F461675

General Info

Members Datasets Scaffolds Average Seq Length
543 289 1086 313

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0146606|Ga0501040_0146606_357_1292
Length 295
Sequence MKVIIPLAGKGTRLRPHTHLVPKPMLKIAGKPVIDYVMEDLRRLGGVEEVIYITGHLKETVEAYARAKYPFKSHFVEQKEQRGTADAVGLAKPYIDQPVMIIFVDTIFDADLSVTKTSDADGIIWVKEVEDYQRFGVVVTDADGNMSRIVEKPNTPISKRANIGLYYIRNWRLLVEAVDWVMTRPPNKGEYYLTDAFQYMIDRGAKLKVVDVEGWYDAGKLDTLLDTNRTMVEPVYIEDGVTVRRSTIGPNVSISAGSVIEDSRIRDSIVGAEVAIDGFHGALTVTDNSELRGDG

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
142 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
235 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
259 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
260 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
263 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
264 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
270 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
271 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
272 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
273 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
274 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7
Rhizosphere 93
Stem 0
Stem Tuber 0
Unclassified 7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0146606 3300049576 Bacteria 1664
2 JGI25406J46586_10015222 3300003203 Bacteria 3249
3 Ga0065712_10119105 3300005290 Bacteria 1697
4 Ga0065715_10106221 3300005293 Bacteria 2843
5 Ga0065715_10119747 3300005293 Bacteria 2278
6 Ga0070658_10039188 3300005327 Bacteria 3822
7 Ga0070676_10009939 3300005328 Bacteria 5150
8 Ga0070683_100000440 3300005329 Bacteria 28884
9 Ga0070683_100035503 3300005329 Bacteria 4557
10 Ga0070683_100095768 3300005329 Bacteria 2791
11 Ga0070683_100158330 3300005329 Bacteria 2148
12 Ga0070690_100104290 3300005330 Bacteria 1883
13 Ga0070680_100000733 3300005336 Bacteria 22901
14 Ga0070680_100007400 3300005336 Bacteria 8381
15 Ga0070680_100009987 3300005336 Bacteria 7311
16 Ga0070680_100250375 3300005336 Bacteria 1498
17 Ga0070660_100080309 3300005339 Bacteria 2559
18 Ga0070660_100157350 3300005339 Bacteria 1829
19 Ga0070660_100270548 3300005339 Bacteria 1389
20 Ga0070689_100013163 3300005340 Bacteria 5980
21 Ga0070687_100043872 3300005343 Bacteria 2275
22 Ga0070661_100006474 3300005344 Bacteria 8076
23 Ga0070661_100113314 3300005344 Bacteria 2026
24 Ga0070661_100131226 3300005344 Bacteria 1882
25 Ga0070668_100071405 3300005347 Bacteria 2704
26 Ga0070675_100006592 3300005354 Bacteria 8925
27 Ga0070675_100061064 3300005354 Bacteria 3112
28 Ga0070673_100018930 3300005364 Bacteria 4935
29 Ga0070673_100086203 3300005364 Bacteria 2558
30 Ga0070688_100018929 3300005365 Bacteria 3982
31 Ga0070667_100105768 3300005367 Bacteria 2435
32 Ga0070703_10023331 3300005406 Bacteria 1822
33 Ga0070709_10051956 3300005434 Bacteria 2574
34 Ga0070714_100005688 3300005435 Bacteria 9546
35 Ga0070714_100198845 3300005435 Bacteria 1833
36 Ga0070714_100259134 3300005435 Bacteria 1610
37 Ga0070713_100000149 3300005436 Bacteria 46694
38 Ga0070713_100010888 3300005436 Bacteria 6594
39 Ga0070713_100094791 3300005436 Bacteria 2574
40 Ga0070711_100002799 3300005439 Bacteria 10006
41 Ga0070711_100006672 3300005439 Bacteria 6978
42 Ga0070705_100012253 3300005440 Bacteria 4354
43 Ga0070705_100049314 3300005440 Bacteria 2444
44 Ga0070705_100083594 3300005440 Bacteria 1968
45 Ga0070700_100034915 3300005441 Bacteria 3039
46 Ga0070708_100485087 3300005445 Bacteria 1166
47 Ga0070708_100503996 3300005445 Bacteria 1142
48 Ga0070678_100038030 3300005456 Bacteria 3385
49 Ga0070662_100057690 3300005457 Bacteria 2822
50 Ga0070681_10002622 3300005458 Bacteria 16511
51 Ga0070681_10076015 3300005458 Bacteria 3318
52 Ga0070681_10088605 3300005458 Bacteria 3046
53 Ga0068867_100008098 3300005459 Bacteria 7428
54 Ga0068867_100026007 3300005459 Bacteria 4199
55 Ga0070706_100004466 3300005467 Bacteria 13503
56 Ga0070707_100002753 3300005468 Bacteria 16744
57 Ga0070707_100004738 3300005468 Bacteria 12751
58 Ga0070707_100026141 3300005468 Bacteria 5540
59 Ga0070707_100137827 3300005468 Bacteria 2374
60 Ga0070707_100162842 3300005468 Bacteria 2173
61 Ga0070698_100014842 3300005471 Bacteria 8235
62 Ga0070698_100052480 3300005471 Bacteria 4148
63 Ga0070698_100112259 3300005471 Unclassified 2691
64 Ga0070698_100191377 3300005471 Bacteria 1983
65 Ga0070698_100258400 3300005471 Bacteria 1674
66 Ga0070698_100264815 3300005471 Bacteria 1651
67 Ga0070699_100000131 3300005518 Bacteria 69337
68 Ga0070699_100001862 3300005518 Bacteria 19130
69 Ga0070699_100003191 3300005518 Bacteria 14504
70 Ga0070699_100004511 3300005518 Bacteria 12318
71 Ga0070699_100008937 3300005518 Bacteria 8678
72 Ga0070699_100119511 3300005518 Bacteria 2316
73 Ga0070699_100128518 3300005518 Bacteria 2233
74 Ga0070679_100183644 3300005530 Bacteria 2063
75 Ga0070697_100004653 3300005536 Bacteria 10530
76 Ga0070697_100075760 3300005536 Bacteria 2766
77 Ga0070672_100034932 3300005543 Bacteria 3818
78 Ga0070686_100276676 3300005544 Bacteria 1236
79 Ga0070696_100000436 3300005546 Bacteria 26267
80 Ga0070696_100000526 3300005546 Bacteria 24285
81 Ga0070696_100038249 3300005546 Bacteria 3311
82 Ga0070696_100060512 3300005546 Bacteria 2648
