F461868

General Info

Members Datasets Scaffolds Average Seq Length
545 307 1090 309

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10080948|Ga0207684_100809483
Length 341
Sequence MDGIDLKVVPGRSPGWEPGSCSEGDGSAVSLHGLTSMTLGVPDVEAVASYYEDFGLRRVGDRPGHGLVLATADGGEQLALRPAGRRRLLEIGIGADDPDDLGRIEAGLRRLGVEFERDAGSLRVRDPNSALQVSVQAGPRITEAAARQEPANGPGRADRPNGRAPAIERAGRVRPRRLGHVVIGSLDQEASQRFFTEGLGFKVSDRVPGLASFMRCSTDHHNLLVQQAPVNFLHHTAWEVDDVDEVGRGATAMLDGHPERHVWGLGRHHIGSNFFWYLKDPVGNFSEYYSDLDIILDDQLWKPSVVEGARGLYNWGPXXXXSFIQPEDLAALMTGSHAPGA

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
164 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
165 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 2547132424 Nocardia nova SH22a Isolate Unclassified
285 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
286 2643221561 Nocardioides sp. Root151 Isolate Unclassified
287 2643221696 Nocardioides sp. Root140 Isolate Unclassified
288 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
289 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
290 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
291 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
292 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
293 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
294 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
295 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
296 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
297 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
298 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
299 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
300 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
301 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
302 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
303 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
304 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
305 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
306 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
307 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.68
Metatranscriptomes 0
Isolates 5.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 5.69
Rhizosphere 86.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10080948 3300025910 Bacteria 2763
2 JGI24744J21845_10000529 3300002077 Bacteria 6827
3 JGI24744J21845_10027957 3300002077 Bacteria 1088
4 JGI24742J22300_10002550 3300002244 Bacteria 2909
5 rootH2_10081177 3300003320 Bacteria 2847
6 rootH2_10244465 3300003320 Bacteria 1701
7 JGI25160J50197_1000426 3300003354 Bacteria 26536
8 Ga0070676_10009616 3300005328 Bacteria 5225
9 Ga0070683_100035869 3300005329 Bacteria 4536
10 Ga0070690_100010336 3300005330 Bacteria 5429
11 Ga0068869_100044786 3300005334 Bacteria 3183
12 Ga0070666_10019640 3300005335 Bacteria 4365
13 Ga0070680_100228541 3300005336 Bacteria 1571
14 Ga0070682_100036842 3300005337 Bacteria 2991
15 Ga0070689_100010972 3300005340 Bacteria 6475
16 Ga0070689_100422315 3300005340 Bacteria 1130
17 Ga0070691_10003821 3300005341 Bacteria 6798
18 Ga0070687_100185622 3300005343 Bacteria 1249
19 Ga0070692_10022108 3300005345 Bacteria 3104
20 Ga0070692_10044965 3300005345 Bacteria 2276
21 Ga0070668_100005142 3300005347 Bacteria 9703
22 Ga0070668_100262948 3300005347 Bacteria 1435
23 Ga0070669_100010618 3300005353 Bacteria 6540
24 Ga0070675_100100930 3300005354 Bacteria 2430
25 Ga0070671_100000498 3300005355 Bacteria 27450
26 Ga0070671_100180204 3300005355 Bacteria 1788
27 Ga0070671_100323746 3300005355 Bacteria 1314
28 Ga0070674_100003926 3300005356 Bacteria 8421
29 Ga0070674_100011331 3300005356 Bacteria 5426
30 Ga0070673_100075527 3300005364 Bacteria 2718
31 Ga0070688_100016779 3300005365 Bacteria 4192
32 Ga0070659_100023947 3300005366 Bacteria 4676
33 Ga0070659_100078882 3300005366 Bacteria 2628
34 Ga0070667_100033004 3300005367 Bacteria 4322
35 Ga0070667_100068912 3300005367 Bacteria 3010
36 Ga0070667_100466339 3300005367 Bacteria 1155
37 Ga0070709_10000816 3300005434 Bacteria 17378
38 Ga0070709_10005428 3300005434 Bacteria 6907
39 Ga0070709_10055888 3300005434 Bacteria 2494
40 Ga0070714_100001078 3300005435 Bacteria 19503
41 Ga0070714_100005602 3300005435 Bacteria 9600
42 Ga0070714_100019289 3300005435 Bacteria 5551
43 Ga0070714_100082276 3300005435 Bacteria 2805
44 Ga0070714_100207706 3300005435 Bacteria 1794
45 Ga0070713_100000960 3300005436 Bacteria 18441
46 Ga0070713_100005770 3300005436 Bacteria 8505
47 Ga0070713_100042991 3300005436 Bacteria 3692
48 Ga0070713_100625003 3300005436 Bacteria 1024
49 Ga0070710_10000314 3300005437 Bacteria 23078
50 Ga0070710_10003822 3300005437 Bacteria 7119
51 Ga0070710_10018888 3300005437 Bacteria 3553
52 Ga0070710_10019462 3300005437 Bacteria 3508
53 Ga0070701_10000440 3300005438 Bacteria 14168
54 Ga0070711_100004713 3300005439 Bacteria 8073
55 Ga0070711_100020566 3300005439 Bacteria 4255
56 Ga0070711_100025238 3300005439 Bacteria 3886
57 Ga0070711_100048508 3300005439 Bacteria 2904
58 Ga0070705_100008585 3300005440 Bacteria 5061
59 Ga0070705_100049551 3300005440 Bacteria 2439
60 Ga0070705_100052562 3300005440 Bacteria 2381
61 Ga0070700_100001859 3300005441 Bacteria 10657
62 Ga0070700_100077458 3300005441 Bacteria 2138
63 Ga0070700_100175651 3300005441 Bacteria 1486
