F461636

General Info

Members Datasets Scaffolds Average Seq Length
543 250 1086 149

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10927294|Ga0207668_109272941
Length 182
Sequence LPDQYLTPKRGFETVKTGSGGGIHRLETFSHMASTLSDQVNTGIAEAMKAKDTVRLSALRMLKAAIMNKGVEKGRDLDDAEVLQVIGALAKQRRDSIEQFGKAGRQDLVQKETGDLHVLEAFLPAAASAADIEAAVMAAIAETGASSPKDMGRVMKAVMPKLAGKTVDGRAVNEAVRRALGA

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
178 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
228 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
229 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
246 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 2.21
Rhizosphere 96.87
Stem 0
Stem Tuber 0
Unclassified 11.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_10927294 3300025972 Unclassified 776
2 MBSR1b_contig_5371541 2162886012 Bacteria 1094
3 Ga0065712_10000466 3300005290 Bacteria 10964
4 Ga0065715_10161962 3300005293 Bacteria 1621
5 Ga0065707_10097847 3300005295 Bacteria 3131
6 Ga0065707_10646277 3300005295 Unclassified 665
7 Ga0070658_10074658 3300005327 Bacteria 2781
8 Ga0070658_10195846 3300005327 Bacteria 1704
9 Ga0070676_10081067 3300005328 Unclassified 1969
10 Ga0070683_100404814 3300005329 Bacteria 1301
11 Ga0070683_100506126 3300005329 Bacteria 1154
12 Ga0070690_100014623 3300005330 Bacteria 4659
13 Ga0070690_100334778 3300005330 Bacteria 1094
14 Ga0070670_100001433 3300005331 Bacteria 19191
15 Ga0070670_100016980 3300005331 Bacteria 6249
16 Ga0070670_100306230 3300005331 Bacteria 1390
17 Ga0070670_100487992 3300005331 Bacteria 1095
18 Ga0070670_101261485 3300005331 Bacteria 676
19 Ga0070677_10232634 3300005333 Bacteria 906
20 Ga0068869_100196514 3300005334 Bacteria 1589
21 Ga0068869_100518076 3300005334 Bacteria 998
22 Ga0068869_100761850 3300005334 Unclassified 830
23 Ga0070666_10129183 3300005335 Bacteria 1755
24 Ga0070680_100656319 3300005336 Unclassified 902
25 Ga0068868_100587887 3300005338 Unclassified 985
26 Ga0070689_100016372 3300005340 Bacteria 5426
27 Ga0070689_100039417 3300005340 Bacteria 3617
28 Ga0070689_100162669 3300005340 Bacteria 1805
29 Ga0070691_10006286 3300005341 Bacteria 5428
30 Ga0070691_10179083 3300005341 Bacteria 1103
31 Ga0070687_100090725 3300005343 Bacteria 1690
32 Ga0070687_100092777 3300005343 Unclassified 1674
33 Ga0070687_100099560 3300005343 Bacteria 1625
34 Ga0070692_10003674 3300005345 Bacteria 6277
35 Ga0070692_10295068 3300005345 Unclassified 988
36 Ga0070692_10583530 3300005345 Bacteria 737
37 Ga0070668_100058789 3300005347 Bacteria 2975
38 Ga0070668_100196634 3300005347 Bacteria 1654
39 Ga0070668_100554908 3300005347 Unclassified 1000
40 Ga0070669_100662850 3300005353 Unclassified 879
41 Ga0070675_100003805 3300005354 Bacteria 11456
42 Ga0070675_100012401 3300005354 Bacteria 6678
43 Ga0070675_100018523 3300005354 Bacteria 5544
44 Ga0070675_100034668 3300005354 Bacteria 4097
45 Ga0070675_100131036 3300005354 Bacteria 2137
46 Ga0070675_100131108 3300005354 Bacteria 2136
47 Ga0070675_100207806 3300005354 Bacteria 1701
48 Ga0070675_100783656 3300005354 Bacteria 871
49 Ga0070671_100213942 3300005355 Bacteria 1635
50 Ga0070671_100309720 3300005355 Bacteria 1345
51 Ga0070674_100225208 3300005356 Bacteria 1461
52 Ga0070674_100257983 3300005356 Bacteria 1372
53 Ga0070673_100001953 3300005364 Bacteria 12424
54 Ga0070673_100016161 3300005364 Bacteria 5268
55 Ga0070673_100118003 3300005364 Bacteria 2209
56 Ga0070673_100130893 3300005364 Bacteria 2105
57 Ga0070673_100157779 3300005364 Bacteria 1927
58 Ga0070673_100299246 3300005364 Bacteria 1416
59 Ga0070673_100407653 3300005364 Unclassified 1217
60 Ga0070688_100030604 3300005365 Bacteria 3231
61 Ga0070688_100054196 3300005365 Bacteria 2511
62 Ga0070688_100455676 3300005365 Bacteria 957
63 Ga0070659_100091522 3300005366 Bacteria 2438
64 Ga0070659_101034809 3300005366 Unclassified 722
65 Ga0070667_100399437 3300005367 Unclassified 1251
66 Ga0070703_10253322 3300005406 Bacteria 715
67 Ga0070701_10069953 3300005438 Unclassified 1874
68 Ga0070701_10119168 3300005438 Bacteria 1485
69 Ga0070701_10166068 3300005438 Bacteria 1282
70 Ga0070705_100000578 3300005440 Bacteria 21273
71 Ga0070705_100004206 3300005440 Bacteria 7030
72 Ga0070705_100141423 3300005440 Unclassified 1584
73 Ga0070705_100341183 3300005440 Bacteria 1089
74 Ga0070705_100398360 3300005440 Bacteria 1019
75 Ga0070700_100056487 3300005441 Unclassified 2461
76 Ga0070700_100089675 3300005441 Bacteria 2004
77 Ga0070700_100398904 3300005441 Bacteria 1034
78 Ga0070694_100001421 3300005444 Bacteria 14035
79 Ga0070694_100010403 3300005444 Bacteria 5740
80 Ga0070694_100258499 3300005444 Bacteria 1320
81 Ga0070708_100569973 3300005445 Bacteria 1068
82 Ga0070708_100949609 3300005445 Bacteria 807
83 Ga0070663_100840033 3300005455 Bacteria 790
84 Ga0070678_100343235 3300005456 Bacteria 1282
85 Ga0070678_101516346 3300005456 Bacteria 628