83 Ga0070696_100153863 3300005546 Bacteria 1690
84 Ga0070696_100174429 3300005546 Bacteria 1591
85 Ga0070693_100134077 3300005547 Bacteria 1552
86 Ga0070665_100216994 3300005548 Bacteria 1914
87 Ga0070665_100262021 3300005548 Bacteria 1730
88 Ga0070704_100010332 3300005549 Bacteria 5677
89 Ga0070704_100035572 3300005549 Bacteria 3386
90 Ga0068855_100158610 3300005563 Bacteria 2569
91 Ga0070664_100031929 3300005564 Bacteria 4404
92 Ga0070664_100215207 3300005564 Bacteria 1718
93 Ga0068857_100003989 3300005577 Bacteria 12433
94 Ga0068857_100029110 3300005577 Bacteria 4874
95 Ga0068854_100005676 3300005578 Bacteria 7888
96 Ga0068854_100039691 3300005578 Bacteria 3317
97 Ga0070702_100049156 3300005615 Bacteria 2404
98 Ga0070702_100202963 3300005615 Bacteria 1314
99 Ga0068859_100042916 3300005617 Bacteria 4544
100 Ga0068859_100098835 3300005617 Bacteria 2973
101 Ga0068864_100008732 3300005618 Bacteria 8356
102 Ga0068864_100373723 3300005618 Bacteria 1349
103 Ga0068861_100081029 3300005719 Bacteria 2540
104 Ga0068870_10036053 3300005840 Bacteria 2543
105 Ga0068863_100084508 3300005841 Bacteria 3008
106 Ga0068858_100107831 3300005842 Unclassified 2600
107 Ga0068860_100047764 3300005843 Bacteria 4079
108 Ga0068862_100141382 3300005844 Bacteria 2136
109 Ga0081455_10070069 3300005937 Bacteria 2912
110 Ga0081455_10110720 3300005937 Bacteria 2182
111 Ga0081538_10066647 3300005981 Bacteria 2016
112 Ga0081539_10000174 3300005985 Bacteria 151265
113 Ga0070717_10023344 3300006028 Bacteria 4899
114 Ga0070712_100008515 3300006175 Bacteria 6454
115 Ga0070712_100240656 3300006175 Bacteria 1441
116 Ga0097621_100313067 3300006237 Bacteria 1389
117 Ga0075428_100036820 3300006844 Bacteria 5388
118 Ga0075428_100102374 3300006844 Bacteria 3123
119 Ga0075428_100417013 3300006844 Bacteria 1438
120 Ga0075431_100118877 3300006847 Unclassified 2727
121 Ga0075431_100279457 3300006847 Bacteria 1690
122 Ga0075433_10042982 3300006852 Bacteria 3922
123 Ga0075433_10115005 3300006852 Bacteria 2387
124 Ga0075434_100010819 3300006871 Bacteria 8573
125 Ga0075434_100070739 3300006871 Bacteria 3480
126 Ga0075429_100005664 3300006880 Bacteria 10774
127 Ga0075429_100045635 3300006880 Bacteria 3813
128 Ga0075429_100162791 3300006880 Bacteria 1954
129 Ga0068865_100006776 3300006881 Bacteria 7012
130 Ga0068865_100023280 3300006881 Bacteria 4054
131 Ga0097620_100042915 3300006931 Bacteria 4544
132 Ga0097620_100098837 3300006931 Bacteria 2973
133 Ga0105240_10080722 3300009093 Bacteria 3999
134 Ga0105240_10140330 3300009093 Bacteria 2890
135 Ga0111539_10920194 3300009094 Bacteria 1017
136 Ga0105245_10113490 3300009098 Bacteria 2523
137 Ga0114129_10005002 3300009147 Bacteria 18666
138 Ga0114129_10046313 3300009147 Bacteria 6112
139 Ga0114129_10133652 3300009147 Bacteria 3406
140 Ga0114129_10135190 3300009147 Bacteria 3384
141 Ga0105243_10135701 3300009148 Bacteria 2093
142 Ga0105241_10017856 3300009174 Bacteria 5218
143 Ga0105242_10021658 3300009176 Bacteria 5049
144 Ga0105248_10090019 3300009177 Bacteria 3455
145 Ga0105248_10176669 3300009177 Bacteria 2406
146 Ga0105248_10273421 3300009177 Bacteria 1902
147 Ga0105237_10072012 3300009545 Bacteria 3450
148 Ga0105237_10113203 3300009545 Bacteria 2705
149 Ga0105237_10623746 3300009545 Bacteria 1085
150 Ga0105249_10104613 3300009553 Bacteria 2668
151 Ga0105249_10326354 3300009553 Bacteria 1547
152 Ga0105239_10007902 3300010375 Bacteria 12160
153 Ga0105246_10040986 3300011119 Unclassified 3128
154 Ga0105246_10428684 3300011119 Bacteria 1106
155 Ga0157373_10241019 3300013100 Bacteria 1278
156 Ga0157373_10247286 3300013100 Bacteria 1261
157 Ga0157378_10003362 3300013297 Bacteria 14228
158 Ga0163162_10047295 3300013306 Bacteria 4312
159 Ga0157372_10103508 3300013307 Bacteria 3253
160 Ga0157372_10289412 3300013307 Bacteria 1905
161 Ga0157375_10374581 3300013308 Bacteria 1590
162 Ga0163163_10080871 3300014325 Bacteria 3250
163 Ga0157377_10126864 3300014745 Bacteria 1553
164 Ga0163161_10070245 3300017792 Bacteria 2560
165 Ga0163161_10234741 3300017792 Bacteria 1424
166 Ga0206356_10574207 3300020070 Bacteria 1245
167 Ga0207653_10003318 3300025885 Bacteria 5079
168 Ga0207692_10066369 3300025898 Bacteria 1886
169 Ga0207692_10093766 3300025898 Bacteria 1633
170 Ga0207642_10005341 3300025899 Bacteria 4186
171 Ga0207680_10130869 3300025903 Bacteria 1654
172 Ga0207699_10021895 3300025906 Bacteria 3455
173 Ga0207699_10044244 3300025906 Bacteria 2591
174 Ga0207643_10003344 3300025908 Bacteria 8639
175 Ga0207643_10004403 3300025908 Bacteria 7575
176 Ga0207705_10031528 3300025909 Bacteria 3784
177 Ga0207684_10011945 3300025910 Bacteria 7565
178 Ga0207684_10122174 3300025910 Bacteria 2233
179 Ga0207654_10003690 3300025911 Bacteria 7722
180 Ga0207707_10002170 3300025912 Bacteria 17761
181 Ga0207707_10007951 3300025912 Bacteria 9221
182 Ga0207707_10010026 3300025912 Bacteria 8222
183 Ga0207695_10027839 3300025913 Bacteria 6284
184 Ga0207695_10083088 3300025913 Bacteria 3236
185 Ga0207693_10009997 3300025915 Bacteria 7711
186 Ga0207693_10015641 3300025915 Bacteria 6083
187 Ga0207663_10004700 3300025916 Bacteria 6818
188 Ga0207660_10002494 3300025917 Bacteria 12101
189 Ga0207660_10065616 3300025917 Bacteria 2624