64 Ga0070694_100017060 3300005444 Bacteria 4583
65 Ga0070708_100003375 3300005445 Bacteria 12514
66 Ga0070708_100041171 3300005445 Bacteria 4050
67 Ga0070708_100257668 3300005445 Bacteria 1639
68 Ga0070708_100352833 3300005445 Bacteria 1386
69 Ga0070708_100466591 3300005445 Bacteria 1191
70 Ga0070663_100004861 3300005455 Bacteria 7926
71 Ga0070663_100026282 3300005455 Bacteria 3941
72 Ga0070663_100169597 3300005455 Bacteria 1686
73 Ga0070663_100269893 3300005455 Bacteria 1352
74 Ga0070678_100002972 3300005456 Bacteria 9393
75 Ga0070678_100007338 3300005456 Bacteria 6530
76 Ga0070662_100004194 3300005457 Bacteria 9087
77 Ga0070681_10498945 3300005458 Bacteria 1130
78 Ga0068867_100012005 3300005459 Bacteria 6119
79 Ga0068867_100051282 3300005459 Bacteria 3042
80 Ga0070685_10032685 3300005466 Bacteria 2916
81 Ga0070706_100022665 3300005467 Bacteria 5782
82 Ga0070706_100023711 3300005467 Bacteria 5648
83 Ga0070706_100223098 3300005467 Bacteria 1759
84 Ga0070706_100277826 3300005467 Bacteria 1563
85 Ga0070707_100003389 3300005468 Bacteria 15057
86 Ga0070707_100097837 3300005468 Bacteria 2842
87 Ga0070707_100134990 3300005468 Bacteria 2400
88 Ga0070707_100214330 3300005468 Bacteria 1876
89 Ga0070707_100265202 3300005468 Bacteria 1670
90 Ga0070698_100024816 3300005471 Bacteria 6251
91 Ga0070698_100053206 3300005471 Bacteria 4115
92 Ga0070698_100198354 3300005471 Bacteria 1943
93 Ga0070698_100495910 3300005471 Bacteria 1159
94 Ga0070699_100000928 3300005518 Bacteria 27327
95 Ga0070699_100008496 3300005518 Bacteria 8897
96 Ga0070699_100058077 3300005518 Bacteria 3351
97 Ga0070697_100001107 3300005536 Bacteria 20385
98 Ga0068853_100009817 3300005539 Bacteria 7724
99 Ga0068853_100303597 3300005539 Bacteria 1476
100 Ga0070686_100100953 3300005544 Bacteria 1949
101 Ga0070695_100017387 3300005545 Bacteria 4359
102 Ga0070695_100152458 3300005545 Bacteria 1614
103 Ga0070696_100073356 3300005546 Bacteria 2411
104 Ga0070693_100009195 3300005547 Bacteria 4909
105 Ga0070693_100016742 3300005547 Bacteria 3800
106 Ga0070665_100002148 3300005548 Bacteria 22010
107 Ga0070665_100022669 3300005548 Bacteria 6322
108 Ga0070704_100003693 3300005549 Bacteria 8809
109 Ga0070704_100005355 3300005549 Bacteria 7473
110 Ga0070704_100055336 3300005549 Bacteria 2812
111 Ga0068855_100120455 3300005563 Bacteria 3003
112 Ga0068855_100208902 3300005563 Bacteria 2195
113 Ga0070664_100046174 3300005564 Bacteria 3679
114 Ga0068857_100127769 3300005577 Bacteria 2291
115 Ga0068854_100038222 3300005578 Bacteria 3374
116 Ga0068854_100278909 3300005578 Bacteria 1345
117 Ga0070702_100016637 3300005615 Bacteria 3777
118 Ga0070702_100021867 3300005615 Bacteria 3373
119 Ga0070702_100186493 3300005615 Bacteria 1362
120 Ga0068852_100046257 3300005616 Bacteria 3707
121 Ga0068859_100001220 3300005617 Bacteria 26227
122 Ga0068859_100014197 3300005617 Bacteria 7988
123 Ga0068859_100060970 3300005617 Bacteria 3801
124 Ga0068866_10001878 3300005718 Bacteria 8793
125 Ga0068866_10005245 3300005718 Bacteria 5340
126 Ga0068866_10011148 3300005718 Bacteria 3877
127 Ga0068866_10050678 3300005718 Bacteria 2109
128 Ga0068861_100064290 3300005719 Bacteria 2823
129 Ga0068861_100161982 3300005719 Bacteria 1846
130 Ga0068861_100222670 3300005719 Bacteria 1595
131 Ga0068860_100003805 3300005843 Bacteria 15526
132 Ga0068860_100006742 3300005843 Bacteria 11521
133 Ga0068860_100130078 3300005843 Bacteria 2415
134 Ga0068860_100247970 3300005843 Bacteria 1733
135 Ga0068862_100008620 3300005844 Bacteria 8436
136 Ga0070717_10008554 3300006028 Bacteria 7643
137 Ga0070717_10068822 3300006028 Bacteria 2946
138 Ga0070717_10192699 3300006028 Bacteria 1781
139 Ga0075364_10130924 3300006051 Bacteria 1683
140 Ga0070715_10011786 3300006163 Bacteria 3159
141 Ga0070715_10026398 3300006163 Bacteria 2311
142 Ga0070715_10058633 3300006163 Bacteria 1681
143 Ga0070716_100000670 3300006173 Bacteria 14588
144 Ga0070716_100024351 3300006173 Bacteria 3221
145 Ga0070716_100116257 3300006173 Bacteria 1666
146 Ga0070712_100001012 3300006175 Bacteria 16927
147 Ga0070712_100002553 3300006175 Bacteria 11244
148 Ga0070712_100004934 3300006175 Bacteria 8253
149 Ga0070712_100015763 3300006175 Bacteria 4873
150 Ga0075367_10161216 3300006178 Bacteria 1395
151 Ga0097621_100159797 3300006237 Bacteria 1936
152 Ga0068871_100028723 3300006358 Bacteria 4363
153 Ga0075434_100548706 3300006871 Bacteria 1175
154 Ga0068865_100003267 3300006881 Bacteria 9704
155 Ga0068865_100016234 3300006881 Bacteria 4760
156 Ga0075436_100034793 3300006914 Bacteria 3474
157 Ga0097620_100001220 3300006931 Bacteria 26227
158 Ga0097620_100014197 3300006931 Bacteria 7988
159 Ga0097620_100060970 3300006931 Bacteria 3801
160 Ga0075435_100100824 3300007076 Bacteria 2392
161 Ga0075435_100301198 3300007076 Bacteria 1371
162 Ga0099795_10006348 3300007788 Bacteria 3219
163 Ga0105251_10030099 3300009011 Bacteria 2729
164 Ga0105240_10609209 3300009093 Bacteria 1201
165 Ga0105245_10007647 3300009098 Bacteria 9464
166 Ga0105245_10070869 3300009098 Bacteria 3164
167 Ga0105247_10002251 3300009101 Bacteria 13270
168 Ga0105247_10012536 3300009101 Bacteria 5093
169 Ga0105247_10108332 3300009101 Bacteria 1785
170 Ga0105243_10002203 3300009148 Bacteria 16422
171 Ga0105243_10107741 3300009148 Bacteria 2325
172 Ga0105241_10096582 3300009174 Bacteria 2341
