365_10047537
610 Ga0075365_10069520
611 Ga0075365_10121587
612 Ga0075368_10001237
613 Ga0075368_10032725
614 Ga0075363_100005322
615 Ga0075363_100018011
616 Ga0075363_100187260
617 Ga0075364_10011197
618 Ga0075364_10011797
619 Ga0075364_10034354
620 Ga0075364_10068219
621 Ga0075364_10163703
622 Ga0075364_10228486
623 Ga0075364_10233524
624 Ga0075432_10016139
625 Ga0070715_10156916
626 Ga0075362_10079478
627 Ga0075367_10018094
628 Ga0075367_10321714
629 Ga0075369_10225821
630 Ga0075370_10005476
631 Ga0075370_10091950
632 Ga0075428_100002979
633 Ga0075428_100733323
634 Ga0075430_100039792
635 Ga0075431_100000561
636 Ga0075431_100000598
637 Ga0075433_10008956
638 Ga0075433_10023586
639 Ga0075433_10072680
640 Ga0075433_10095505
641 Ga0075433_10106026
642 Ga0075434_100011587
643 Ga0075434_100020948
644 Ga0075434_100149642
645 Ga0075429_100004839
646 Ga0075429_100193352
647 Ga0075436_100018088
648 Ga0075436_100278395
649 Ga0075436_100332060
650 Ga0097620_100006971
651 Ga0075435_100014847
652 Ga0075435_100044492
653 Ga0105240_10024506
654 Ga0105240_10278382
655 Ga0111539_10039524
656 Ga0111539_10093355
657 Ga0111539_10094071
658 Ga0111539_10498132
659 Ga0105245_10036514
660 Ga0105245_10129173
661 Ga0105247_10002111
662 Ga0105247_10722070
663 Ga0114129_10014342
664 Ga0105243_10395332
665 Ga0105243_10460324
666 Ga0105248_10244978
667 Ga0105238_10177495
668 Ga0105239_10760689
669 Ga0105239_10818926
670 Ga0157335_1010390
671 Ga0157370_10048698
672 Ga0157370_10082246
673 Ga0157369_10016081
674 Ga0157369_10028744
675 Ga0157369_10092871
676 Ga0157369_10312115
677 Ga0157374_10995108
678 Ga0157374_11380154
679 Ga0163162_10682213
680 Ga0157372_10022342
681 Ga0157372_10051630
682 Ga0157372_10153545
683 Ga0157372_10212954
684 Ga0157372_10219247
685 Ga0157375_10252680
686 Ga0157379_10000611
687 Ga0157379_10254267
688 Ga0157376_10280270
689 Ga0183367_1012
690 Ga0163161_10361049
691 Ga0206353_10720512
692 Ga0213874_10038945
693 Ga0213876_10000836
694 Ga0213876_10033648
695 Ga0213876_10113900
696 Ga0213875_10030759
697 Ga0213875_10193908
698 Ga0207692_10188146
699 Ga0207710_10000108
700 Ga0207688_10513313
701 Ga0207680_10016272
702 Ga0207685_10129893
703 Ga0207705_10230419
704 Ga0207707_10018464
705 Ga0207707_10598919
706 Ga0207695_10090313
707 Ga0207660_10037781
708 Ga0207649_10097522
709 Ga0207652_10023548
710 Ga0207646_10192069
711 Ga0207694_10127944
712 Ga0207687_10050928
713 Ga0207687_10277977
714 Ga0207700_10046277
715 Ga0207700_10362889
716 Ga0207644_10065014
717 Ga0207690_10113211
718 Ga0207706_10217423
719 Ga0207709_10281602
720 Ga0207670_10505472
721 Ga0207669_10241937
722 Ga0207689_10126078
723 Ga0207661_10100205
724 Ga0207661_10115092
725 Ga0207679_10013912
726 Ga0207679_11022093
727 Ga0207667_10842997
728 Ga0207712_10004245
729 Ga0207712_10176930
730 Ga0207668_10120582
731 Ga0207668_10190147
732 Ga0207640_10029354
733 Ga0207658_10027346
734 Ga0207677_10168611
735 Ga0207703_10000235
736 Ga0207703_10007328
737 Ga0207678_10079081
738 Ga0207678_10278651
739 Ga0207708_10414324
740 Ga0207702_10024318
741 Ga0207641_10002292
742 Ga0207676_10136001
743 Ga0209813_10002370