86 Ga0070662_100030681 3300005457 Bacteria 3765
87 Ga0070662_100056083 3300005457 Bacteria 2860
88 Ga0070662_100162039 3300005457 Bacteria 1750
89 Ga0070662_100424557 3300005457 Bacteria 1100
90 Ga0070662_100643587 3300005457 Bacteria 894
91 Ga0070662_100852571 3300005457 Bacteria 776
92 Ga0070681_10003182 3300005458 Bacteria 15287
93 Ga0070681_10365995 3300005458 Bacteria 1352
94 Ga0068867_100103488 3300005459 Bacteria 2178
95 Ga0068867_100219175 3300005459 Bacteria 1532
96 Ga0070685_10012979 3300005466 Bacteria 4388
97 Ga0070685_10259671 3300005466 Unclassified 1155
98 Ga0070706_100237484 3300005467 Bacteria 1702
99 Ga0070707_100131296 3300005468 Bacteria 2436
100 Ga0070707_100132641 3300005468 Bacteria 2423
101 Ga0070698_100013325 3300005471 Bacteria 8702
102 Ga0070698_100146246 3300005471 Bacteria 2313
103 Ga0070698_100543582 3300005471 Bacteria 1101
104 Ga0070699_100005922 3300005518 Bacteria 10678
105 Ga0070699_100068210 3300005518 Bacteria 3088
106 Ga0070684_100764562 3300005535 Bacteria 902
107 Ga0070697_100075390 3300005536 Bacteria 2773
108 Ga0070672_100023943 3300005543 Bacteria 4504
109 Ga0070672_100032760 3300005543 Bacteria 3926
110 Ga0070672_100148950 3300005543 Bacteria 1935
111 Ga0070672_100178020 3300005543 Bacteria 1771
112 Ga0070672_100449687 3300005543 Bacteria 1109
113 Ga0070686_100173284 3300005544 Bacteria 1528
114 Ga0070686_100424097 3300005544 Bacteria 1017
115 Ga0070695_100000155 3300005545 Bacteria 32258
116 Ga0070695_100052454 3300005545 Bacteria 2621
117 Ga0070695_100681871 3300005545 Unclassified 814
118 Ga0070696_100000499 3300005546 Bacteria 24777
119 Ga0070696_100007757 3300005546 Bacteria 7161
120 Ga0070696_100147883 3300005546 Bacteria 1722
121 Ga0070704_100012839 3300005549 Bacteria 5180
122 Ga0070704_100113225 3300005549 Bacteria 2068
123 Ga0070704_100174595 3300005549 Bacteria 1713
124 Ga0070704_100349634 3300005549 Bacteria 1247
125 Ga0070704_100963074 3300005549 Bacteria 770
126 Ga0070664_100020216 3300005564 Bacteria 5482
127 Ga0070664_100046355 3300005564 Bacteria 3671
128 Ga0070664_100077453 3300005564 Bacteria 2859
129 Ga0070664_100900136 3300005564 Bacteria 830
130 Ga0070664_101131469 3300005564 Unclassified 738
131 Ga0068857_100035631 3300005577 Bacteria 4407
132 Ga0068857_100109373 3300005577 Bacteria 2483
133 Ga0068857_100529735 3300005577 Bacteria 1108
134 Ga0068857_101045835 3300005577 Bacteria 787
135 Ga0070702_100396639 3300005615 Bacteria 986
136 Ga0070702_100508677 3300005615 Bacteria 886
137 Ga0068859_100018733 3300005617 Bacteria 6956
138 Ga0068859_100031420 3300005617 Bacteria 5333
139 Ga0068859_100070530 3300005617 Bacteria 3530
140 Ga0068859_100156732 3300005617 Bacteria 2355
141 Ga0068864_100051843 3300005618 Bacteria 3536
142 Ga0068864_100114399 3300005618 Bacteria 2406
143 Ga0068864_100164517 3300005618 Bacteria 2019
144 Ga0068861_100057477 3300005719 Bacteria 2972
145 Ga0068861_100282983 3300005719 Bacteria 1429
146 Ga0068861_100373277 3300005719 Unclassified 1258
147 Ga0068870_10002177 3300005840 Bacteria 8121
148 Ga0068870_10269486 3300005840 Bacteria 1063
149 Ga0068870_10573272 3300005840 Bacteria 763
150 Ga0068863_100664345 3300005841 Bacteria 1034
151 Ga0068863_100973142 3300005841 Bacteria 851
152 Ga0068858_100062859 3300005842 Bacteria 3434
153 Ga0068858_101429152 3300005842 Bacteria 682
154 Ga0068858_101465469 3300005842 Bacteria 673
155 Ga0068860_100024574 3300005843 Bacteria 5819
156 Ga0068860_100135461 3300005843 Bacteria 2365
157 Ga0068862_100202330 3300005844 Bacteria 1791
158 Ga0068862_100314411 3300005844 Bacteria 1444
159 Ga0068862_100626565 3300005844 Unclassified 1035
160 Ga0081455_10031016 3300005937 Bacteria 4844
161 Ga0081539_10001136 3300005985 Bacteria 48290
162 Ga0081539_10151084 3300005985 Bacteria 1117
163 Ga0075368_10042932 3300006042 Bacteria 1781
164 Ga0075367_10010855 3300006178 Bacteria 4800
165 Ga0097621_100202351 3300006237 Bacteria 1724
166 Ga0068871_100516591 3300006358 Bacteria 1078
167 Ga0075428_100006198 3300006844 Bacteria 13304
168 Ga0075428_100023443 3300006844 Bacteria 6831
169 Ga0075428_100251020 3300006844 Bacteria 1907
170 Ga0075428_100316062 3300006844 Unclassified 1678
171 Ga0075428_100392094 3300006844 Bacteria 1488
172 Ga0075428_100413557 3300006844 Bacteria 1445
173 Ga0075428_100777630 3300006844 Unclassified 1018
174 Ga0075430_100000632 3300006846 Bacteria 26776
175 Ga0075430_100030606 3300006846 Bacteria 4572
176 Ga0075430_100060099 3300006846 Bacteria 3194
177 Ga0075430_100129478 3300006846 Bacteria 2103
178 Ga0075430_100940864 3300006846 Unclassified 712
179 Ga0075431_100002264 3300006847 Bacteria 18442
180 Ga0075431_100395639 3300006847 Bacteria 1383
181 Ga0075433_10112836 3300006852 Bacteria 2411
182 Ga0075433_10113555 3300006852 Bacteria 2403
183 Ga0075433_10124458 3300006852 Bacteria 2290
184 Ga0075434_100000553 3300006871 Bacteria 28642
185 Ga0075434_100011984 3300006871 Bacteria 8204