173 Ga0105241_10319480 3300009174 Bacteria 1338
174 Ga0105242_10004579 3300009176 Bacteria 10724
175 Ga0105242_10020004 3300009176 Bacteria 5246
176 Ga0105242_10046584 3300009176 Bacteria 3518
177 Ga0105248_10015841 3300009177 Bacteria 8309
178 Ga0105248_10141099 3300009177 Bacteria 2718
179 Ga0105248_10432300 3300009177 Bacteria 1483
180 Ga0105237_10001007 3300009545 Bacteria 37936
181 Ga0105238_10392938 3300009551 Bacteria 1379
182 Ga0105249_10007225 3300009553 Bacteria 9690
183 Ga0105249_10028215 3300009553 Bacteria 5068
184 Ga0105249_10205363 3300009553 Bacteria 1930
185 Ga0099796_10023164 3300010159 Bacteria 1936
186 Ga0099796_10024171 3300010159 Bacteria 1905
187 Ga0105239_10053758 3300010375 Bacteria 4416
188 Ga0105239_10068783 3300010375 Bacteria 3891
189 Ga0105239_10610640 3300010375 Bacteria 1244
190 Ga0157371_10067870 3300013102 Bacteria 2524
191 Ga0157378_10010987 3300013297 Bacteria 7924
192 Ga0157378_10011394 3300013297 Bacteria 7784
193 Ga0157378_10617404 3300013297 Bacteria 1097
194 Ga0163162_10002362 3300013306 Bacteria 17737
195 Ga0163162_10015808 3300013306 Bacteria 7375
196 Ga0163162_10016195 3300013306 Bacteria 7292
197 Ga0163162_10166181 3300013306 Bacteria 2330
198 Ga0157372_10042951 3300013307 Bacteria 5003
199 Ga0157372_10076010 3300013307 Bacteria 3791
200 Ga0157372_10143853 3300013307 Bacteria 2749
201 Ga0157375_10010108 3300013308 Bacteria 8297
202 Ga0157375_10021210 3300013308 Bacteria 5952
203 Ga0157375_10026468 3300013308 Bacteria 5406
204 Ga0157375_10357762 3300013308 Bacteria 1626
205 Ga0157380_10008447 3300014326 Bacteria 7354
206 Ga0157379_10002708 3300014968 Bacteria 14945
207 Ga0163161_10022152 3300017792 Bacteria 4472
208 Ga0163161_10041220 3300017792 Bacteria 3317
209 Ga0213876_10067984 3300021384 Bacteria 1882
210 Ga0207426_1000563 3300025302 Bacteria 50591
211 Ga0207426_1000891 3300025302 Bacteria 30448
212 Ga0207426_1059459 3300025302 Bacteria 1105
213 Ga0207653_10049245 3300025885 Bacteria 1398
214 Ga0207692_10001102 3300025898 Bacteria 9901
215 Ga0207692_10004261 3300025898 Bacteria 5653
216 Ga0207692_10020404 3300025898 Bacteria 3014
217 Ga0207692_10027076 3300025898 Bacteria 2696
218 Ga0207692_10168586 3300025898 Bacteria 1267
219 Ga0207642_10003075 3300025899 Bacteria 5228
220 Ga0207642_10057007 3300025899 Bacteria 1795
221 Ga0207710_10004312 3300025900 Bacteria 6228
222 Ga0207688_10013862 3300025901 Bacteria 4382
223 Ga0207688_10127821 3300025901 Bacteria 1488
224 Ga0207680_10053795 3300025903 Bacteria 2418
225 Ga0207647_10046568 3300025904 Bacteria 2702
226 Ga0207647_10152789 3300025904 Bacteria 1349
227 Ga0207685_10002949 3300025905 Bacteria 4028
228 Ga0207699_10007748 3300025906 Bacteria 5258
229 Ga0207699_10019273 3300025906 Bacteria 3634
230 Ga0207699_10033776 3300025906 Bacteria 2895
231 Ga0207699_10058669 3300025906 Bacteria 2303
232 Ga0207699_10094071 3300025906 Bacteria 1887
233 Ga0207699_10264444 3300025906 Bacteria 1190
234 Ga0207645_10069542 3300025907 Bacteria 2252
235 Ga0207684_10046156 3300025910 Bacteria 3696
236 Ga0207684_10162863 3300025910 Bacteria 1921
237 Ga0207684_10192521 3300025910 Bacteria 1759
238 Ga0207684_10231348 3300025910 Bacteria 1595
239 Ga0207684_10234674 3300025910 Bacteria 1583
240 Ga0207684_10234794 3300025910 Bacteria 1582
241 Ga0207671_10000782 3300025914 Bacteria 40342
242 Ga0207671_10076770 3300025914 Bacteria 2500
243 Ga0207693_10002964 3300025915 Bacteria 14695
244 Ga0207693_10013048 3300025915 Bacteria 6705
245 Ga0207693_10014678 3300025915 Bacteria 6292
246 Ga0207663_10010387 3300025916 Bacteria 4955
247 Ga0207663_10030226 3300025916 Bacteria 3193
248 Ga0207663_10100812 3300025916 Bacteria 1939
249 Ga0207663_10116814 3300025916 Bacteria 1819
250 Ga0207657_10009057 3300025919 Bacteria 10051
251 Ga0207646_10050662 3300025922 Bacteria 3715
252 Ga0207646_10083932 3300025922 Bacteria 2849
253 Ga0207646_10178749 3300025922 Bacteria 1916
254 Ga0207646_10473289 3300025922 Bacteria 1130
255 Ga0207681_10026407 3300025923 Bacteria 3746
256 Ga0207694_10109205 3300025924 Bacteria 2199
257 Ga0207659_10168056 3300025926 Bacteria 1728
258 Ga0207687_10006008 3300025927 Bacteria 8035
259 Ga0207687_10044807 3300025927 Bacteria 3055
260 Ga0207687_10101116 3300025927 Bacteria 2122
261 Ga0207700_10000405 3300025928 Bacteria 25217
262 Ga0207700_10015713 3300025928 Bacteria 5005
263 Ga0207700_10020591 3300025928 Bacteria 4483
264 Ga0207700_10373880 3300025928 Bacteria 1245
265 Ga0207664_10001132 3300025929 Bacteria 17744
266 Ga0207664_10003874 3300025929 Bacteria 10049
267 Ga0207664_10007740 3300025929 Bacteria 7457
268 Ga0207664_10070540 3300025929 Bacteria 2812
269 Ga0207664_10291360 3300025929 Bacteria 1434
270 Ga0207644_10001999 3300025931 Bacteria 13205
271 Ga0207690_10161623 3300025932 Bacteria 1670
272 Ga0207706_10002204 3300025933 Bacteria 18997
273 Ga0207706_10014005 3300025933 Bacteria 7272
274 Ga0207686_10003135 3300025934 Bacteria 8891
275 Ga0207686_10003673 3300025934 Bacteria 8224
276 Ga0207686_10100378 3300025934 Bacteria 1931
277 Ga0207709_10012623 3300025935 Bacteria 4655
278 Ga0207709_10214384 3300025935 Bacteria 1384
279 Ga0207670_10012639 3300025936 Bacteria 4947
280 Ga0207670_10484145 3300025936 Bacteria 1002
281 Ga0207669_10001537 3300025937 Bacteria 9836
282 Ga0207669_10142160 3300025937 Bacteria 1667