744 Ga0209813_10151880
745 Ga0207428_10001600
746 Ga0207428_10008318
747 Ga0207428_10086352
748 Ga0268266_10005006
749 Ga0268266_10005991
750 Ga0268266_10009215
751 Ga0268265_10000173
752 Ga0268265_10166276
753 Ga0268264_10000027
754 Ga0268264_10000510
755 Ga0307512_10226871
756 Ga0265325_10061537
757 Ga0307513_10096384
758 Ga0307514_10015051
759 Ga0307514_10044158
760 Ga0307516_10014114
761 Ga0307405_10000334
762 Ga0307405_10163166
763 Ga0307405_10412315
764 Ga0307413_10484036
765 Ga0307518_10000537
766 Ga0307410_10210200
767 Ga0307406_10030726
768 Ga0307406_10333672
769 Ga0307409_100000066
770 Ga0307409_100061403
771 Ga0307409_100182309
772 Ga0307409_100294946
773 Ga0307416_100003023
774 Ga0307416_100326126
775 Ga0307411_10062381
776 Ga0307411_10068975
777 Ga0307415_100000199
778 Ga0307415_100068395
779 Ga0307415_100364747
780 Ga0307510_10042351
781 Ga0373953_0179272
782 Ga0373931_0094329
783 Ga0373947_0058096
784 Ga0373937_0246137
785 Ga0395899_0109235
786 Ga0395899_0189524
787 Ga0395900_0039851
788 Ga0395900_0154857
789 Ga0395900_0165342
790 Ga0395900_0254869
791 Ga0395900_0336722
792 Ga0395898_0001953
793 Ga0395898_0043019
794 Ga0395898_0076734
795 Ga0395898_0099799
796 Ga0395898_0238918
797 Ga0395905_0148135
798 Ga0395905_0250738
799 Ga0436364_0070967
800 Ga0436364_0427145
801 Ga0436364_1537202
802 Ga0395901_0042302
803 Ga0395901_0059020
804 Ga0395901_0061173
805 Ga0395901_0065444
806 Ga0395901_0102264
807 Ga0395901_0110022
808 Ga0395901_0116677
809 Ga0395901_0874607
810 Ga0436365_0643996
811 Ga0436365_1334006
812 Ga0436365_1900929
813 Ga0436362_0179562
814 Ga0439439_0000790
815 Ga0439466_0116770
816 Ga0451791_1746377
817 Ga0439449_0036060
818 Ga0439457_015329
819 Ga0439459_0024195
820 Ga0439464_0013535
821 Ga0466969_0117054
822 Ga0466972_0066376
823 Ga0466972_0219241
824 Ga0466965_0037285
825 Ga0466966_0208863
826 Ga0466961_0063741
827 Ga0466961_0235386
828 Ga0466963_0009960
829 Ga0466963_0014997
830 Ga0466963_0062528
831 Ga0466963_0083975
832 Ga0466963_0131050
833 Ga0466963_0489765
834 Ga0466964_0014531
835 Ga0466964_0296146
836 Ga0466971_0014969
837 Ga0466971_0032614
838 Ga0466971_0180554
839 Ga0466970_0077183
840 Ga0466970_0089589
841 Ga0466970_0234716
842 Ga0466957_0064084
843 Ga0466957_0097097
844 Ga0466957_0234024
845 Ga0466957_0283462
846 Ga0466957_0338974
847 Ga0466957_0548984
848 Ga0466957_0594869
849 Ga0466960_0159399
850 Ga0466959_0029320
851 Ga0466959_0116871
852 Ga0466959_0232622
853 Ga0451576_0895151
854 Ga0466958_0025773
855 Ga0466958_0081154
856 Ga0466967_0001962
857 Ga0466967_0031564
858 Ga0466967_0115508
859 Ga0466967_0259847
860 Ga0466967_0372489
861 Ga0466967_0401895
862 Ga0466967_0447213
863 Ga0466967_0705701
864 Ga0466967_0826821
865 Ga0495627_007487
866 Ga0495592_0019850
867 Ga0495592_0021813
868 Ga0495603_0001645
869 Ga0495603_0016911
870 Ga0495603_0036038
871 Ga0495603_0168501
872 Ga0495629_0029584
873 Ga0495629_0145602
874 Ga0495651_0024419
875 Ga0495651_0133070
876 Ga0495653_0348669
877 Ga0495650_0000063
878 Ga0495580_0285737
879 Ga0495582_0214631
880 Ga0495639_0305331
881 Ga0495594_0180741
882 Ga0495607_0189028
883 Ga0495608_0009284