186 Ga0075434_100784173 3300006871 Bacteria 969
187 Ga0075429_100014017 3300006880 Bacteria 6948
188 Ga0075429_100029637 3300006880 Bacteria 4753
189 Ga0075429_100032335 3300006880 Bacteria 4547
190 Ga0075429_100056671 3300006880 Bacteria 3411
191 Ga0075429_100266695 3300006880 Bacteria 1499
192 Ga0075429_100690853 3300006880 Bacteria 894
193 Ga0075429_101194127 3300006880 Bacteria 664
194 Ga0068865_100540580 3300006881 Unclassified 977
195 Ga0068865_100665866 3300006881 Bacteria 886
196 Ga0068865_100739361 3300006881 Bacteria 844
197 Ga0068865_100911680 3300006881 Bacteria 765
198 Ga0097620_100018729 3300006931 Bacteria 6956
199 Ga0097620_100031420 3300006931 Bacteria 5333
200 Ga0097620_100070533 3300006931 Bacteria 3530
201 Ga0097620_100156720 3300006931 Bacteria 2355
202 Ga0075435_100032196 3300007076 Bacteria 4139
203 Ga0075435_100039090 3300007076 Bacteria 3786
204 Ga0075435_100100724 3300007076 Bacteria 2393
205 Ga0075435_100250187 3300007076 Bacteria 1509
206 Ga0105251_10498449 3300009011 Bacteria 569
207 Ga0111539_10002555 3300009094 Bacteria 24100
208 Ga0111539_10002949 3300009094 Bacteria 22579
209 Ga0111539_10009751 3300009094 Bacteria 12118
210 Ga0111539_10248133 3300009094 Bacteria 2073
211 Ga0111539_10590979 3300009094 Bacteria 1293
212 Ga0111539_12127008 3300009094 Bacteria 651
213 Ga0105245_11744273 3300009098 Bacteria 675
214 Ga0114129_10002512 3300009147 Bacteria 25458
215 Ga0114129_10063014 3300009147 Bacteria 5179
216 Ga0114129_10075079 3300009147 Unclassified 4707
217 Ga0114129_10082780 3300009147 Bacteria 4458
218 Ga0114129_10160142 3300009147 Bacteria 3075
219 Ga0105243_10009286 3300009148 Bacteria 7503
220 Ga0105243_10167754 3300009148 Bacteria 1899
221 Ga0105243_10207878 3300009148 Bacteria 1721
222 Ga0105242_11794791 3300009176 Bacteria 652
223 Ga0105248_10555570 3300009177 Bacteria 1295
224 Ga0105248_10749947 3300009177 Bacteria 1102
225 Ga0105249_10043392 3300009553 Bacteria 4089
226 Ga0105249_10124594 3300009553 Bacteria 2452
227 Ga0105246_10548381 3300011119 Bacteria 990
228 Ga0157371_10554022 3300013102 Bacteria 852
229 Ga0157378_10091325 3300013297 Bacteria 2768
230 Ga0157378_10280219 3300013297 Bacteria 1607
231 Ga0163162_10279601 3300013306 Bacteria 1801
232 Ga0163162_12752698 3300013306 Bacteria 566
233 Ga0157375_10027211 3300013308 Bacteria 5343
234 Ga0157375_10075066 3300013308 Bacteria 3404
235 Ga0157375_10079538 3300013308 Bacteria 3314
236 Ga0157375_10454223 3300013308 Bacteria 1447
237 Ga0157375_10673246 3300013308 Unclassified 1190
238 Ga0163163_10004809 3300014325 Bacteria 11600
239 Ga0163163_11799729 3300014325 Bacteria 673
240 Ga0157380_10013641 3300014326 Bacteria 5931
241 Ga0157380_10054350 3300014326 Bacteria 3177
242 Ga0157380_10446538 3300014326 Unclassified 1241
243 Ga0157380_12356144 3300014326 Bacteria 597
244 Ga0157380_12446919 3300014326 Bacteria 588
245 Ga0157377_10099313 3300014745 Bacteria 1731
246 Ga0157377_10235247 3300014745 Bacteria 1180
247 Ga0157377_10616022 3300014745 Unclassified 776
248 Ga0157379_10127568 3300014968 Bacteria 2289
249 Ga0157376_10322208 3300014969 Bacteria 1470
250 Ga0157376_10350305 3300014969 Unclassified 1413
251 Ga0163161_10504833 3300017792 Bacteria 985
252 Ga0207697_10144811 3300025315 Bacteria 1032
253 Ga0207653_10026642 3300025885 Bacteria 1854
254 Ga0207682_10087767 3300025893 Bacteria 1344
255 Ga0207688_10201427 3300025901 Bacteria 1193
256 Ga0207680_10064865 3300025903 Bacteria 2241
257 Ga0207647_10238620 3300025904 Unclassified 1044
258 Ga0207645_10019933 3300025907 Bacteria 4390
259 Ga0207645_10089941 3300025907 Bacteria 1974
260 Ga0207643_10003278 3300025908 Bacteria 8743
261 Ga0207643_10036026 3300025908 Bacteria 2775
262 Ga0207643_10098242 3300025908 Bacteria 1714
263 Ga0207643_10375639 3300025908 Bacteria 895
264 Ga0207705_10127393 3300025909 Bacteria 1893
265 Ga0207705_10138007 3300025909 Bacteria 1819
266 Ga0207684_10464230 3300025910 Unclassified 1087
267 Ga0207684_10502441 3300025910 Bacteria 1039
268 Ga0207707_10236374 3300025912 Bacteria 1589
269 Ga0207707_11104023 3300025912 Bacteria 646
270 Ga0207693_10392900 3300025915 Bacteria 1085
271 Ga0207662_10063384 3300025918 Bacteria 2223
272 Ga0207662_10101852 3300025918 Bacteria 1780
273 Ga0207662_10593752 3300025918 Bacteria 770
274 Ga0207649_11071655 3300025920 Unclassified 635
275 Ga0207652_10412862 3300025921 Bacteria 1218
276 Ga0207646_10047186 3300025922 Bacteria 3864
277 Ga0207681_10020188 3300025923 Bacteria 4219
278 Ga0207650_10030243 3300025925 Bacteria 3899
279 Ga0207650_10034112 3300025925 Bacteria 3689
280 Ga0207650_10127412 3300025925 Bacteria 1989
281 Ga0207650_10201772 3300025925 Bacteria 1593
282 Ga0207650_10831155 3300025925 Bacteria 783
283 Ga0207650_10904538 3300025925 Bacteria 749
284 Ga0207659_10006571 3300025926 Bacteria 7136
285 Ga0207659_10010468 3300025926 Bacteria 5830
286 Ga0207659_10020831 3300025926 Bacteria 4341