283 Ga0207704_10001051 3300025938 Bacteria 12269
284 Ga0207704_10025567 3300025938 Bacteria 3223
285 Ga0207704_10231190 3300025938 Bacteria 1375
286 Ga0207665_10001591 3300025939 Bacteria 15298
287 Ga0207665_10011663 3300025939 Bacteria 5776
288 Ga0207665_10147578 3300025939 Bacteria 1682
289 Ga0207691_10101942 3300025940 Bacteria 2561
290 Ga0207711_10044056 3300025941 Bacteria 3808
291 Ga0207711_10090070 3300025941 Bacteria 2696
292 Ga0207689_10022069 3300025942 Bacteria 5354
293 Ga0207679_10283944 3300025945 Bacteria 1420
294 Ga0207667_10107639 3300025949 Bacteria 2876
295 Ga0207712_10008464 3300025961 Bacteria 6503
296 Ga0207668_10014464 3300025972 Bacteria 4883
297 Ga0207668_10021400 3300025972 Bacteria 4124
298 Ga0207640_10006083 3300025981 Bacteria 6597
299 Ga0207640_10037231 3300025981 Bacteria 3060
300 Ga0207640_10269414 3300025981 Bacteria 1331
301 Ga0207658_10023191 3300025986 Bacteria 4329
302 Ga0207658_10037906 3300025986 Bacteria 3468
303 Ga0207658_10103127 3300025986 Bacteria 2239
304 Ga0207677_10008660 3300026023 Bacteria 5694
305 Ga0207677_10029250 3300026023 Bacteria 3498
306 Ga0207703_10004784 3300026035 Bacteria 11034
307 Ga0207703_10132003 3300026035 Bacteria 2158
308 Ga0207639_10016922 3300026041 Bacteria 5166
309 Ga0207639_10186741 3300026041 Bacteria 1768
310 Ga0207678_10002006 3300026067 Bacteria 18529
311 Ga0207678_10044129 3300026067 Bacteria 3857
312 Ga0207678_10287794 3300026067 Bacteria 1411
313 Ga0207708_10010381 3300026075 Bacteria 6914
314 Ga0207708_10026389 3300026075 Bacteria 4396
315 Ga0207708_10271909 3300026075 Bacteria 1371
316 Ga0207702_10023717 3300026078 Bacteria 5089
317 Ga0207702_10062616 3300026078 Bacteria 3178
318 Ga0207641_10074429 3300026088 Bacteria 2929
319 Ga0207648_10000418 3300026089 Bacteria 46808
320 Ga0207648_10070701 3300026089 Bacteria 3042
321 Ga0207674_10002514 3300026116 Bacteria 23121
322 Ga0207675_100007405 3300026118 Bacteria 10374
323 Ga0207675_100070124 3300026118 Bacteria 3276
324 Ga0207675_100201807 3300026118 Bacteria 1910
325 Ga0207683_10000332 3300026121 Bacteria 42904
326 Ga0207683_10003882 3300026121 Bacteria 12964
327 Ga0207683_10103263 3300026121 Bacteria 2546
328 Ga0207698_10189374 3300026142 Bacteria 1831
329 Ga0268266_10015717 3300028379 Bacteria 6483
330 Ga0268266_10027880 3300028379 Bacteria 4802
331 Ga0268266_10106234 3300028379 Bacteria 2481
332 Ga0268265_10030306 3300028380 Bacteria 3894
333 Ga0268265_10140492 3300028380 Bacteria 2021
334 Ga0268264_10179154 3300028381 Bacteria 1923
335 Ga0265337_1002111 3300028556 Bacteria 9380
336 Ga0265326_10002999 3300028558 Bacteria 5614
337 Ga0265319_1002056 3300028563 Bacteria 11312
338 Ga0265334_10000710 3300028573 Bacteria 16701
339 Ga0265323_10018520 3300028653 Bacteria 2694
340 Ga0265336_10005662 3300028666 Bacteria 4582
341 Ga0265338_10001289 3300028800 Bacteria 41134
342 Ga0265324_10003529 3300029957 Bacteria 7382
343 Ga0307511_10001087 3300030521 Bacteria 28892
344 Ga0265332_10002366 3300031238 Bacteria 9620
345 Ga0265320_10003999 3300031240 Bacteria 9706
346 Ga0265340_10006765 3300031247 Bacteria 6272
347 Ga0265339_10048025 3300031249 Bacteria 2342
348 Ga0265316_10028558 3300031344 Bacteria 4600
349 Ga0307513_10000497 3300031456 Bacteria 56474
350 Ga0307513_10015009 3300031456 Bacteria 9405
351 Ga0307513_10052768 3300031456 Bacteria 4376
352 Ga0265313_10006028 3300031595 Bacteria 8747
353 Ga0265314_10026202 3300031711 Bacteria 4383
354 Ga0265342_10005691 3300031712 Bacteria 9426
355 Ga0307413_10014259 3300031824 Bacteria 4029
356 Ga0307413_10081696 3300031824 Bacteria 2073
357 Ga0307413_10104031 3300031824 Bacteria 1884
358 Ga0307410_10076042 3300031852 Bacteria 2343
359 Ga0307410_10180450 3300031852 Bacteria 1598
360 Ga0307409_100018199 3300031995 Bacteria 4713
361 Ga0307416_100017784 3300032002 Bacteria 4986
362 Ga0307414_10192462 3300032004 Bacteria 1652
363 Ga0307415_100304390 3300032126 Bacteria 1322
364 Ga0307507_10003043 3300033179 Bacteria 33544
365 Ga0307510_10154077 3300033180 Bacteria 1909
366 Ga0373948_0005400 3300034817 Bacteria 2072
367 Ga0373934_0005019 3300035086 Bacteria 4904
368 Ga0373934_0006321 3300035086 Bacteria 4391
369 Ga0373923_0095498 3300035111 Bacteria 1305
370 Ga0373936_0044513 3300035113 Bacteria 1786
371 Ga0373936_0076588 3300035113 Bacteria 1386
372 Ga0373939_0012341 3300035114 Bacteria 2177
373 Ga0373941_0007699 3300035115 Bacteria 2646
374 Ga0373956_0009705 3300035119 Bacteria 3919
375 Ga0373957_0023111 3300035120 Bacteria 2221
376 Ga0373943_0134243 3300035170 Bacteria 1327
377 Ga0373946_0101588 3300035171 Bacteria 1290
378 Ga0373946_0109248 3300035171 Bacteria 1250
379 Ga0373955_0031578 3300035172 Bacteria 2775
380 Ga0373924_0004166 3300035410 Bacteria 5035
381 Ga0373931_0130593 3300035691 Bacteria 1445
382 Ga0373931_0174723 3300035691 Bacteria 1268
383 Ga0373935_0008318 3300035692 Bacteria 6206
384 Ga0373935_0055783 3300035692 Bacteria 2518
385 Ga0373935_0190837 3300035692 Bacteria 1411
386 Ga0373927_0043250 3300035695 Bacteria 2917
387 Ga0373933_0031958 3300035724 Bacteria 3056
388 Ga0373947_0047597 3300035725 Bacteria 2570
389 Ga0373937_0007125 3300036401 Bacteria 9660
390 Ga0373937_0036471 3300036401 Bacteria 4480
391 Ga0373937_0340493 3300036401 Bacteria 1420
392 Ga0373925_0000013 3300037068 Bacteria 188673