190 Ga0207660_10071715 3300025917 Bacteria 2521
191 Ga0207660_10276152 3300025917 Bacteria 1332
192 Ga0207662_10005939 3300025918 Bacteria 6555
193 Ga0207657_10023152 3300025919 Bacteria 5790
194 Ga0207657_10267601 3300025919 Bacteria 1359
195 Ga0207652_10008103 3300025921 Bacteria 8436
196 Ga0207652_10010159 3300025921 Bacteria 7581
197 Ga0207652_10416279 3300025921 Unclassified 1212
198 Ga0207646_10013251 3300025922 Bacteria 7887
199 Ga0207646_10047450 3300025922 Bacteria 3852
200 Ga0207646_10078275 3300025922 Unclassified 2956
201 Ga0207646_10084661 3300025922 Unclassified 2837
202 Ga0207646_10116743 3300025922 Bacteria 2397
203 Ga0207646_10254351 3300025922 Bacteria 1587
204 Ga0207681_10171686 3300025923 Bacteria 1644
205 Ga0207650_10431780 3300025925 Bacteria 1094
206 Ga0207659_10010500 3300025926 Bacteria 5821
207 Ga0207659_10054384 3300025926 Bacteria 2859
208 Ga0207700_10000599 3300025928 Bacteria 21065
209 Ga0207700_10007739 3300025928 Bacteria 6600
210 Ga0207700_10070076 3300025928 Bacteria 2694
211 Ga0207664_10010119 3300025929 Bacteria 6651
212 Ga0207664_10076595 3300025929 Bacteria 2708
213 Ga0207664_10176114 3300025929 Bacteria 1834
214 Ga0207690_10215832 3300025932 Bacteria 1465
215 Ga0207706_10008792 3300025933 Bacteria 9297
216 Ga0207686_10002785 3300025934 Bacteria 9462
217 Ga0207670_10025663 3300025936 Bacteria 3703
218 Ga0207669_10191322 3300025937 Bacteria 1476
219 Ga0207665_10087519 3300025939 Bacteria 2153
220 Ga0207691_10023958 3300025940 Bacteria 5742
221 Ga0207691_10126022 3300025940 Bacteria 2266
222 Ga0207661_10012127 3300025944 Bacteria 6259
223 Ga0207661_10021733 3300025944 Bacteria 4813
224 Ga0207661_10042428 3300025944 Bacteria 3586
225 Ga0207661_10405791 3300025944 Bacteria 1236
226 Ga0207679_10036953 3300025945 Bacteria 3468
227 Ga0207679_10187900 3300025945 Bacteria 1715
228 Ga0207679_10266378 3300025945 Unclassified 1463
229 Ga0207667_10616197 3300025949 Bacteria 1093
230 Ga0207668_10040764 3300025972 Bacteria 3135
231 Ga0207668_10059917 3300025972 Bacteria 2670
232 Ga0207640_10019626 3300025981 Bacteria 3998
233 Ga0207640_10162926 3300025981 Bacteria 1652
234 Ga0207658_10420961 3300025986 Bacteria 1178
235 Ga0207703_10241385 3300026035 Bacteria 1624
236 Ga0207639_10048293 3300026041 Bacteria 3221
237 Ga0207678_10131214 3300026067 Bacteria 2137
238 Ga0207708_10007267 3300026075 Bacteria 8187
239 Ga0207641_10074027 3300026088 Bacteria 2937
240 Ga0207648_10002060 3300026089 Bacteria 21904
241 Ga0207648_10503763 3300026089 Bacteria 1108
242 Ga0207676_10002069 3300026095 Bacteria 14566
243 Ga0207676_10009280 3300026095 Bacteria 6998
244 Ga0207676_10074337 3300026095 Bacteria 2738
245 Ga0207676_10359753 3300026095 Bacteria 1348
246 Ga0207674_10007014 3300026116 Bacteria 13170
247 Ga0207674_10017092 3300026116 Bacteria 7918
248 Ga0207674_10096916 3300026116 Bacteria 2934
249 Ga0207675_100176646 3300026118 Unclassified 2043
250 Ga0207683_10058273 3300026121 Bacteria 3391
251 Ga0207698_10119060 3300026142 Bacteria 2231
252 Ga0209974_10023671 3300027876 Bacteria 2033
253 Ga0268266_10076479 3300028379 Bacteria 2910
254 Ga0268264_10116309 3300028381 Bacteria 2350
255 Ga0268264_10168409 3300028381 Bacteria 1979
256 Ga0307408_100011030 3300031548 Bacteria 5963
257 Ga0307408_100069104 3300031548 Bacteria 2603
258 Ga0307408_100096458 3300031548 Unclassified 2244
259 Ga0316575_10008068 3300031665 Bacteria 3828
260 Ga0316579_10059231 3300031691 Bacteria 1800
261 Ga0316576_10013154 3300031727 Bacteria 5490
262 Ga0316578_10088761 3300031728 Bacteria 1845
263 Ga0307405_10058570 3300031731 Bacteria 2424
264 Ga0307405_10074483 3300031731 Bacteria 2196
265 Ga0307405_10139853 3300031731 Bacteria 1686
266 Ga0307413_10006927 3300031824 Bacteria 5218
267 Ga0307413_10010645 3300031824 Bacteria 4476
268 Ga0307413_10022298 3300031824 Bacteria 3410
269 Ga0307413_10037584 3300031824 Unclassified 2797
270 Ga0307413_10056800 3300031824 Bacteria 2389
271 Ga0307413_10161437 3300031824 Bacteria 1575
272 Ga0307410_10002633 3300031852 Bacteria 8742
273 Ga0307410_10005177 3300031852 Bacteria 6868
274 Ga0307410_10007383 3300031852 Bacteria 6015
275 Ga0307410_10007704 3300031852 Bacteria 5911
276 Ga0307410_10024757 3300031852 Unclassified 3755
277 Ga0307410_10041732 3300031852 Bacteria 3027
278 Ga0307407_10038931 3300031903 Bacteria 2639
279 Ga0307407_10141330 3300031903 Bacteria 1553
280 Ga0307412_10024923 3300031911 Unclassified 3699
281 Ga0307409_100048008 3300031995 Bacteria 3245
282 Ga0307409_100055301 3300031995 Bacteria 3063
283 Ga0307409_100217146 3300031995 Bacteria 1723
284 Ga0307409_100294495 3300031995 Unclassified 1506
285 Ga0307416_100018370 3300032002 Bacteria 4924
286 Ga0307416_100021841 3300032002 Unclassified 4605
287 Ga0307416_100033140 3300032002 Bacteria 3913
288 Ga0307416_100060168 3300032002 Bacteria 3091
289 Ga0307416_100096272 3300032002 Bacteria 2559
290 Ga0307416_100102675 3300032002 Unclassified 2494
291 Ga0307416_100116164 3300032002 Unclassified 2371
292 Ga0307416_100255897 3300032002 Bacteria 1707
293 Ga0307416_100578545 3300032002 Unclassified 1200
294 Ga0307414_10041216 3300032004 Bacteria 3125
295 Ga0307414_10053221 3300032004 Bacteria 2822
296 Ga0307414_10066020 3300032004 Bacteria 2584