287 Ga0207659_10021220 3300025926 Bacteria 4307
288 Ga0207659_10807386 3300025926 Bacteria 806
289 Ga0207700_10028014 3300025928 Bacteria 3953
290 Ga0207644_10274521 3300025931 Bacteria 1352
291 Ga0207690_10078573 3300025932 Bacteria 2297
292 Ga0207706_10104750 3300025933 Bacteria 2489
293 Ga0207706_10356031 3300025933 Bacteria 1272
294 Ga0207706_10694308 3300025933 Bacteria 870
295 Ga0207706_10927546 3300025933 Bacteria 734
296 Ga0207686_10408694 3300025934 Bacteria 1036
297 Ga0207686_11159509 3300025934 Bacteria 632
298 Ga0207709_10335314 3300025935 Bacteria 1136
299 Ga0207670_10007691 3300025936 Bacteria 6037
300 Ga0207670_10016295 3300025936 Bacteria 4463
301 Ga0207670_10048200 3300025936 Bacteria 2841
302 Ga0207670_10123188 3300025936 Bacteria 1888
303 Ga0207669_11621143 3300025937 Unclassified 552
304 Ga0207704_10282951 3300025938 Bacteria 1261
305 Ga0207665_10283625 3300025939 Bacteria 1233
306 Ga0207691_10018438 3300025940 Bacteria 6615
307 Ga0207691_10031031 3300025940 Bacteria 4991
308 Ga0207691_10064539 3300025940 Bacteria 3317
309 Ga0207691_10109002 3300025940 Bacteria 2464
310 Ga0207691_10147076 3300025940 Bacteria 2073
311 Ga0207689_10061675 3300025942 Bacteria 3084
312 Ga0207689_10172773 3300025942 Bacteria 1782
313 Ga0207689_10452237 3300025942 Bacteria 1074
314 Ga0207661_10047193 3300025944 Bacteria 3418
315 Ga0207661_10357530 3300025944 Bacteria 1319
316 Ga0207679_10033398 3300025945 Bacteria 3620
317 Ga0207679_10049128 3300025945 Bacteria 3076
318 Ga0207679_11051903 3300025945 Bacteria 746
319 Ga0207651_10038501 3300025960 Bacteria 3144
320 Ga0207651_10064800 3300025960 Bacteria 2559
321 Ga0207651_10143195 3300025960 Bacteria 1849
322 Ga0207651_10464498 3300025960 Unclassified 1088
323 Ga0207651_11030064 3300025960 Bacteria 736
324 Ga0207651_11096410 3300025960 Bacteria 713
325 Ga0207651_11121970 3300025960 Bacteria 705
326 Ga0207651_11406411 3300025960 Bacteria 628
327 Ga0207668_10227958 3300025972 Bacteria 1500
328 Ga0207668_10787640 3300025972 Bacteria 841
329 Ga0207658_10557222 3300025986 Bacteria 1026
330 Ga0207677_11112377 3300026023 Bacteria 720
331 Ga0207677_11881241 3300026023 Bacteria 556
332 Ga0207703_10067018 3300026035 Bacteria 2954
333 Ga0207703_11202253 3300026035 Bacteria 729
334 Ga0207703_11516312 3300026035 Bacteria 645
335 Ga0207639_10300088 3300026041 Bacteria 1420
336 Ga0207678_11525672 3300026067 Bacteria 589
337 Ga0207708_10061262 3300026075 Unclassified 2873
338 Ga0207708_10153277 3300026075 Bacteria 1816
339 Ga0207708_10677035 3300026075 Bacteria 880
340 Ga0207708_10783327 3300026075 Bacteria 820
341 Ga0207641_10054823 3300026088 Bacteria 3385
342 Ga0207641_10606756 3300026088 Bacteria 1072
343 Ga0207641_10615009 3300026088 Bacteria 1065
344 Ga0207641_10762917 3300026088 Bacteria 955
345 Ga0207648_10216234 3300026089 Bacteria 1702
346 Ga0207648_10294968 3300026089 Bacteria 1453
347 Ga0207648_10356634 3300026089 Bacteria 1319
348 Ga0207676_10018062 3300026095 Bacteria 5121
349 Ga0207676_10119920 3300026095 Unclassified 2216
350 Ga0207676_10221469 3300026095 Bacteria 1685
351 Ga0207676_10305114 3300026095 Bacteria 1455
352 Ga0207674_10042204 3300026116 Bacteria 4713
353 Ga0207674_10052516 3300026116 Bacteria 4157
354 Ga0207675_100063713 3300026118 Bacteria 3445
355 Ga0207675_100078258 3300026118 Bacteria 3098
356 Ga0207675_100272830 3300026118 Bacteria 1642
357 Ga0207675_100556398 3300026118 Bacteria 1147
358 Ga0207683_10274553 3300026121 Bacteria 1540
359 Ga0207683_10930906 3300026121 Bacteria 807
360 Ga0207683_11680025 3300026121 Bacteria 584
361 Ga0209983_1077797 3300027665 Bacteria 742
362 Ga0209998_10012527 3300027717 Bacteria 1761
363 Ga0209813_10147960 3300027866 Bacteria 839
364 Ga0209974_10007824 3300027876 Bacteria 3673
365 Ga0209974_10355289 3300027876 Bacteria 569
366 Ga0207428_10000970 3300027907 Bacteria 31814
367 Ga0207428_10004243 3300027907 Bacteria 13717
368 Ga0207428_10005844 3300027907 Bacteria 11414
369 Ga0207428_10018072 3300027907 Bacteria 6034
370 Ga0207428_10431722 3300027907 Bacteria 962
371 Ga0268266_11092663 3300028379 Unclassified 772
372 Ga0268265_10002967 3300028380 Bacteria 12417
373 Ga0268265_10194770 3300028380 Bacteria 1753
374 Ga0268265_10489100 3300028380 Unclassified 1157
375 Ga0268265_10640286 3300028380 Unclassified 1021
376 Ga0268264_10063353 3300028381 Bacteria 3107
377 Ga0268264_10325602 3300028381 Bacteria 1455
378 Ga0268264_10513636 3300028381 Bacteria 1170
379 Ga0316182_1188169 3300030745 Bacteria 852
380 Ga0307408_100077436 3300031548 Bacteria 2476
381 Ga0307405_10000373 3300031731 Bacteria 16766
382 Ga0307405_10036467 3300031731 Bacteria 2947
383 Ga0307413_10018636 3300031824 Bacteria 3647
384 Ga0307413_11338689 3300031824 Bacteria 628
385 Ga0307410_10709432 3300031852 Bacteria 849
386 Ga0307406_10019698 3300031901 Bacteria 3963
387 Ga0307412_10003351 3300031911 Bacteria 8902
388 Ga0307412_10064737 3300031911 Bacteria 2471