393 Ga0373925_0000108 3300037068 Bacteria 89540
394 Ga0373925_0104822 3300037068 Bacteria 2178
395 Ga0373925_0147580 3300037068 Bacteria 1844
396 Ga0373925_0184851 3300037068 Bacteria 1652
397 Ga0395898_0082499 3300037466 Bacteria 3099
398 Ga0436364_0585535 3300037853 Bacteria 6667
399 Ga0436364_0990140 3300037853 Bacteria 2781
400 Ga0436364_1423635 3300037853 Plasmid 4321
401 Ga0395901_0034913 3300038443 Bacteria 5195
402 Ga0395901_0140013 3300038443 Bacteria 2543
403 Ga0436365_1332088 3300039437 Bacteria 1594
404 Ga0436365_1797386 3300039437 Bacteria 2867
405 Ga0436361_0614360 3300039447 Bacteria 2874
406 Ga0439459_0006111 3300042438 Bacteria 1999
407 Ga0466972_0008635 3300044658 Bacteria 5112
408 Ga0466965_0196646 3300044683 Bacteria 1068
409 Ga0466966_0052813 3300044684 Bacteria 2580
410 Ga0466961_0042397 3300044693 Bacteria 2917
411 Ga0466963_0000294 3300044694 Bacteria 22408
412 Ga0466963_0062257 3300044694 Bacteria 2496
413 Ga0466964_0054585 3300044706 Bacteria 1647
414 Ga0466970_0030949 3300044765 Bacteria 2824
415 Ga0466970_0033205 3300044765 Bacteria 2728
416 Ga0466957_0083320 3300044842 Bacteria 1995
417 Ga0466957_0246561 3300044842 Bacteria 1186
418 Ga0466967_0297303 3300045976 Bacteria 1552
419 Ga0466967_0496106 3300045976 Bacteria 1198
420 Ga0495592_0091355 3300046454 Bacteria 2183
421 Ga0495603_0004212 3300046455 Bacteria 8566
422 Ga0495629_0234542 3300046459 Bacteria 1264
423 Ga0495638_0017985 3300046460 Bacteria 4703
424 Ga0495651_0037049 3300046462 Bacteria 3797
425 Ga0495653_0013346 3300046463 Bacteria 6695
426 Ga0495653_0022134 3300046463 Bacteria 5144
427 Ga0495650_0047293 3300046471 Bacteria 1800
428 Ga0495580_0002358 3300046472 Bacteria 16493
429 Ga0495608_0094814 3300046511 Bacteria 1928
430 Ga0495618_0063289 3300046514 Bacteria 2348
431 Ga0495618_0248106 3300046514 Bacteria 1117
432 Ga0495628_0083990 3300046516 Bacteria 2471
433 Ga0495630_0180613 3300046517 Bacteria 1609
434 Ga0495666_0160222 3300046526 Bacteria 1043
435 Ga0495652_0074828 3300046529 Bacteria 2815
436 Ga0495652_0119376 3300046529 Bacteria 2106
437 Ga0495665_0011253 3300046531 Bacteria 4845
438 Ga0495665_0097177 3300046531 Bacteria 1546
439 Ga0495586_0235258 3300046535 Bacteria 1043
440 Ga0495587_0062889 3300046536 Bacteria 2172
441 Ga0495645_0073379 3300046543 Bacteria 2465
442 Ga0495667_0007660 3300046559 Bacteria 7326
443 Ga0495667_0049557 3300046559 Bacteria 2772
444 Ga0495634_0033614 3300046642 Bacteria 3523
445 Ga0495635_0016331 3300046663 Bacteria 5184
446 Ga0495588_0130426 3300046674 Bacteria 1326
447 Ga0495657_0053299 3300046675 Bacteria 2707
448 Ga0495657_0055190 3300046675 Bacteria 2651
449 Ga0495599_0060930 3300046678 Bacteria 2359
450 Ga0495599_0093566 3300046678 Bacteria 1875
451 Ga0495623_0084824 3300046679 Bacteria 1954
452 Ga0495646_0046926 3300046680 Bacteria 2631
453 Ga0495624_0205465 3300046690 Bacteria 1196
454 Ga0495670_0100264 3300046691 Bacteria 1491
455 Ga0495589_0024266 3300046794 Bacteria 3083
456 Ga0495674_0067873 3300047319 Bacteria 3088
457 Ga0495674_0119150 3300047319 Bacteria 2231
458 Ga0495674_0371734 3300047319 Bacteria 1158
459 Ga0495676_0067338 3300047321 Bacteria 2771
460 Ga0495676_0082495 3300047321 Bacteria 2433
461 Ga0495676_0207247 3300047321 Bacteria 1359
462 Ga0495680_0095468 3300047322 Bacteria 2223
463 Ga0495675_0188678 3300047444 Bacteria 1259
464 Ga0495684_0017737 3300047471 Bacteria 5482
465 Ga0495684_0034947 3300047471 Bacteria 3856
466 Ga0495602_0125661 3300048088 Bacteria 2055
467 Ga0496100_0004599 3300048903 Bacteria 7332
468 Ga0496100_0172925 3300048903 Bacteria 1557
469 Ga0496101_0007883 3300048904 Bacteria 6931
470 Ga0496101_0139838 3300048904 Bacteria 1844
471 Ga0496102_0008761 3300048905 Bacteria 8674
472 Ga0496102_0037668 3300048905 Bacteria 4363
473 Ga0496103_0003331 3300048906 Bacteria 9827
474 Ga0496103_0052399 3300048906 Bacteria 2527
475 Ga0496103_0066578 3300048906 Bacteria 2248
476 Ga0496104_0187441 3300048907 Bacteria 1979
477 Ga0496105_0045548 3300048908 Bacteria 3619
478 Ga0496105_0047292 3300048908 Bacteria 3551
479 Ga0496105_0111594 3300048908 Bacteria 2256
480 Ga0496106_0076564 3300048909 Bacteria 2565
481 Ga0496106_0217032 3300048909 Bacteria 1524
482 Ga0496107_0030862 3300048910 Bacteria 3821
483 Ga0496107_0040284 3300048910 Bacteria 3353
484 Ga0496107_0136557 3300048910 Bacteria 1811
485 Ga0496108_0334595 3300048911 Bacteria 1320
486 Ga0496109_0244145 3300048912 Bacteria 1690
487 Ga0496110_0021460 3300048913 Bacteria 5469
488 Ga0496110_0812529 3300048913 Bacteria 839
489 Ga0496111_0188206 3300048914 Bacteria 1534
490 Ga0496112_0241586 3300048915 Bacteria 1758
491 Ga0496113_0099828 3300048916 Bacteria 2248
492 Ga0496114_0020282 3300048917 Bacteria 5393
493 Ga0496114_0194740 3300048917 Bacteria 1774
494 Ga0496114_0267708 3300048917 Bacteria 1505
495 Ga0496115_0137819 3300048918 Bacteria 2012
496 Ga0496126_0072131 3300048929 Bacteria 3072
497 Ga0496126_0091234 3300048929 Bacteria 2679
498 Ga0501033_0095342 3300049570 Bacteria 2174
499 Ga0501037_0172450 3300049573 Bacteria 1537
500 Ga0501038_0116377 3300049574 Bacteria 2209
501 Ga0501047_0035501 3300049581 Bacteria 4817
502 Ga0501070_0033077 3300049586 Bacteria 4325
503 Ga0501073_0039492 3300049589 Bacteria 3343
504 Ga0501074_0007552 3300049590 Bacteria 7866