297 Ga0307414_10073089 3300032004 Bacteria 2479
298 Ga0307414_10128357 3300032004 Unclassified 1964
299 Ga0307414_10454344 3300032004 Bacteria 1124
300 Ga0307411_10009538 3300032005 Bacteria 5112
301 Ga0307411_10015803 3300032005 Bacteria 4253
302 Ga0307411_10053455 3300032005 Bacteria 2646
303 Ga0307411_10102680 3300032005 Bacteria 2027
304 Ga0307411_10386977 3300032005 Bacteria 1152
305 Ga0307415_100015340 3300032126 Bacteria 4534
306 Ga0307415_100016741 3300032126 Unclassified 4378
307 Ga0307415_100058472 3300032126 Bacteria 2654
308 Ga0307415_100071690 3300032126 Bacteria 2437
309 Ga0316583_10032882 3300032133 Unclassified 1843
310 Ga0373934_0000757 3300035086 Bacteria 11585
311 Ga0373953_0090504 3300035117 Bacteria 1279
312 Ga0373956_0000180 3300035119 Bacteria 24010
313 Ga0373957_0016721 3300035120 Bacteria 2544
314 Ga0373943_0000229 3300035170 Bacteria 22889
315 Ga0373955_0000462 3300035172 Bacteria 17206
316 Ga0316574_0295136 3300035398 Unclassified 1031
317 Ga0373924_0097208 3300035410 Bacteria 1264
318 Ga0373931_0003655 3300035691 Bacteria 6953
319 Ga0373935_0101861 3300035692 Bacteria 1894
320 Ga0373933_0000370 3300035724 Bacteria 28746
321 Ga0373947_0003120 3300035725 Bacteria 9859
322 Ga0373937_0001012 3300036401 Bacteria 23794
323 Ga0316582_0054075 3300036647 Bacteria 2554
324 Ga0395905_0093574 3300037471 Bacteria 2819
325 Ga0395905_0407152 3300037471 Bacteria 1255
326 Ga0395901_0421385 3300038443 Bacteria 1369
327 Ga0439436_0029961 3300041404 Unclassified 1583
328 Ga0439448_0015975 3300042005 Unclassified 2280
329 Ga0439462_0012907 3300042015 Unclassified 2138
330 Ga0450898_012677 3300042134 Bacteria 1396
331 Ga0439446_0030373 3300042156 Bacteria 1562
332 Ga0439434_0035100 3300042435 Unclassified 1533
333 Ga0451577_0022065 3300042876 Bacteria 5817
334 Ga0451577_0066589 3300042876 Bacteria 3213
335 Ga0451577_0204378 3300042876 Bacteria 1783
336 Ga0453683_0018695 3300044673 Bacteria 4447
337 Ga0453683_0068330 3300044673 Bacteria 2222
338 Ga0453684_0302406 3300044712 Bacteria 1818
339 Ga0466967_0139650 3300045976 Bacteria 2256
340 Ga0495592_0004361 3300046454 Bacteria 10351
341 Ga0495592_0076513 3300046454 Bacteria 2428
342 Ga0495603_0119321 3300046455 Unclassified 1537
343 Ga0495629_0003149 3300046459 Bacteria 12497
344 Ga0495651_0032756 3300046462 Bacteria 4052
345 Ga0495653_0009057 3300046463 Bacteria 8143
346 Ga0495653_0027727 3300046463 Bacteria 4533
347 Ga0495580_0008396 3300046472 Bacteria 8214
348 Ga0495580_0092817 3300046472 Bacteria 2101
349 Ga0495582_0004410 3300046473 Bacteria 7920
350 Ga0495582_0050911 3300046473 Bacteria 2283
351 Ga0495639_0001082 3300046475 Bacteria 12263
352 Ga0495664_0029270 3300046477 Bacteria 3220
353 Ga0495594_0037831 3300046499 Bacteria 2634
354 Ga0495594_0160677 3300046499 Bacteria 1277
355 Ga0495608_0070887 3300046511 Bacteria 2275
356 Ga0495628_0000653 3300046516 Bacteria 31740
357 Ga0495628_0078527 3300046516 Bacteria 2567
358 Ga0495630_0002973 3300046517 Bacteria 11768
359 Ga0495630_0002989 3300046517 Bacteria 11727
360 Ga0495630_0010418 3300046517 Bacteria 6711
361 Ga0495652_0001550 3300046529 Bacteria 25167
362 Ga0495665_0001121 3300046531 Bacteria 14192
363 Ga0495665_0024941 3300046531 Bacteria 3213
364 Ga0495640_0009251 3300046533 Bacteria 7683
365 Ga0495640_0079007 3300046533 Bacteria 2191
366 Ga0495586_0028746 3300046535 Bacteria 2975
367 Ga0495586_0120535 3300046535 Bacteria 1465
368 Ga0495587_0002838 3300046536 Bacteria 11609
369 Ga0495645_0098620 3300046543 Bacteria 2079
370 Ga0495645_0109268 3300046543 Bacteria 1958
371 Ga0495667_0000572 3300046559 Bacteria 23486
372 Ga0495634_0011783 3300046642 Bacteria 6357
373 Ga0495635_0000120 3300046663 Bacteria 47330
374 Ga0495657_0000371 3300046675 Bacteria 41627
375 Ga0495599_0000065 3300046678 Bacteria 72906
376 Ga0495623_0000014 3300046679 Bacteria 119814
377 Ga0495646_0007386 3300046680 Bacteria 6985
378 Ga0495658_0000262 3300046683 Bacteria 29829
379 Ga0495658_0001049 3300046683 Bacteria 14600
380 Ga0495613_0015519 3300046689 Bacteria 5664
381 Ga0495613_0120022 3300046689 Bacteria 1888
382 Ga0495624_0057845 3300046690 Bacteria 2437
383 Ga0495600_0003930 3300046809 Bacteria 8829
384 Ga0495581_0000588 3300047315 Bacteria 18995
385 Ga0495604_0001307 3300047317 Bacteria 20361
386 Ga0495674_0001097 3300047319 Bacteria 25967
387 Ga0495680_0005099 3300047322 Bacteria 12401
388 Ga0495680_0008088 3300047322 Bacteria 9589
389 Ga0495675_0000875 3300047444 Bacteria 18392
390 Ga0495684_0000221 3300047471 Bacteria 44218
391 Ga0495593_0000338 3300047673 Bacteria 25960
392 Ga0495602_0002462 3300048088 Bacteria 18853
393 Ga0496100_0070289 3300048903 Bacteria 2334
394 Ga0496101_0030298 3300048904 Bacteria 3792
395 Ga0496101_0041301 3300048904 Bacteria 3289
396 Ga0496101_0081058 3300048904 Bacteria 2399
397 Ga0496102_0012691 3300048905 Bacteria 7297
398 Ga0496102_0036524 3300048905 Bacteria 4427
399 Ga0496102_0040322 3300048905 Bacteria 4223
400 Ga0496102_0219605 3300048905 Bacteria 1791
401 Ga0496103_0004583 3300048906 Bacteria 8372
402 Ga0496104_0005257 3300048907 Bacteria 11316
403 Ga0496104_0104166 3300048907 Bacteria 2718
404 Ga0496106_0025570 3300048909 Bacteria 4394
405 Ga0496106_0029316 3300048909 Bacteria 4101