884 Ga0495618_0040486
885 Ga0495618_0132149
886 Ga0495618_0428472
887 Ga0495628_0011328
888 Ga0495630_0036347
889 Ga0495652_0112001
890 Ga0495652_0246550
891 Ga0495640_0006105
892 Ga0495640_0051952
893 Ga0495640_0208955
894 Ga0495587_0242221
895 Ga0495667_0003165
896 Ga0495667_0404070
897 Ga0495634_0007161
898 Ga0495634_0107798
899 Ga0495635_0198310
900 Ga0495635_0269768
901 Ga0495599_0213078
902 Ga0495658_0088816
903 Ga0495600_0079170
904 Ga0495600_0139384
905 Ga0495600_0193699
906 Ga0495604_0046716
907 Ga0495604_0156473
908 Ga0495674_0002756
909 Ga0495674_0290132
910 Ga0495676_0032010
911 Ga0495676_0050445
912 Ga0495676_0078251
913 Ga0495680_0007746
914 Ga0495675_0254805
915 Ga0495684_0040243
916 Ga0495593_0134714
917 Ga0496100_0414774
918 Ga0496101_0004027
919 Ga0496101_0096542
920 Ga0496102_0388825
921 Ga0496102_0405297
922 Ga0496102_0548527
923 Ga0496103_0037680
924 Ga0496104_0013302
925 Ga0496104_0096455
926 Ga0496104_0114644
927 Ga0496104_0426883
928 Ga0496104_0564760
929 Ga0496105_0030482
930 Ga0496105_0068808
931 Ga0496105_0187398
932 Ga0496106_0193090
933 Ga0496107_0059333
934 Ga0496107_0169197
935 Ga0496108_0018874
936 Ga0496108_0052365
937 Ga0496108_0062669
938 Ga0496108_0208532
939 Ga0496109_0021633
940 Ga0496109_0207309
941 Ga0496109_0433799
942 Ga0496110_0016374
943 Ga0496110_0019687
944 Ga0496110_0073578
945 Ga0496110_0257846
946 Ga0496110_0579131
947 Ga0496111_0059590
948 Ga0496111_0081299
949 Ga0496111_0143916
950 Ga0496112_0003269
951 Ga0496112_0038428
952 Ga0496112_0053582
953 Ga0496112_0372565
954 Ga0496112_1013793
955 Ga0496114_0045258
956 Ga0496114_0061973
957 Ga0496114_0070790
958 Ga0496114_0264772
959 Ga0496114_0335246
960 Ga0496115_0009328
961 Ga0496115_0236696
962 Ga0496115_0400273
963 Ga0496119_0012938
964 Ga0496121_0005613
965 Ga0496121_0023183
966 Ga0496124_0069895
967 Ga0501031_0173211
968 Ga0501033_0002536
969 Ga0501034_0002715
970 Ga0501034_0549839
971 Ga0501034_0777679
972 Ga0501036_0077258
973 Ga0501036_0240240
974 Ga0501038_0387684
975 Ga0501038_0567750
976 Ga0501040_0126573
977 Ga0501040_0205988
978 Ga0501040_0464516
979 Ga0501042_0456952
980 Ga0501046_0350496
981 Ga0501047_0154890
982 Ga0501048_0179835
983 Ga0501048_0233815
984 Ga0501069_0000034
985 Ga0501069_0001592
986 Ga0501069_0300875
987 Ga0501070_0000013
988 Ga0501070_0003101
989 Ga0501070_0019128
990 Ga0501070_0041988
991 Ga0501070_0106730
992 Ga0501071_0029255
993 Ga0501071_0447077
994 Ga0501072_0044704
995 Ga0501072_0280534
996 Ga0501072_0498027
997 Ga0501076_0076417
998 Ga0501079_0018815
999 Ga0501079_0102902
1000 Ga0501080_0004897
1001 Ga0501080_0061196
1002 Ga0501080_0075011
1003 Ga0501080_0209336
1004 Ga0501081_0039545
1005 Ga0501081_0176129
1006 Ga0501083_0446065
1007 Ga0501282_009851
1008 Ga0501045_0223410
1009 nmdc:mga03683_26612_c1
1010 nmdc:mga00v17_176516_c1
1011 nmdc:mga00v17_29001_c1
1012 nmdc:mga00v17_339836_c1
1013 nmdc:mga00v17_43670_c1
1014 nmdc:mga00v17_8153_c1
1015 nmdc:mga0yw44_155540_c1
1016 nmdc:mga0yw44_218003_c1
1017 nmdc:mga0yw44_7754_c1
1018 nmdc:mga0yw44_77885_c1
1019 nmdc:mga06z11_161385_c1
1020 nmdc:mga06z11_470182_c1