505 Ga0501035_0066503 3300049822 Bacteria 3198
506 nmdc:mga00v17_145789_c1 3300050491 Bacteria 1519
507 nmdc:mga0n895_195329_c1 3300050512 Bacteria 2055
508 nmdc:mga0rr50_107543_c1 3300050513 Bacteria 2202
509 nmdc:mga0rr50_147758_c1 3300050513 Bacteria 1896
510 nmdc:mga0rr50_58605_c1 3300050513 Bacteria 2887
511 nmdc:mga08x19_61130_c1 3300050514 Bacteria 2441
512 Ga0495601_0044829 3300053077 Bacteria 2780
513 Ga0500643_023683 3300053087 Bacteria 1959
514 Ga0500593_000074 3300053117 Bacteria 37556
515 Ga0466962_0006561 3300061719 Bacteria 5585
516 Ga0466962_0053384 3300061719 Bacteria 1932
517 2548696047 2547132424 Bacteria 8348532
518 2552113492 2551306166 Bacteria 9731570
519 2643824104 2643221561 Bacteria 4984412
520 2644533410 2643221696 Bacteria 5431823
521 2793981064 2791355406 Bacteria 11364898
522 2809587881 2808606522 Bacteria 9488490
523 2842888879 2842888712 Bacteria 4279094
524 2870785593 2870782633 Bacteria 9624083
525 2891968960 2891968417 Bacteria 5821697
526 2899368837 2899359706 Bacteria 10940472
527 2917742629 2917736166 Bacteria 9690793
528 2929219207 2929212328 Bacteria 7708288
529 2939599191 2939598168 Bacteria 4687164
530 2954721126 2954711539 Bacteria 10867210
531 2954730676 2954721474 Bacteria 10456478
532 2954731361 2954731030 Bacteria 10243860
533 2954749383 2954740390 Bacteria 10229294
534 2954750075 2954749733 Bacteria 10366972
535 3003003489 3002998708 Bacteria 11715108
536 3003005974 3002998708 Bacteria 11715108
537 8047713774 8047710418 Bacteria 11023148
538 8047715818 8047710418 Bacteria 11023148
539 8047898683 8047893842 Bacteria 11723082
540 8047903610 8047893842 Bacteria 11723082
541 8048356874 8048356638 Bacteria 11044339
542 8048375645 8048369669 Bacteria 11666822
543 8048378952 8048369669 Bacteria 11666822
544 8048382560 8048379754 Bacteria 11877923
545 8048388057 8048379754 Bacteria 11877923
546 Ga0207684_10080948
547 JGI24744J21845_10000529
548 JGI24744J21845_10027957
549 JGI24742J22300_10002550
550 rootH2_10081177
551 rootH2_10244465
552 JGI25160J50197_1000426
553 Ga0070676_10009616
554 Ga0070683_100035869
555 Ga0070690_100010336
556 Ga0068869_100044786
557 Ga0070666_10019640
558 Ga0070680_100228541
559 Ga0070682_100036842
560 Ga0070689_100010972
561 Ga0070689_100422315
562 Ga0070691_10003821
563 Ga0070687_100185622
564 Ga0070692_10022108
565 Ga0070692_10044965
566 Ga0070668_100005142
567 Ga0070668_100262948
568 Ga0070669_100010618
569 Ga0070675_100100930
570 Ga0070671_100000498
571 Ga0070671_100180204
572 Ga0070671_100323746
573 Ga0070674_100003926
574 Ga0070674_100011331
575 Ga0070673_100075527
576 Ga0070688_100016779
577 Ga0070659_100023947
578 Ga0070659_100078882
579 Ga0070667_100033004
580 Ga0070667_100068912
581 Ga0070667_100466339
582 Ga0070709_10000816
583 Ga0070709_10005428
584 Ga0070709_10055888
585 Ga0070714_100001078
586 Ga0070714_100005602
587 Ga0070714_100019289
588 Ga0070714_100082276
589 Ga0070714_100207706
590 Ga0070713_100000960
591 Ga0070713_100005770
592 Ga0070713_100042991
593 Ga0070713_100625003
594 Ga0070710_10000314
595 Ga0070710_10003822
596 Ga0070710_10018888
597 Ga0070710_10019462
598 Ga0070701_10000440
599 Ga0070711_100004713
600 Ga0070711_100020566
601 Ga0070711_100025238
602 Ga0070711_100048508
603 Ga0070705_100008585
604 Ga0070705_100049551
605 Ga0070705_100052562
606 Ga0070700_100001859
607 Ga0070700_100077458
608 Ga0070700_100175651
609 Ga0070694_100017060
610 Ga0070708_100003375
611 Ga0070708_100041171
612 Ga0070708_100257668
613 Ga0070708_100352833
614 Ga0070708_100466591
615 Ga0070663_100004861
616 Ga0070663_100026282
617 Ga0070663_100169597
618 Ga0070663_100269893
619 Ga0070678_100002972
620 Ga0070678_100007338
621 Ga0070662_100004194
622 Ga0070681_10498945
623 Ga0068867_100012005
624 Ga0068867_100051282
625 Ga0070685_10032685
626 Ga0070706_100022665
627 Ga0070706_100023711
628 Ga0070706_100223098
629 Ga0070706_100277826
630 Ga0070707_100003389
631 Ga0070707_100097837
632 Ga0070707_100134990
633 Ga0070707_100214330
634 Ga0070707_100265202
635 Ga0070698_100024816
636 Ga0070698_100053206
637 Ga0070698_100198354
638 Ga0070698_100495910
639 Ga0070699_100000928
640 Ga0070699_100008496
641 Ga0070699_100058077
642 Ga0070697_100001107
643 Ga0068853_100009817
644 Ga0068853_100303597
645 Ga0070686_100100953
646 Ga0070695_100017387
647 Ga0070695_100152458
648 Ga0070696_100073356
649 Ga0070693_100009195
650 Ga0070693_100016742
651 Ga0070665_100002148
652 Ga0070665_100022669
653 Ga0070704_100003693
654 Ga0070704_100005355
655 Ga0070704_100055336
656 Ga0068855_100120455
657 Ga0068855_100208902
658 Ga0070664_100046174
659 Ga0068857_100127769
660 Ga0068854_100038222
661 Ga0068854_100278909
662 Ga0070702_100016637
663 Ga0070702_100021867
664 Ga0070702_100186493
665 Ga0068852_100046257
666 Ga0068859_100001220
667 Ga0068859_100014197
668 Ga0068859_100060970
669 Ga0068866_10001878
670 Ga0068866_10005245
671 Ga0068866_10011148
672 Ga0068866_10050678
673 Ga0068861_100064290
674 Ga0068861_100161982
675 Ga0068861_100222670
676 Ga0068860_100003805
677 Ga0068860_100006742
678 Ga0068860_100130078
679 Ga0068860_100247970
680 Ga0068862_100008620
681 Ga0070717_10008554
682 Ga0070717_10068822
683 Ga0070717_10192699
684 Ga0075364_10130924
685 Ga0070715_10011786
686 Ga0070715_10026398
687 Ga0070715_10058633
688 Ga0070716_100000670
689 Ga0070716_100024351