406 Ga0496106_0091434 3300048909 Bacteria 2350
407 Ga0496106_0103022 3300048909 Bacteria 2215
408 Ga0496106_0104271 3300048909 Bacteria 2202
409 Ga0496107_0125700 3300048910 Bacteria 1891
410 Ga0496107_0259294 3300048910 Bacteria 1294
411 Ga0496107_0261454 3300048910 Unclassified 1288
412 Ga0496108_0008113 3300048911 Bacteria 8515
413 Ga0496108_0017792 3300048911 Bacteria 5812
414 Ga0496108_0038132 3300048911 Bacteria 4003
415 Ga0496108_0114627 3300048911 Bacteria 2308
416 Ga0496109_0001699 3300048912 Bacteria 18354
417 Ga0496109_0011547 3300048912 Bacteria 7597
418 Ga0496109_0030354 3300048912 Bacteria 4845
419 Ga0496109_0032959 3300048912 Unclassified 4660
420 Ga0496110_0027057 3300048913 Bacteria 4913
421 Ga0496110_0041745 3300048913 Bacteria 4003
422 Ga0496111_0003685 3300048914 Bacteria 9521
423 Ga0496112_0000394 3300048915 Bacteria 28507
424 Ga0496112_0081398 3300048915 Bacteria 3202
425 Ga0496112_0097841 3300048915 Unclassified 2904
426 Ga0496113_0045681 3300048916 Bacteria 3249
427 Ga0496113_0049797 3300048916 Bacteria 3121
428 Ga0496113_0122986 3300048916 Bacteria 2030
429 Ga0496114_0052675 3300048917 Bacteria 3391
430 Ga0496114_0230591 3300048917 Bacteria 1627
431 Ga0501295_004801 3300049518 Bacteria 1787
432 Ga0501296_004480 3300049519 Bacteria 1528
433 Ga0501031_0087493 3300049568 Bacteria 2032
434 Ga0501031_0131795 3300049568 Unclassified 1633
435 Ga0501034_0101964 3300049571 Bacteria 2863
436 Ga0501036_0061129 3300049572 Bacteria 3191
437 Ga0501037_0030237 3300049573 Bacteria 4003
438 Ga0501038_0135552 3300049574 Bacteria 2018
439 Ga0501039_0037885 3300049575 Unclassified 3724
440 Ga0501040_0023073 3300049576 Bacteria 4170
441 Ga0501041_0038407 3300049577 Bacteria 2903
442 Ga0501041_0079609 3300049577 Bacteria 2017
443 Ga0501042_0031112 3300049578 Bacteria 3776
444 Ga0501042_0042201 3300049578 Bacteria 3246
445 Ga0501046_0371610 3300049580 Bacteria 1036
446 Ga0501047_0046515 3300049581 Bacteria 4194
447 Ga0501048_0067143 3300049582 Bacteria 2536
448 Ga0501048_0074771 3300049582 Bacteria 2390
449 Ga0501067_0009143 3300049583 Bacteria 5487
450 Ga0501067_0029826 3300049583 Bacteria 3023
451 Ga0501067_0030721 3300049583 Bacteria 2979
452 Ga0501068_0005640 3300049584 Bacteria 6857
453 Ga0501068_0045015 3300049584 Bacteria 2658
454 Ga0501068_0065436 3300049584 Bacteria 2213
455 Ga0501068_0091535 3300049584 Bacteria 1877
456 Ga0501069_0001844 3300049585 Bacteria 10573
457 Ga0501069_0006355 3300049585 Bacteria 6174
458 Ga0501069_0036713 3300049585 Bacteria 2703
459 Ga0501069_0088475 3300049585 Bacteria 1750
460 Ga0501070_0007476 3300049586 Bacteria 9281
461 Ga0501070_0016540 3300049586 Bacteria 6194
462 Ga0501070_0137546 3300049586 Bacteria 2017
463 Ga0501070_0140826 3300049586 Bacteria 1991
464 Ga0501071_0005277 3300049587 Bacteria 8287
465 Ga0501071_0028913 3300049587 Bacteria 3908
466 Ga0501071_0130483 3300049587 Bacteria 1866
467 Ga0501072_0007071 3300049588 Bacteria 8520
468 Ga0501073_0055549 3300049589 Bacteria 2770
469 Ga0501073_0071481 3300049589 Bacteria 2417
470 Ga0501074_0002538 3300049590 Bacteria 12734
471 Ga0501074_0018756 3300049590 Bacteria 5026
472 Ga0501074_0153605 3300049590 Bacteria 1645
473 Ga0501075_0157446 3300049591 Unclassified 1732
474 Ga0501076_0043680 3300049592 Bacteria 3532
475 Ga0501076_0099303 3300049592 Bacteria 2345
476 Ga0501076_0143737 3300049592 Bacteria 1939
477 Ga0501076_0245724 3300049592 Bacteria 1464
478 Ga0501077_0000524 3300049593 Bacteria 23229
479 Ga0501077_0032949 3300049593 Bacteria 3299
480 Ga0501077_0087694 3300049593 Bacteria 1972
481 Ga0501214_004135 3300049659 Bacteria 1328
482 Ga0501214_012843 3300049659 Bacteria 962
483 Ga0501217_001987 3300049661 Unclassified 3945
484 Ga0501217_031471 3300049661 Bacteria 1308
485 Ga0501233_025685 3300049668 Bacteria 1297
486 Ga0501235_034814 3300049669 Bacteria 1143
487 Ga0501249_012390 3300049679 Bacteria 1801
488 Ga0501257_032675 3300049686 Bacteria 1259
489 Ga0501221_005650 3300049704 Bacteria 2097
490 Ga0501079_0005768 3300049741 Bacteria 9258
491 Ga0501079_0008168 3300049741 Bacteria 7934
492 Ga0501079_0043214 3300049741 Bacteria 3478
493 Ga0501080_0035917 3300049742 Bacteria 4626
494 Ga0501080_0055347 3300049742 Bacteria 3695
495 Ga0501080_0129067 3300049742 Bacteria 2340
496 Ga0501081_0004622 3300049743 Bacteria 8840
497 Ga0501081_0011130 3300049743 Bacteria 5883
498 Ga0501083_0004073 3300049744 Bacteria 10282
499 Ga0501083_0060306 3300049744 Bacteria 2534
500 Ga0501083_0090378 3300049744 Bacteria 2023
501 Ga0501262_002646 3300049759 Bacteria 2023
502 Ga0501263_013152 3300049760 Bacteria 1045
503 Ga0501271_001588 3300049768 Bacteria 1965
504 Ga0501272_004242 3300049769 Bacteria 1484
505 Ga0501273_007031 3300049770 Bacteria 1317
506 Ga0501283_003475 3300049779 Bacteria 2084
507 Ga0501045_0027982 3300049824 Bacteria 4066
508 Ga0501045_0045894 3300049824 Bacteria 3181
509 Ga0501045_0130840 3300049824 Bacteria 1865
510 nmdc:mga05p37_1187_c1 3300050507 Bacteria 30065
511 nmdc:mga05p37_230979_c1 3300050507 Bacteria 2229
512 nmdc:mga05p37_88826_c1 3300050507 Unclassified 3809
513 nmdc:mga09592_44311_c1 3300050508 Bacteria 3744
514 nmdc:mga09592_4808_c1 3300050508 Bacteria 10944
515 nmdc:mga09592_6302_c1 3300050508 Bacteria 9664