389 Ga0307409_100022297 3300031995 Bacteria 4363
390 Ga0307409_100373268 3300031995 Bacteria 1353
391 Ga0307409_100717951 3300031995 Bacteria 1000
392 Ga0307409_101507434 3300031995 Bacteria 700
393 Ga0307416_100008917 3300032002 Bacteria 6518
394 Ga0307416_100036088 3300032002 Bacteria 3786
395 Ga0307416_100186426 3300032002 Bacteria 1951
396 Ga0307414_10046133 3300032004 Bacteria 2989
397 Ga0307414_10617504 3300032004 Bacteria 974
398 Ga0307414_11379794 3300032004 Bacteria 655
399 Ga0307411_10042729 3300032005 Bacteria 2895
400 Ga0307411_10062965 3300032005 Bacteria 2477
401 Ga0307411_11367427 3300032005 Bacteria 647
402 Ga0307415_100016755 3300032126 Bacteria 4377
403 Ga0373938_0199040 3300034957 Bacteria 554
404 Ga0373952_0021199 3300035092 Unclassified 1370
405 Ga0373962_0046308 3300035242 Unclassified 1241
406 Ga0373927_0596961 3300035695 Bacteria 730
407 Ga0373933_0135016 3300035724 Bacteria 1554
408 Ga0373937_0058295 3300036401 Bacteria 3547
409 Ga0439439_0196164 3300041406 Bacteria 586
410 Ga0451853_0851951 3300041512 Unclassified 852
411 Ga0439431_0136932 3300041997 Unclassified 690
412 Ga0439448_0190253 3300042005 Bacteria 718
413 Ga0439455_0248120 3300042012 Bacteria 521
414 Ga0439462_0065629 3300042015 Unclassified 984
415 Ga0439434_0017687 3300042435 Bacteria 2134
416 Ga0439444_0067491 3300042437 Bacteria 759
417 Ga0450916_005003 3300042530 Bacteria 1517
418 Ga0450918_052362 3300042531 Bacteria 745
419 Ga0453683_0310103 3300044673 Bacteria 1010
420 Ga0453684_0593538 3300044712 Bacteria 1215
421 Ga0451576_0009112 3300045051 Bacteria 11545
422 Ga0451576_0038599 3300045051 Bacteria 5054
423 Ga0495603_0066439 3300046455 Bacteria 2124
424 Ga0495629_0004349 3300046459 Bacteria 10622
425 Ga0495580_0154097 3300046472 Bacteria 1592
426 Ga0495584_0012753 3300046491 Bacteria 4289
427 Ga0495584_0271487 3300046491 Bacteria 862
428 Ga0495594_0019284 3300046499 Bacteria 3623
429 Ga0495594_0166170 3300046499 Bacteria 1255
430 Ga0495644_0008131 3300046523 Bacteria 4036
431 Ga0495663_0055697 3300046525 Bacteria 1234
432 Ga0495642_0011927 3300046528 Bacteria 3347
433 Ga0495642_0034413 3300046528 Bacteria 2040
434 Ga0495598_0005542 3300046537 Bacteria 2806
435 Ga0495598_0013953 3300046537 Bacteria 2002
436 Ga0495609_0043815 3300046538 Bacteria 2008
437 Ga0495621_0001105 3300046539 Bacteria 6941
438 Ga0495621_0029680 3300046539 Bacteria 1865
439 Ga0495621_0040314 3300046539 Bacteria 1636
440 Ga0495656_0065097 3300046615 Bacteria 1602
441 Ga0495659_0029444 3300046664 Bacteria 1906
442 Ga0495659_0460653 3300046664 Bacteria 554
443 Ga0495669_0105683 3300046684 Bacteria 1311
444 Ga0495669_0108311 3300046684 Bacteria 1295
445 Ga0495669_0120747 3300046684 Bacteria 1228
446 Ga0495624_0638221 3300046690 Bacteria 634
447 Ga0495670_0014004 3300046691 Bacteria 3946
448 Ga0495670_0127216 3300046691 Bacteria 1327
449 Ga0495636_0027171 3300047318 Bacteria 2331
450 Ga0495636_0115077 3300047318 Unclassified 1186
451 Ga0495676_0043167 3300047321 Bacteria 3694
452 Ga0495602_1068053 3300048088 Bacteria 530
453 Ga0495614_0350450 3300048089 Bacteria 688
454 Ga0496100_1130347 3300048903 Bacteria 617
455 Ga0496102_0104927 3300048905 Unclassified 2629
456 Ga0496104_0639461 3300048907 Bacteria 973
457 Ga0496106_0537511 3300048909 Unclassified 938
458 Ga0496106_1191522 3300048909 Unclassified 594
459 Ga0496109_0087533 3300048912 Bacteria 2877
460 Ga0496109_1326783 3300048912 Bacteria 655
461 Ga0496110_0079211 3300048913 Bacteria 2925
462 Ga0496111_0095355 3300048914 Unclassified 2183
463 Ga0496111_1066441 3300048914 Bacteria 577
464 Ga0496112_0010625 3300048915 Bacteria 8362
465 Ga0496113_0123282 3300048916 Bacteria 2028
466 Ga0501036_0045506 3300049572 Bacteria 3718
467 Ga0501037_0092993 3300049573 Bacteria 2181
468 Ga0501038_0183575 3300049574 Unclassified 1687
469 Ga0501039_1251787 3300049575 Bacteria 573
470 Ga0501040_0141768 3300049576 Unclassified 1693
471 Ga0501041_0014173 3300049577 Unclassified 4732
472 Ga0501041_0686454 3300049577 Bacteria 655
473 Ga0501042_0107108 3300049578 Bacteria 2012
474 Ga0501042_0396245 3300049578 Unclassified 1000
475 Ga0501042_0773446 3300049578 Bacteria 699
476 Ga0501046_0052926 3300049580 Unclassified 3199
477 Ga0501048_0247779 3300049582 Bacteria 1264
478 Ga0501068_0106104 3300049584 Bacteria 1744
479 Ga0501069_0048174 3300049585 Unclassified 2366
480 Ga0501071_0074758 3300049587 Unclassified 2473
481 Ga0501072_0007972 3300049588 Bacteria 8038
482 Ga0501074_0094021 3300049590 Bacteria 2147
483 Ga0501075_0016681 3300049591 Bacteria 5297
484 Ga0501075_1552434 3300049591 Unclassified 501
485 Ga0501076_0004732 3300049592 Bacteria 9712
486 Ga0501228_039952 3300049666 Bacteria 607
487 Ga0501236_082539 3300049670 Bacteria 605
488 Ga0501249_076854 3300049679 Bacteria 783
489 Ga0501079_0051236 3300049741 Bacteria 3187
490 Ga0501079_0128942 3300049741 Unclassified 1968