690 Ga0070716_100116257
691 Ga0070712_100001012
692 Ga0070712_100002553
693 Ga0070712_100004934
694 Ga0070712_100015763
695 Ga0075367_10161216
696 Ga0097621_100159797
697 Ga0068871_100028723
698 Ga0075434_100548706
699 Ga0068865_100003267
700 Ga0068865_100016234
701 Ga0075436_100034793
702 Ga0097620_100001220
703 Ga0097620_100014197
704 Ga0097620_100060970
705 Ga0075435_100100824
706 Ga0075435_100301198
707 Ga0099795_10006348
708 Ga0105251_10030099
709 Ga0105240_10609209
710 Ga0105245_10007647
711 Ga0105245_10070869
712 Ga0105247_10002251
713 Ga0105247_10012536
714 Ga0105247_10108332
715 Ga0105243_10002203
716 Ga0105243_10107741
717 Ga0105241_10096582
718 Ga0105241_10319480
719 Ga0105242_10004579
720 Ga0105242_10020004
721 Ga0105242_10046584
722 Ga0105248_10015841
723 Ga0105248_10141099
724 Ga0105248_10432300
725 Ga0105237_10001007
726 Ga0105238_10392938
727 Ga0105249_10007225
728 Ga0105249_10028215
729 Ga0105249_10205363
730 Ga0099796_10023164
731 Ga0099796_10024171
732 Ga0105239_10053758
733 Ga0105239_10068783
734 Ga0105239_10610640
735 Ga0157371_10067870
736 Ga0157378_10010987
737 Ga0157378_10011394
738 Ga0157378_10617404
739 Ga0163162_10002362
740 Ga0163162_10015808
741 Ga0163162_10016195
742 Ga0163162_10166181
743 Ga0157372_10042951
744 Ga0157372_10076010
745 Ga0157372_10143853
746 Ga0157375_10010108
747 Ga0157375_10021210
748 Ga0157375_10026468
749 Ga0157375_10357762
750 Ga0157380_10008447
751 Ga0157379_10002708
752 Ga0163161_10022152
753 Ga0163161_10041220
754 Ga0213876_10067984
755 Ga0207426_1000563
756 Ga0207426_1000891
757 Ga0207426_1059459
758 Ga0207653_10049245
759 Ga0207692_10001102
760 Ga0207692_10004261
761 Ga0207692_10020404
762 Ga0207692_10027076
763 Ga0207692_10168586
764 Ga0207642_10003075
765 Ga0207642_10057007
766 Ga0207710_10004312
767 Ga0207688_10013862
768 Ga0207688_10127821
769 Ga0207680_10053795
770 Ga0207647_10046568
771 Ga0207647_10152789
772 Ga0207685_10002949
773 Ga0207699_10007748
774 Ga0207699_10019273
775 Ga0207699_10033776
776 Ga0207699_10058669
777 Ga0207699_10094071
778 Ga0207699_10264444
779 Ga0207645_10069542
780 Ga0207684_10046156
781 Ga0207684_10162863
782 Ga0207684_10192521
783 Ga0207684_10231348
784 Ga0207684_10234674
785 Ga0207684_10234794
786 Ga0207671_10000782
787 Ga0207671_10076770
788 Ga0207693_10002964
789 Ga0207693_10013048
790 Ga0207693_10014678
791 Ga0207663_10010387
792 Ga0207663_10030226
793 Ga0207663_10100812
794 Ga0207663_10116814
795 Ga0207657_10009057
796 Ga0207646_10050662
797 Ga0207646_10083932
798 Ga0207646_10178749
799 Ga0207646_10473289
800 Ga0207681_10026407
801 Ga0207694_10109205
802 Ga0207659_10168056
803 Ga0207687_10006008
804 Ga0207687_10044807
805 Ga0207687_10101116
806 Ga0207700_10000405
807 Ga0207700_10015713
808 Ga0207700_10020591
809 Ga0207700_10373880
810 Ga0207664_10001132
811 Ga0207664_10003874
812 Ga0207664_10007740
813 Ga0207664_10070540
814 Ga0207664_10291360
815 Ga0207644_10001999
816 Ga0207690_10161623
817 Ga0207706_10002204
818 Ga0207706_10014005
819 Ga0207686_10003135
820 Ga0207686_10003673
821 Ga0207686_10100378
822 Ga0207709_10012623
823 Ga0207709_10214384
824 Ga0207670_10012639
825 Ga0207670_10484145
826 Ga0207669_10001537
827 Ga0207669_10142160
828 Ga0207704_10001051
829 Ga0207704_10025567
830 Ga0207704_10231190
831 Ga0207665_10001591
832 Ga0207665_10011663
833 Ga0207665_10147578
834 Ga0207691_10101942
835 Ga0207711_10044056
836 Ga0207711_10090070
837 Ga0207689_10022069
838 Ga0207679_10283944
839 Ga0207667_10107639
840 Ga0207712_10008464
841 Ga0207668_10014464
842 Ga0207668_10021400
843 Ga0207640_10006083
844 Ga0207640_10037231
845 Ga0207640_10269414
846 Ga0207658_10023191
847 Ga0207658_10037906
848 Ga0207658_10103127
849 Ga0207677_10008660
850 Ga0207677_10029250
851 Ga0207703_10004784
852 Ga0207703_10132003
853 Ga0207639_10016922
854 Ga0207639_10186741
855 Ga0207678_10002006
856 Ga0207678_10044129
857 Ga0207678_10287794
858 Ga0207708_10010381
859 Ga0207708_10026389
860 Ga0207708_10271909
861 Ga0207702_10023717
862 Ga0207702_10062616
863 Ga0207641_10074429
864 Ga0207648_10000418
865 Ga0207648_10070701
866 Ga0207674_10002514
867 Ga0207675_100007405
868 Ga0207675_100070124
869 Ga0207675_100201807
870 Ga0207683_10000332
871 Ga0207683_10003882
872 Ga0207683_10103263
873 Ga0207698_10189374
874 Ga0268266_10015717
875 Ga0268266_10027880
876 Ga0268266_10106234
877 Ga0268265_10030306
878 Ga0268265_10140492
879 Ga0268264_10179154
880 Ga0265337_1002111
881 Ga0265326_10002999
882 Ga0265319_1002056
883 Ga0265334_10000710
884 Ga0265323_10018520
885 Ga0265336_10005662
886 Ga0265338_10001289
887 Ga0265324_10003529
888 Ga0307511_10001087
889 Ga0265332_10002366
890 Ga0265320_10003999
891 Ga0265340_10006765
892 Ga0265339_10048025
893 Ga0265316_10028558
894 Ga0307513_10000497
895 Ga0307513_10015009
896 Ga0307513_10052768
897 Ga0265313_10006028
898 Ga0265314_10026202
899 Ga0265342_10005691
900 Ga0307413_10014259
901 Ga0307413_10081696
902 Ga0307413_10104031
903 Ga0307410_10076042
904 Ga0307410_10180450
905 Ga0307409_100018199
906 Ga0307416_100017784
907 Ga0307414_10192462
908 Ga0307415_100304390
909 Ga0307507_10003043
910 Ga0307510_10154077
911 Ga0373948_0005400
912 Ga0373934_0005019
913 Ga0373934_0006321
914 Ga0373923_0095498
915 Ga0373936_0044513
916 Ga0373936_0076588
917 Ga0373939_0012341
918 Ga0373941_0007699