516 nmdc:mga06r32_159161_c1 3300050510 Unclassified 2240
517 nmdc:mga06r32_192110_c1 3300050510 Unclassified 2029
518 nmdc:mga06r32_462226_c1 3300050510 Bacteria 1248
519 nmdc:mga0n895_16838_c1 3300050512 Bacteria 6719
520 nmdc:mga0n895_48146_c1 3300050512 Bacteria 4171
521 nmdc:mga0n895_77176_c1 3300050512 Bacteria 3313
522 nmdc:mga0n895_9416_c1 3300050512 Bacteria 8545
523 nmdc:mga0a205_132924_c1 3300050515 Bacteria 2388
524 nmdc:mga0a205_33902_c1 3300050515 Bacteria 4097
525 nmdc:mga0a205_339239_c1 3300050515 Unclassified 1371
526 nmdc:mga0a205_89447_c1 3300050515 Bacteria 2976
527 Ga0495601_0004857 3300053077 Bacteria 7799
528 Ga0495612_0006869 3300053078 Bacteria 4656
529 Ga0495619_0027611 3300053085 Bacteria 3657
530 Ga0501084_0013422 3300054114 Bacteria 6779
531 Ga0501084_0015548 3300054114 Bacteria 6312
532 Ga0501084_0055493 3300054114 Bacteria 3314
533 Ga0501084_0185666 3300054114 Bacteria 1755
534 Ga0501084_0376655 3300054114 Bacteria 1199
535 Ga0590071_006015 3300059421 Bacteria 2901
536 Ga0590074_013689 3300059423 Bacteria 1371
537 Ga0590077_015351 3300059426 Bacteria 1600
538 Ga0501082_0009687 3300060353 Bacteria 8296
539 Ga0501082_0016393 3300060353 Bacteria 6379
540 Ga0501082_0120250 3300060353 Bacteria 2277
541 Ga0501082_0384321 3300060353 Bacteria 1225
542 Ga0530510_0035315 3300061734 Bacteria 3603
543 Ga0530510_0100739 3300061734 Bacteria 2112
544 Ga0501040_0146606
545 JGI25406J46586_10015222
546 Ga0065712_10119105
547 Ga0065715_10106221
548 Ga0065715_10119747
549 Ga0070658_10039188
550 Ga0070676_10009939
551 Ga0070683_100000440
552 Ga0070683_100035503
553 Ga0070683_100095768
554 Ga0070683_100158330
555 Ga0070690_100104290
556 Ga0070680_100000733
557 Ga0070680_100007400
558 Ga0070680_100009987
559 Ga0070680_100250375
560 Ga0070660_100080309
561 Ga0070660_100157350
562 Ga0070660_100270548
563 Ga0070689_100013163
564 Ga0070687_100043872
565 Ga0070661_100006474
566 Ga0070661_100113314
567 Ga0070661_100131226
568 Ga0070668_100071405
569 Ga0070675_100006592
570 Ga0070675_100061064
571 Ga0070673_100018930
572 Ga0070673_100086203
573 Ga0070688_100018929
574 Ga0070667_100105768
575 Ga0070703_10023331
576 Ga0070709_10051956
577 Ga0070714_100005688
578 Ga0070714_100198845
579 Ga0070714_100259134
580 Ga0070713_100000149
581 Ga0070713_100010888
582 Ga0070713_100094791
583 Ga0070711_100002799
584 Ga0070711_100006672
585 Ga0070705_100012253
586 Ga0070705_100049314
587 Ga0070705_100083594
588 Ga0070700_100034915
589 Ga0070708_100485087
590 Ga0070708_100503996
591 Ga0070678_100038030
592 Ga0070662_100057690
593 Ga0070681_10002622
594 Ga0070681_10076015
595 Ga0070681_10088605
596 Ga0068867_100008098
597 Ga0068867_100026007
598 Ga0070706_100004466
599 Ga0070707_100002753
600 Ga0070707_100004738
601 Ga0070707_100026141
602 Ga0070707_100137827
603 Ga0070707_100162842
604 Ga0070698_100014842
605 Ga0070698_100052480
606 Ga0070698_100112259
607 Ga0070698_100191377
608 Ga0070698_100258400
609 Ga0070698_100264815
610 Ga0070699_100000131
611 Ga0070699_100001862
612 Ga0070699_100003191
613 Ga0070699_100004511
614 Ga0070699_100008937
615 Ga0070699_100119511
616 Ga0070699_100128518
617 Ga0070679_100183644
618 Ga0070697_100004653
619 Ga0070697_100075760
620 Ga0070672_100034932
621 Ga0070686_100276676
622 Ga0070696_100000436
623 Ga0070696_100000526
624 Ga0070696_100038249
625 Ga0070696_100060512
626 Ga0070696_100153863
627 Ga0070696_100174429
628 Ga0070693_100134077
629 Ga0070665_100216994
630 Ga0070665_100262021
631 Ga0070704_100010332
632 Ga0070704_100035572
633 Ga0068855_100158610
634 Ga0070664_100031929
635 Ga0070664_100215207
636 Ga0068857_100003989
637 Ga0068857_100029110
638 Ga0068854_100005676
639 Ga0068854_100039691
640 Ga0070702_100049156
641 Ga0070702_100202963
642 Ga0068859_100042916
643 Ga0068859_100098835
644 Ga0068864_100008732
645 Ga0068864_100373723
646 Ga0068861_100081029
647 Ga0068870_10036053
648 Ga0068863_100084508
649 Ga0068858_100107831
650 Ga0068860_100047764
651 Ga0068862_100141382
652 Ga0081455_10070069
653 Ga0081455_10110720
654 Ga0081538_10066647
655 Ga0081539_10000174
656 Ga0070717_10023344
657 Ga0070712_100008515
658 Ga0070712_100240656
659 Ga0097621_100313067
660 Ga0075428_100036820
661 Ga0075428_100102374
662 Ga0075428_100417013
663 Ga0075431_100118877
664 Ga0075431_100279457
665 Ga0075433_10042982
666 Ga0075433_10115005
667 Ga0075434_100010819
668 Ga0075434_100070739
669 Ga0075429_100005664
670 Ga0075429_100045635
671 Ga0075429_100162791
672 Ga0068865_100006776
673 Ga0068865_100023280
674 Ga0097620_100042915
675 Ga0097620_100098837
676 Ga0105240_10080722
677 Ga0105240_10140330
678 Ga0111539_10920194
679 Ga0105245_10113490
680 Ga0114129_10005002
681 Ga0114129_10046313
682 Ga0114129_10133652
683 Ga0114129_10135190
684 Ga0105243_10135701
685 Ga0105241_10017856
686 Ga0105242_10021658
687 Ga0105248_10090019
688 Ga0105248_10176669
689 Ga0105248_10273421
690 Ga0105237_10072012
691 Ga0105237_10113203
692 Ga0105237_10623746
693 Ga0105249_10104613
694 Ga0105249_10326354
695 Ga0105239_10007902
696 Ga0105246_10040986
697 Ga0105246_10428684
698 Ga0157373_10241019
699 Ga0157373_10247286
700 Ga0157378_10003362
701 Ga0163162_10047295
702 Ga0157372_10103508
703 Ga0157372_10289412
704 Ga0157375_10374581