491 Ga0501080_0144860 3300049742 Bacteria 2196
492 Ga0501081_0116949 3300049743 Bacteria 1896
493 Ga0501083_0735409 3300049744 Bacteria 642
494 Ga0501035_0317733 3300049822 Bacteria 1309
495 nmdc:mga04h51_167710_c1 3300050495 Bacteria 848
496 nmdc:mga05p37_137679_c1 3300050507 Bacteria 2993
497 nmdc:mga05p37_23950_c1 3300050507 Bacteria 7413
498 nmdc:mga05p37_2648_c1 3300050507 Bacteria 20851
499 nmdc:mga05p37_267290_c1 3300050507 Bacteria 2045
500 nmdc:mga05p37_28327_c1 3300050507 Bacteria 6830
501 nmdc:mga05p37_5387_c1 3300050507 Bacteria 15041
502 nmdc:mga09592_102341_c1 3300050508 Bacteria 2454
503 nmdc:mga09592_276272_c1 3300050508 Bacteria 1457
504 nmdc:mga09592_333303_c1 3300050508 Unclassified 1314
505 nmdc:mga09592_437253_c1 3300050508 Bacteria 1129
506 nmdc:mga09592_78712_c1 3300050508 Unclassified 2806
507 nmdc:mga09592_84613_c1 3300050508 Bacteria 2705
508 nmdc:mga0qj67_284855_c1 3300050509 Bacteria 1339
509 nmdc:mga0qj67_41603_c1 3300050509 Bacteria 3615
510 nmdc:mga06r32_298412_c1 3300050510 Bacteria 1597
511 nmdc:mga06r32_50389_c1 3300050510 Bacteria 3983
512 nmdc:mga08y16_1646_c1 3300050511 Bacteria 22621
513 nmdc:mga08y16_222622_c1 3300050511 Bacteria 1953
514 nmdc:mga08y16_226320_c1 3300050511 Bacteria 1935
515 nmdc:mga08y16_353_c1 3300050511 Bacteria 41478
516 nmdc:mga08y16_58854_c1 3300050511 Bacteria 4015
517 nmdc:mga0n895_4653_c1 3300050512 Bacteria 11318
518 nmdc:mga0n895_587899_c1 3300050512 Bacteria 1117
519 nmdc:mga0n895_73565_c1 3300050512 Bacteria 3393
520 nmdc:mga0rr50_1008678_c1 3300050513 Bacteria 709
521 nmdc:mga0rr50_1023939_c1 3300050513 Bacteria 703
522 nmdc:mga0rr50_160932_c1 3300050513 Bacteria 1822
523 nmdc:mga0rr50_271294_c1 3300050513 Bacteria 1414
524 nmdc:mga0rr50_32310_c1 3300050513 Bacteria 3728
525 nmdc:mga0rr50_69831_c1 3300050513 Bacteria 2675
526 nmdc:mga08x19_158670_c1 3300050514 Bacteria 1535
527 nmdc:mga0a205_129920_c1 3300050515 Bacteria 2420
528 nmdc:mga0a205_14986_c2 3300050515 Bacteria 6241
529 nmdc:mga0a205_223003_c1 3300050515 Bacteria 1770
530 nmdc:mga0a205_33822_c1 3300050515 Bacteria 4902
531 nmdc:mga0a205_508599_c1 3300050515 Bacteria 1061
532 nmdc:mga0a205_89834_c1 3300050515 Bacteria 2969
533 nmdc:mga0a205_9698_c1 3300050515 Bacteria 8816
534 Ga0501084_0054793 3300054114 Unclassified 3336
535 Ga0590071_002897 3300059421 Bacteria 4282
536 Ga0590075_001952 3300059424 Bacteria 4989
537 Ga0590075_022889 3300059424 Unclassified 1565
538 Ga0590077_000272 3300059426 Bacteria 14641
539 Ga0590077_003865 3300059426 Bacteria 3089
540 Ga0501082_0033979 3300060353 Bacteria 4399
541 Ga0501082_0125533 3300060353 Bacteria 2226
542 Ga0501082_0283163 3300060353 Bacteria 1443
543 Ga0530510_1413026 3300061734 Unclassified 534
544 Ga0207668_10927294
545 MBSR1b_contig_5371541
546 Ga0065712_10000466
547 Ga0065715_10161962
548 Ga0065707_10097847
549 Ga0065707_10646277
550 Ga0070658_10074658
551 Ga0070658_10195846
552 Ga0070676_10081067
553 Ga0070683_100404814
554 Ga0070683_100506126
555 Ga0070690_100014623
556 Ga0070690_100334778
557 Ga0070670_100001433
558 Ga0070670_100016980
559 Ga0070670_100306230
560 Ga0070670_100487992
561 Ga0070670_101261485
562 Ga0070677_10232634
563 Ga0068869_100196514
564 Ga0068869_100518076
565 Ga0068869_100761850
566 Ga0070666_10129183
567 Ga0070680_100656319
568 Ga0068868_100587887
569 Ga0070689_100016372
570 Ga0070689_100039417
571 Ga0070689_100162669
572 Ga0070691_10006286
573 Ga0070691_10179083
574 Ga0070687_100090725
575 Ga0070687_100092777
576 Ga0070687_100099560
577 Ga0070692_10003674
578 Ga0070692_10295068
579 Ga0070692_10583530
580 Ga0070668_100058789
581 Ga0070668_100196634
582 Ga0070668_100554908
583 Ga0070669_100662850
584 Ga0070675_100003805
585 Ga0070675_100012401
586 Ga0070675_100018523
587 Ga0070675_100034668
588 Ga0070675_100131036
589 Ga0070675_100131108
590 Ga0070675_100207806
591 Ga0070675_100783656
592 Ga0070671_100213942
593 Ga0070671_100309720
594 Ga0070674_100225208
595 Ga0070674_100257983
596 Ga0070673_100001953
597 Ga0070673_100016161
598 Ga0070673_100118003
599 Ga0070673_100130893
600 Ga0070673_100157779
601 Ga0070673_100299246
602 Ga0070673_100407653
603 Ga0070688_100030604
604 Ga0070688_100054196
605 Ga0070688_100455676
606 Ga0070659_100091522
607 Ga0070659_101034809
608 Ga0070667_100399437
609 Ga0070703_10253322
610 Ga0070701_10069953
611 Ga0070701_10119168
612 Ga0070701_10166068
613 Ga0070705_100000578
614 Ga0070705_100004206
615 Ga0070705_100141423
616 Ga0070705_100341183
617 Ga0070705_100398360
618 Ga0070700_100056487
619 Ga0070700_100089675
620 Ga0070700_100398904
621 Ga0070694_100001421
622 Ga0070694_100010403
623 Ga0070694_100258499
624 Ga0070708_100569973
625 Ga0070708_100949609
626 Ga0070663_100840033
627 Ga0070678_100343235
628 Ga0070678_101516346
629 Ga0070662_100030681
630 Ga0070662_100056083
631 Ga0070662_100162039
632 Ga0070662_100424557
633 Ga0070662_100643587
634 Ga0070662_100852571