1021 nmdc:mga04h51_200917_c1
1022 nmdc:mga07m45_26141_c1
1023 nmdc:mga07m45_4678_c1
1024 nmdc:mga05p37_1318_c1
1025 nmdc:mga05p37_439214_c1
1026 nmdc:mga05p37_66457_c1
1027 nmdc:mga09592_42045_c1
1028 nmdc:mga09592_83_c1
1029 nmdc:mga0qj67_15059_c1
1030 nmdc:mga0qj67_265782_c1
1031 nmdc:mga0qj67_8027_c1
1032 nmdc:mga06r32_20579_c1
1033 nmdc:mga06r32_3137_c1
1034 nmdc:mga06r32_8034_c1
1035 nmdc:mga08y16_282742_c1
1036 nmdc:mga08y16_3049_c1
1037 nmdc:mga08y16_50019_c1
1038 nmdc:mga0n895_3338_c1
1039 nmdc:mga0n895_36870_c1
1040 nmdc:mga0n895_37760_c1
1041 nmdc:mga0n895_86154_c1
1042 nmdc:mga0rr50_59113_c1
1043 nmdc:mga0rr50_67715_c1
1044 nmdc:mga08x19_56277_c1
1045 nmdc:mga0a205_187476_c1
1046 nmdc:mga0a205_288192_c1
1047 nmdc:mga0a205_42200_c1
1048 nmdc:mga0a205_531163_c1
1049 nmdc:mga0a205_590059_c1
1050 Ga0495601_0489001
1051 Ga0500635_0122480
1052 Ga0495595_0056520
1053 Ga0500566_0003366
1054 Ga0500568_0023333
1055 Ga0500616_0000081
1056 Ga0500616_0001925
1057 Ga0501084_0000257
1058 Ga0501084_0488008
1059 Ga0501084_0851284
1060 Ga0590071_030546
1061 Ga0590075_008278
1062 Ga0590077_006751
1063 Ga0466962_0008760
1064 Ga0466962_0008934
1065 Ga0466962_0035366
1066 Ga0466962_0078259
1067 Ga0530510_0082028
1068 Ga0530510_0372069
1069 2586057898
1070 2643827029
1071 2644534380
1072 2739606611
1073 2785367375
1074 2808915761
1075 2809029833
1076 2809590415
1077 2809593260
1078 2812334559
1079 2819696165
1080 2832006364
1081 2862282074
1082 2862383326
1083 2866070616
1084 2867304085
1085 2867313079
1086 2867325103
1087 2873151871
1088 3003006103
1089 8008563299
1090 8056210857

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

3

105

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9584 2 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9561 1 118
3w9s-assembly1.cif.gz_B crystal structure analysis of the n-terminal receiver domain of response regulator pmra 0.9508 3 117
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9499 1 118
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9488 2 114
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9685 1 81 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9513 1 79 3.40.50.2300
af_P0AA16_3_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9488 2 77 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9482 2 79 3.40.50.2300
3dzdB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9472 1 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7C1GHC5-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.963 2 121 GO:0000155
AF-A0A485APA4-F1-model_v4 Alkaline phosphatase synthesis transcriptional regulatory protein phoP 0.9592 2 121 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A522BHX7-F1-model_v4 Protein-glutamate methylesterase/protein-glutamine glutaminase (EC 3.1.1.61) (EC 3.5.1.44) 0.9584 1 121 GO:0000156
GO:0005737
GO:0006935
GO:0008168
GO:0008984
GO:0032259
GO:0050568
AF-Q3B4H6-F1-model_v4 Response regulator receiver domain protein (CheY-like) 0.9584 2 114 GO:0000160
AF-A0A836WKU4-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9567 1 121 GO:0000155
GO:0000156
GO:0007234
GO:0030295

Map