705 Ga0163163_10080871
706 Ga0157377_10126864
707 Ga0163161_10070245
708 Ga0163161_10234741
709 Ga0206356_10574207
710 Ga0207653_10003318
711 Ga0207692_10066369
712 Ga0207692_10093766
713 Ga0207642_10005341
714 Ga0207680_10130869
715 Ga0207699_10021895
716 Ga0207699_10044244
717 Ga0207643_10003344
718 Ga0207643_10004403
719 Ga0207705_10031528
720 Ga0207684_10011945
721 Ga0207684_10122174
722 Ga0207654_10003690
723 Ga0207707_10002170
724 Ga0207707_10007951
725 Ga0207707_10010026
726 Ga0207695_10027839
727 Ga0207695_10083088
728 Ga0207693_10009997
729 Ga0207693_10015641
730 Ga0207663_10004700
731 Ga0207660_10002494
732 Ga0207660_10065616
733 Ga0207660_10071715
734 Ga0207660_10276152
735 Ga0207662_10005939
736 Ga0207657_10023152
737 Ga0207657_10267601
738 Ga0207652_10008103
739 Ga0207652_10010159
740 Ga0207652_10416279
741 Ga0207646_10013251
742 Ga0207646_10047450
743 Ga0207646_10078275
744 Ga0207646_10084661
745 Ga0207646_10116743
746 Ga0207646_10254351
747 Ga0207681_10171686
748 Ga0207650_10431780
749 Ga0207659_10010500
750 Ga0207659_10054384
751 Ga0207700_10000599
752 Ga0207700_10007739
753 Ga0207700_10070076
754 Ga0207664_10010119
755 Ga0207664_10076595
756 Ga0207664_10176114
757 Ga0207690_10215832
758 Ga0207706_10008792
759 Ga0207686_10002785
760 Ga0207670_10025663
761 Ga0207669_10191322
762 Ga0207665_10087519
763 Ga0207691_10023958
764 Ga0207691_10126022
765 Ga0207661_10012127
766 Ga0207661_10021733
767 Ga0207661_10042428
768 Ga0207661_10405791
769 Ga0207679_10036953
770 Ga0207679_10187900
771 Ga0207679_10266378
772 Ga0207667_10616197
773 Ga0207668_10040764
774 Ga0207668_10059917
775 Ga0207640_10019626
776 Ga0207640_10162926
777 Ga0207658_10420961
778 Ga0207703_10241385
779 Ga0207639_10048293
780 Ga0207678_10131214
781 Ga0207708_10007267
782 Ga0207641_10074027
783 Ga0207648_10002060
784 Ga0207648_10503763
785 Ga0207676_10002069
786 Ga0207676_10009280
787 Ga0207676_10074337
788 Ga0207676_10359753
789 Ga0207674_10007014
790 Ga0207674_10017092
791 Ga0207674_10096916
792 Ga0207675_100176646
793 Ga0207683_10058273
794 Ga0207698_10119060
795 Ga0209974_10023671
796 Ga0268266_10076479
797 Ga0268264_10116309
798 Ga0268264_10168409
799 Ga0307408_100011030
800 Ga0307408_100069104
801 Ga0307408_100096458
802 Ga0316575_10008068
803 Ga0316579_10059231
804 Ga0316576_10013154
805 Ga0316578_10088761
806 Ga0307405_10058570
807 Ga0307405_10074483
808 Ga0307405_10139853
809 Ga0307413_10006927
810 Ga0307413_10010645
811 Ga0307413_10022298
812 Ga0307413_10037584
813 Ga0307413_10056800
814 Ga0307413_10161437
815 Ga0307410_10002633
816 Ga0307410_10005177
817 Ga0307410_10007383
818 Ga0307410_10007704
819 Ga0307410_10024757
820 Ga0307410_10041732
821 Ga0307407_10038931
822 Ga0307407_10141330
823 Ga0307412_10024923
824 Ga0307409_100048008
825 Ga0307409_100055301
826 Ga0307409_100217146
827 Ga0307409_100294495
828 Ga0307416_100018370
829 Ga0307416_100021841
830 Ga0307416_100033140
831 Ga0307416_100060168
832 Ga0307416_100096272
833 Ga0307416_100102675
834 Ga0307416_100116164
835 Ga0307416_100255897
836 Ga0307416_100578545
837 Ga0307414_10041216
838 Ga0307414_10053221
839 Ga0307414_10066020
840 Ga0307414_10073089
841 Ga0307414_10128357
842 Ga0307414_10454344
843 Ga0307411_10009538
844 Ga0307411_10015803
845 Ga0307411_10053455
846 Ga0307411_10102680
847 Ga0307411_10386977
848 Ga0307415_100015340
849 Ga0307415_100016741
850 Ga0307415_100058472
851 Ga0307415_100071690
852 Ga0316583_10032882
853 Ga0373934_0000757
854 Ga0373953_0090504
855 Ga0373956_0000180
856 Ga0373957_0016721
857 Ga0373943_0000229
858 Ga0373955_0000462
859 Ga0316574_0295136
860 Ga0373924_0097208
861 Ga0373931_0003655
862 Ga0373935_0101861
863 Ga0373933_0000370
864 Ga0373947_0003120
865 Ga0373937_0001012
866 Ga0316582_0054075
867 Ga0395905_0093574
868 Ga0395905_0407152
869 Ga0395901_0421385
870 Ga0439436_0029961
871 Ga0439448_0015975
872 Ga0439462_0012907
873 Ga0450898_012677
874 Ga0439446_0030373
875 Ga0439434_0035100
876 Ga0451577_0022065
877 Ga0451577_0066589
878 Ga0451577_0204378
879 Ga0453683_0018695
880 Ga0453683_0068330
881 Ga0453684_0302406
882 Ga0466967_0139650
883 Ga0495592_0004361
884 Ga0495592_0076513
885 Ga0495603_0119321
886 Ga0495629_0003149
887 Ga0495651_0032756
888 Ga0495653_0009057
889 Ga0495653_0027727
890 Ga0495580_0008396
891 Ga0495580_0092817
892 Ga0495582_0004410
893 Ga0495582_0050911
894 Ga0495639_0001082
895 Ga0495664_0029270
896 Ga0495594_0037831
897 Ga0495594_0160677
898 Ga0495608_0070887
899 Ga0495628_0000653
900 Ga0495628_0078527
901 Ga0495630_0002973
902 Ga0495630_0002989
903 Ga0495630_0010418
904 Ga0495652_0001550
905 Ga0495665_0001121
906 Ga0495665_0024941
907 Ga0495640_0009251
908 Ga0495640_0079007
909 Ga0495586_0028746
910 Ga0495586_0120535
911 Ga0495587_0002838
912 Ga0495645_0098620
913 Ga0495645_0109268
914 Ga0495667_0000572
915 Ga0495634_0011783
916 Ga0495635_0000120
917 Ga0495657_0000371
918 Ga0495599_0000065
919 Ga0495623_0000014
920 Ga0495646_0007386
921 Ga0495658_0000262
922 Ga0495658_0001049
923 Ga0495613_0015519
924 Ga0495613_0120022
925 Ga0495624_0057845
926 Ga0495600_0003930
927 Ga0495581_0000588
928 Ga0495604_0001307
929 Ga0495674_0001097
930 Ga0495680_0005099
931 Ga0495680_0008088
932 Ga0495675_0000875
933 Ga0495684_0000221