635 Ga0070681_10003182
636 Ga0070681_10365995
637 Ga0068867_100103488
638 Ga0068867_100219175
639 Ga0070685_10012979
640 Ga0070685_10259671
641 Ga0070706_100237484
642 Ga0070707_100131296
643 Ga0070707_100132641
644 Ga0070698_100013325
645 Ga0070698_100146246
646 Ga0070698_100543582
647 Ga0070699_100005922
648 Ga0070699_100068210
649 Ga0070684_100764562
650 Ga0070697_100075390
651 Ga0070672_100023943
652 Ga0070672_100032760
653 Ga0070672_100148950
654 Ga0070672_100178020
655 Ga0070672_100449687
656 Ga0070686_100173284
657 Ga0070686_100424097
658 Ga0070695_100000155
659 Ga0070695_100052454
660 Ga0070695_100681871
661 Ga0070696_100000499
662 Ga0070696_100007757
663 Ga0070696_100147883
664 Ga0070704_100012839
665 Ga0070704_100113225
666 Ga0070704_100174595
667 Ga0070704_100349634
668 Ga0070704_100963074
669 Ga0070664_100020216
670 Ga0070664_100046355
671 Ga0070664_100077453
672 Ga0070664_100900136
673 Ga0070664_101131469
674 Ga0068857_100035631
675 Ga0068857_100109373
676 Ga0068857_100529735
677 Ga0068857_101045835
678 Ga0070702_100396639
679 Ga0070702_100508677
680 Ga0068859_100018733
681 Ga0068859_100031420
682 Ga0068859_100070530
683 Ga0068859_100156732
684 Ga0068864_100051843
685 Ga0068864_100114399
686 Ga0068864_100164517
687 Ga0068861_100057477
688 Ga0068861_100282983
689 Ga0068861_100373277
690 Ga0068870_10002177
691 Ga0068870_10269486
692 Ga0068870_10573272
693 Ga0068863_100664345
694 Ga0068863_100973142
695 Ga0068858_100062859
696 Ga0068858_101429152
697 Ga0068858_101465469
698 Ga0068860_100024574
699 Ga0068860_100135461
700 Ga0068862_100202330
701 Ga0068862_100314411
702 Ga0068862_100626565
703 Ga0081455_10031016
704 Ga0081539_10001136
705 Ga0081539_10151084
706 Ga0075368_10042932
707 Ga0075367_10010855
708 Ga0097621_100202351
709 Ga0068871_100516591
710 Ga0075428_100006198
711 Ga0075428_100023443
712 Ga0075428_100251020
713 Ga0075428_100316062
714 Ga0075428_100392094
715 Ga0075428_100413557
716 Ga0075428_100777630
717 Ga0075430_100000632
718 Ga0075430_100030606
719 Ga0075430_100060099
720 Ga0075430_100129478
721 Ga0075430_100940864
722 Ga0075431_100002264
723 Ga0075431_100395639
724 Ga0075433_10112836
725 Ga0075433_10113555
726 Ga0075433_10124458
727 Ga0075434_100000553
728 Ga0075434_100011984
729 Ga0075434_100784173
730 Ga0075429_100014017
731 Ga0075429_100029637
732 Ga0075429_100032335
733 Ga0075429_100056671
734 Ga0075429_100266695
735 Ga0075429_100690853
736 Ga0075429_101194127
737 Ga0068865_100540580
738 Ga0068865_100665866
739 Ga0068865_100739361
740 Ga0068865_100911680
741 Ga0097620_100018729
742 Ga0097620_100031420
743 Ga0097620_100070533
744 Ga0097620_100156720
745 Ga0075435_100032196
746 Ga0075435_100039090
747 Ga0075435_100100724
748 Ga0075435_100250187
749 Ga0105251_10498449
750 Ga0111539_10002555
751 Ga0111539_10002949
752 Ga0111539_10009751
753 Ga0111539_10248133
754 Ga0111539_10590979
755 Ga0111539_12127008
756 Ga0105245_11744273
757 Ga0114129_10002512
758 Ga0114129_10063014
759 Ga0114129_10075079
760 Ga0114129_10082780
761 Ga0114129_10160142
762 Ga0105243_10009286
763 Ga0105243_10167754
764 Ga0105243_10207878
765 Ga0105242_11794791
766 Ga0105248_10555570
767 Ga0105248_10749947
768 Ga0105249_10043392
769 Ga0105249_10124594
770 Ga0105246_10548381
771 Ga0157371_10554022
772 Ga0157378_10091325
773 Ga0157378_10280219
774 Ga0163162_10279601
775 Ga0163162_12752698
776 Ga0157375_10027211
777 Ga0157375_10075066
778 Ga0157375_10079538
779 Ga0157375_10454223
780 Ga0157375_10673246
781 Ga0163163_10004809
782 Ga0163163_11799729
783 Ga0157380_10013641
784 Ga0157380_10054350
785 Ga0157380_10446538
786 Ga0157380_12356144
787 Ga0157380_12446919
788 Ga0157377_10099313
789 Ga0157377_10235247
790 Ga0157377_10616022
791 Ga0157379_10127568
792 Ga0157376_10322208
793 Ga0157376_10350305
794 Ga0163161_10504833
795 Ga0207697_10144811
796 Ga0207653_10026642
797 Ga0207682_10087767
798 Ga0207688_10201427
799 Ga0207680_10064865
800 Ga0207647_10238620
801 Ga0207645_10019933
802 Ga0207645_10089941
803 Ga0207643_10003278
804 Ga0207643_10036026
805 Ga0207643_10098242
806 Ga0207643_10375639
807 Ga0207705_10127393
808 Ga0207705_10138007
809 Ga0207684_10464230
810 Ga0207684_10502441
811 Ga0207707_10236374
812 Ga0207707_11104023
813 Ga0207693_10392900
814 Ga0207662_10063384
815 Ga0207662_10101852
816 Ga0207662_10593752
817 Ga0207649_11071655
818 Ga0207652_10412862
819 Ga0207646_10047186
820 Ga0207681_10020188
821 Ga0207650_10030243
822 Ga0207650_10034112
823 Ga0207650_10127412
824 Ga0207650_10201772
825 Ga0207650_10831155
826 Ga0207650_10904538
827 Ga0207659_10006571
828 Ga0207659_10010468
829 Ga0207659_10020831
830 Ga0207659_10021220
831 Ga0207659_10807386
832 Ga0207700_10028014
833 Ga0207644_10274521
834 Ga0207690_10078573
835 Ga0207706_10104750
836 Ga0207706_10356031
837 Ga0207706_10694308
838 Ga0207706_10927546
839 Ga0207686_10408694
840 Ga0207686_11159509
841 Ga0207709_10335314
842 Ga0207670_10007691