919 Ga0373956_0009705
920 Ga0373957_0023111
921 Ga0373943_0134243
922 Ga0373946_0101588
923 Ga0373946_0109248
924 Ga0373955_0031578
925 Ga0373924_0004166
926 Ga0373931_0130593
927 Ga0373931_0174723
928 Ga0373935_0008318
929 Ga0373935_0055783
930 Ga0373935_0190837
931 Ga0373927_0043250
932 Ga0373933_0031958
933 Ga0373947_0047597
934 Ga0373937_0007125
935 Ga0373937_0036471
936 Ga0373937_0340493
937 Ga0373925_0000013
938 Ga0373925_0000108
939 Ga0373925_0104822
940 Ga0373925_0147580
941 Ga0373925_0184851
942 Ga0395898_0082499
943 Ga0436364_0585535
944 Ga0436364_0990140
945 Ga0436364_1423635
946 Ga0395901_0034913
947 Ga0395901_0140013
948 Ga0436365_1332088
949 Ga0436365_1797386
950 Ga0436361_0614360
951 Ga0439459_0006111
952 Ga0466972_0008635
953 Ga0466965_0196646
954 Ga0466966_0052813
955 Ga0466961_0042397
956 Ga0466963_0000294
957 Ga0466963_0062257
958 Ga0466964_0054585
959 Ga0466970_0030949
960 Ga0466970_0033205
961 Ga0466957_0083320
962 Ga0466957_0246561
963 Ga0466967_0297303
964 Ga0466967_0496106
965 Ga0495592_0091355
966 Ga0495603_0004212
967 Ga0495629_0234542
968 Ga0495638_0017985
969 Ga0495651_0037049
970 Ga0495653_0013346
971 Ga0495653_0022134
972 Ga0495650_0047293
973 Ga0495580_0002358
974 Ga0495608_0094814
975 Ga0495618_0063289
976 Ga0495618_0248106
977 Ga0495628_0083990
978 Ga0495630_0180613
979 Ga0495666_0160222
980 Ga0495652_0074828
981 Ga0495652_0119376
982 Ga0495665_0011253
983 Ga0495665_0097177
984 Ga0495586_0235258
985 Ga0495587_0062889
986 Ga0495645_0073379
987 Ga0495667_0007660
988 Ga0495667_0049557
989 Ga0495634_0033614
990 Ga0495635_0016331
991 Ga0495588_0130426
992 Ga0495657_0053299
993 Ga0495657_0055190
994 Ga0495599_0060930
995 Ga0495599_0093566
996 Ga0495623_0084824
997 Ga0495646_0046926
998 Ga0495624_0205465
999 Ga0495670_0100264
1000 Ga0495589_0024266
1001 Ga0495674_0067873
1002 Ga0495674_0119150
1003 Ga0495674_0371734
1004 Ga0495676_0067338
1005 Ga0495676_0082495
1006 Ga0495676_0207247
1007 Ga0495680_0095468
1008 Ga0495675_0188678
1009 Ga0495684_0017737
1010 Ga0495684_0034947
1011 Ga0495602_0125661
1012 Ga0496100_0004599
1013 Ga0496100_0172925
1014 Ga0496101_0007883
1015 Ga0496101_0139838
1016 Ga0496102_0008761
1017 Ga0496102_0037668
1018 Ga0496103_0003331
1019 Ga0496103_0052399
1020 Ga0496103_0066578
1021 Ga0496104_0187441
1022 Ga0496105_0045548
1023 Ga0496105_0047292
1024 Ga0496105_0111594
1025 Ga0496106_0076564
1026 Ga0496106_0217032
1027 Ga0496107_0030862
1028 Ga0496107_0040284
1029 Ga0496107_0136557
1030 Ga0496108_0334595
1031 Ga0496109_0244145
1032 Ga0496110_0021460
1033 Ga0496110_0812529
1034 Ga0496111_0188206
1035 Ga0496112_0241586
1036 Ga0496113_0099828
1037 Ga0496114_0020282
1038 Ga0496114_0194740
1039 Ga0496114_0267708
1040 Ga0496115_0137819
1041 Ga0496126_0072131
1042 Ga0496126_0091234
1043 Ga0501033_0095342
1044 Ga0501037_0172450
1045 Ga0501038_0116377
1046 Ga0501047_0035501
1047 Ga0501070_0033077
1048 Ga0501073_0039492
1049 Ga0501074_0007552
1050 Ga0501035_0066503
1051 nmdc:mga00v17_145789_c1
1052 nmdc:mga0n895_195329_c1
1053 nmdc:mga0rr50_107543_c1
1054 nmdc:mga0rr50_147758_c1
1055 nmdc:mga0rr50_58605_c1
1056 nmdc:mga08x19_61130_c1
1057 Ga0495601_0044829
1058 Ga0500643_023683
1059 Ga0500593_000074
1060 Ga0466962_0006561
1061 Ga0466962_0053384
1062 2548696047
1063 2552113492
1064 2643824104
1065 2644533410
1066 2793981064
1067 2809587881
1068 2842888879
1069 2870785593
1070 2891968960
1071 2899368837
1072 2917742629
1073 2929219207
1074 2939599191
1075 2954721126
1076 2954730676
1077 2954731361
1078 2954749383
1079 2954750075
1080 3003003489
1081 3003005974
1082 8047713774
1083 8047715818
1084 8047898683
1085 8047903610
1086 8048356874
1087 8048375645
1088 8048378952
1089 8048382560
1090 8048388057

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

177

288

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3b59-assembly1.cif.gz_F crystal structure of the mn(ii)-bound glyoxalase from novosphingobium aromaticivorans 0.8124 2 292
1dhy-assembly1.cif.gz_A kks102 bphc enzyme 0.8053 2 289
1mpy-assembly1.cif.gz_D structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2 0.7955 2 294
6l3w-assembly1.cif.gz_A crystal structure of bphc, a halotolerant catechol dioxygenase 0.7952 3 296
4z6v-assembly1.cif.gz_B structure of h200q variant of homoprotocatechuate 2,3-dioxygenase from b.fuscum in complex with 4-nitrocatechol at 1.37 ang resolution 0.7952 2 292
ID Description Score Start End Superfamily
af_Q2FVX7_247_334_3.30.390.30 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.9197 75 109 3.30.390.30
3vb0B02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8916 150 289 3.10.180.10
1f1yA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8833 150 278 3.10.180.10
3hq0A02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8772 150 285 3.10.180.10
1mpyA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8701 150 294 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4D4KYD1-F1-model_v4 VOC domain-containing protein 0.9852 142 296
AF-A0A4R7UTX5-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase superfamily protein 0.9838 62 309 GO:0051213
AF-A0A6G3DDG2-F1-model_v4 Dioxygenase 0.9772 179 306 GO:0051213
AF-A0A6G3DEN8-F1-model_v4 Dioxygenase 0.9749 1 254 GO:0051213
AF-A0A6G3DEN8-F1-model_v4 Dioxygenase 0.971 1 254 GO:0051213

Map