934 Ga0495593_0000338
935 Ga0495602_0002462
936 Ga0496100_0070289
937 Ga0496101_0030298
938 Ga0496101_0041301
939 Ga0496101_0081058
940 Ga0496102_0012691
941 Ga0496102_0036524
942 Ga0496102_0040322
943 Ga0496102_0219605
944 Ga0496103_0004583
945 Ga0496104_0005257
946 Ga0496104_0104166
947 Ga0496106_0025570
948 Ga0496106_0029316
949 Ga0496106_0091434
950 Ga0496106_0103022
951 Ga0496106_0104271
952 Ga0496107_0125700
953 Ga0496107_0259294
954 Ga0496107_0261454
955 Ga0496108_0008113
956 Ga0496108_0017792
957 Ga0496108_0038132
958 Ga0496108_0114627
959 Ga0496109_0001699
960 Ga0496109_0011547
961 Ga0496109_0030354
962 Ga0496109_0032959
963 Ga0496110_0027057
964 Ga0496110_0041745
965 Ga0496111_0003685
966 Ga0496112_0000394
967 Ga0496112_0081398
968 Ga0496112_0097841
969 Ga0496113_0045681
970 Ga0496113_0049797
971 Ga0496113_0122986
972 Ga0496114_0052675
973 Ga0496114_0230591
974 Ga0501295_004801
975 Ga0501296_004480
976 Ga0501031_0087493
977 Ga0501031_0131795
978 Ga0501034_0101964
979 Ga0501036_0061129
980 Ga0501037_0030237
981 Ga0501038_0135552
982 Ga0501039_0037885
983 Ga0501040_0023073
984 Ga0501041_0038407
985 Ga0501041_0079609
986 Ga0501042_0031112
987 Ga0501042_0042201
988 Ga0501046_0371610
989 Ga0501047_0046515
990 Ga0501048_0067143
991 Ga0501048_0074771
992 Ga0501067_0009143
993 Ga0501067_0029826
994 Ga0501067_0030721
995 Ga0501068_0005640
996 Ga0501068_0045015
997 Ga0501068_0065436
998 Ga0501068_0091535
999 Ga0501069_0001844
1000 Ga0501069_0006355
1001 Ga0501069_0036713
1002 Ga0501069_0088475
1003 Ga0501070_0007476
1004 Ga0501070_0016540
1005 Ga0501070_0137546
1006 Ga0501070_0140826
1007 Ga0501071_0005277
1008 Ga0501071_0028913
1009 Ga0501071_0130483
1010 Ga0501072_0007071
1011 Ga0501073_0055549
1012 Ga0501073_0071481
1013 Ga0501074_0002538
1014 Ga0501074_0018756
1015 Ga0501074_0153605
1016 Ga0501075_0157446
1017 Ga0501076_0043680
1018 Ga0501076_0099303
1019 Ga0501076_0143737
1020 Ga0501076_0245724
1021 Ga0501077_0000524
1022 Ga0501077_0032949
1023 Ga0501077_0087694
1024 Ga0501214_004135
1025 Ga0501214_012843
1026 Ga0501217_001987
1027 Ga0501217_031471
1028 Ga0501233_025685
1029 Ga0501235_034814
1030 Ga0501249_012390
1031 Ga0501257_032675
1032 Ga0501221_005650
1033 Ga0501079_0005768
1034 Ga0501079_0008168
1035 Ga0501079_0043214
1036 Ga0501080_0035917
1037 Ga0501080_0055347
1038 Ga0501080_0129067
1039 Ga0501081_0004622
1040 Ga0501081_0011130
1041 Ga0501083_0004073
1042 Ga0501083_0060306
1043 Ga0501083_0090378
1044 Ga0501262_002646
1045 Ga0501263_013152
1046 Ga0501271_001588
1047 Ga0501272_004242
1048 Ga0501273_007031
1049 Ga0501283_003475
1050 Ga0501045_0027982
1051 Ga0501045_0045894
1052 Ga0501045_0130840
1053 nmdc:mga05p37_1187_c1
1054 nmdc:mga05p37_230979_c1
1055 nmdc:mga05p37_88826_c1
1056 nmdc:mga09592_44311_c1
1057 nmdc:mga09592_4808_c1
1058 nmdc:mga09592_6302_c1
1059 nmdc:mga06r32_159161_c1
1060 nmdc:mga06r32_192110_c1
1061 nmdc:mga06r32_462226_c1
1062 nmdc:mga0n895_16838_c1
1063 nmdc:mga0n895_48146_c1
1064 nmdc:mga0n895_77176_c1
1065 nmdc:mga0n895_9416_c1
1066 nmdc:mga0a205_132924_c1
1067 nmdc:mga0a205_33902_c1
1068 nmdc:mga0a205_339239_c1
1069 nmdc:mga0a205_89447_c1
1070 Ga0495601_0004857
1071 Ga0495612_0006869
1072 Ga0495619_0027611
1073 Ga0501084_0013422
1074 Ga0501084_0015548
1075 Ga0501084_0055493
1076 Ga0501084_0185666
1077 Ga0501084_0376655
1078 Ga0590071_006015
1079 Ga0590074_013689
1080 Ga0590077_015351
1081 Ga0501082_0009687
1082 Ga0501082_0016393
1083 Ga0501082_0120250
1084 Ga0501082_0384321
1085 Ga0530510_0035315
1086 Ga0530510_0100739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

233

0.87

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

132

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3twd-assembly1.cif.gz_A glmuc1 in complex with an antibacterial inhibitor 0.878 244 286
1xhd-assembly1.cif.gz_A x-ray crystal structure of putative acetyltransferase, product of bc4754 gene [bacillus cereus] 0.87 243 280
5ftv-assembly2.cif.gz_C pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.8566 2 236
4ho4-assembly2.cif.gz_B crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate 0.8566 1 236
8f73-assembly1.cif.gz_B-2 crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose 0.8552 2 233
ID Description Score Start End Superfamily
af_Q54FQ8_345_438_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.9363 254 284 2.160.10.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8943 1 219 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8903 1 219 3.90.550.10
af_O14772_404_479_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8897 247 289 2.160.10.10
af_P87163_322_448_2.160.10.10 Mainly Beta;3 Solenoid;UDP N-Acetylglucosamine Acyltransferase; domain 1;Hexapeptide repeat proteins 0.8639 243 289 2.160.10.10
ID Description Score Start End GO Terms
AF-A0A2V7KNG1-F1-model_v4 Nucleotidyltransferase 0.9726 1 209 GO:0009058
GO:0016779
AF-A0A2V7KNG1-F1-model_v4 Nucleotidyltransferase 0.9635 1 209 GO:0009058
GO:0016779
AF-A0A3M1DHZ0-F1-model_v4 Nucleotidyltransferase 0.9601 14 288 GO:0009058
GO:0016779
AF-A0A1G0LP95-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9582 1 233 GO:0009058
GO:0016779
AF-A0A7V9FEN7-F1-model_v4 Nucleotidyltransferase 0.9521 51 289 GO:0009058
GO:0016779

Map