843 Ga0207670_10016295
844 Ga0207670_10048200
845 Ga0207670_10123188
846 Ga0207669_11621143
847 Ga0207704_10282951
848 Ga0207665_10283625
849 Ga0207691_10018438
850 Ga0207691_10031031
851 Ga0207691_10064539
852 Ga0207691_10109002
853 Ga0207691_10147076
854 Ga0207689_10061675
855 Ga0207689_10172773
856 Ga0207689_10452237
857 Ga0207661_10047193
858 Ga0207661_10357530
859 Ga0207679_10033398
860 Ga0207679_10049128
861 Ga0207679_11051903
862 Ga0207651_10038501
863 Ga0207651_10064800
864 Ga0207651_10143195
865 Ga0207651_10464498
866 Ga0207651_11030064
867 Ga0207651_11096410
868 Ga0207651_11121970
869 Ga0207651_11406411
870 Ga0207668_10227958
871 Ga0207668_10787640
872 Ga0207658_10557222
873 Ga0207677_11112377
874 Ga0207677_11881241
875 Ga0207703_10067018
876 Ga0207703_11202253
877 Ga0207703_11516312
878 Ga0207639_10300088
879 Ga0207678_11525672
880 Ga0207708_10061262
881 Ga0207708_10153277
882 Ga0207708_10677035
883 Ga0207708_10783327
884 Ga0207641_10054823
885 Ga0207641_10606756
886 Ga0207641_10615009
887 Ga0207641_10762917
888 Ga0207648_10216234
889 Ga0207648_10294968
890 Ga0207648_10356634
891 Ga0207676_10018062
892 Ga0207676_10119920
893 Ga0207676_10221469
894 Ga0207676_10305114
895 Ga0207674_10042204
896 Ga0207674_10052516
897 Ga0207675_100063713
898 Ga0207675_100078258
899 Ga0207675_100272830
900 Ga0207675_100556398
901 Ga0207683_10274553
902 Ga0207683_10930906
903 Ga0207683_11680025
904 Ga0209983_1077797
905 Ga0209998_10012527
906 Ga0209813_10147960
907 Ga0209974_10007824
908 Ga0209974_10355289
909 Ga0207428_10000970
910 Ga0207428_10004243
911 Ga0207428_10005844
912 Ga0207428_10018072
913 Ga0207428_10431722
914 Ga0268266_11092663
915 Ga0268265_10002967
916 Ga0268265_10194770
917 Ga0268265_10489100
918 Ga0268265_10640286
919 Ga0268264_10063353
920 Ga0268264_10325602
921 Ga0268264_10513636
922 Ga0316182_1188169
923 Ga0307408_100077436
924 Ga0307405_10000373
925 Ga0307405_10036467
926 Ga0307413_10018636
927 Ga0307413_11338689
928 Ga0307410_10709432
929 Ga0307406_10019698
930 Ga0307412_10003351
931 Ga0307412_10064737
932 Ga0307409_100022297
933 Ga0307409_100373268
934 Ga0307409_100717951
935 Ga0307409_101507434
936 Ga0307416_100008917
937 Ga0307416_100036088
938 Ga0307416_100186426
939 Ga0307414_10046133
940 Ga0307414_10617504
941 Ga0307414_11379794
942 Ga0307411_10042729
943 Ga0307411_10062965
944 Ga0307411_11367427
945 Ga0307415_100016755
946 Ga0373938_0199040
947 Ga0373952_0021199
948 Ga0373962_0046308
949 Ga0373927_0596961
950 Ga0373933_0135016
951 Ga0373937_0058295
952 Ga0439439_0196164
953 Ga0451853_0851951
954 Ga0439431_0136932
955 Ga0439448_0190253
956 Ga0439455_0248120
957 Ga0439462_0065629
958 Ga0439434_0017687
959 Ga0439444_0067491
960 Ga0450916_005003
961 Ga0450918_052362
962 Ga0453683_0310103
963 Ga0453684_0593538
964 Ga0451576_0009112
965 Ga0451576_0038599
966 Ga0495603_0066439
967 Ga0495629_0004349
968 Ga0495580_0154097
969 Ga0495584_0012753
970 Ga0495584_0271487
971 Ga0495594_0019284
972 Ga0495594_0166170
973 Ga0495644_0008131
974 Ga0495663_0055697
975 Ga0495642_0011927
976 Ga0495642_0034413
977 Ga0495598_0005542
978 Ga0495598_0013953
979 Ga0495609_0043815
980 Ga0495621_0001105
981 Ga0495621_0029680
982 Ga0495621_0040314
983 Ga0495656_0065097
984 Ga0495659_0029444
985 Ga0495659_0460653
986 Ga0495669_0105683
987 Ga0495669_0108311
988 Ga0495669_0120747
989 Ga0495624_0638221
990 Ga0495670_0014004
991 Ga0495670_0127216
992 Ga0495636_0027171
993 Ga0495636_0115077
994 Ga0495676_0043167
995 Ga0495602_1068053
996 Ga0495614_0350450
997 Ga0496100_1130347
998 Ga0496102_0104927
999 Ga0496104_0639461
1000 Ga0496106_0537511
1001 Ga0496106_1191522
1002 Ga0496109_0087533
1003 Ga0496109_1326783
1004 Ga0496110_0079211
1005 Ga0496111_0095355
1006 Ga0496111_1066441
1007 Ga0496112_0010625
1008 Ga0496113_0123282
1009 Ga0501036_0045506
1010 Ga0501037_0092993
1011 Ga0501038_0183575
1012 Ga0501039_1251787
1013 Ga0501040_0141768
1014 Ga0501041_0014173
1015 Ga0501041_0686454
1016 Ga0501042_0107108
1017 Ga0501042_0396245
1018 Ga0501042_0773446
1019 Ga0501046_0052926
1020 Ga0501048_0247779
1021 Ga0501068_0106104
1022 Ga0501069_0048174
1023 Ga0501071_0074758
1024 Ga0501072_0007972
1025 Ga0501074_0094021
1026 Ga0501075_0016681
1027 Ga0501075_1552434
1028 Ga0501076_0004732
1029 Ga0501228_039952
1030 Ga0501236_082539
1031 Ga0501249_076854
1032 Ga0501079_0051236
1033 Ga0501079_0128942
1034 Ga0501080_0144860
1035 Ga0501081_0116949
1036 Ga0501083_0735409
1037 Ga0501035_0317733
1038 nmdc:mga04h51_167710_c1
1039 nmdc:mga05p37_137679_c1
1040 nmdc:mga05p37_23950_c1
1041 nmdc:mga05p37_2648_c1
1042 nmdc:mga05p37_267290_c1
1043 nmdc:mga05p37_28327_c1
1044 nmdc:mga05p37_5387_c1
1045 nmdc:mga09592_102341_c1
1046 nmdc:mga09592_276272_c1
1047 nmdc:mga09592_333303_c1
1048 nmdc:mga09592_437253_c1
1049 nmdc:mga09592_78712_c1
1050 nmdc:mga09592_84613_c1
1051 nmdc:mga0qj67_284855_c1
1052 nmdc:mga0qj67_41603_c1
1053 nmdc:mga06r32_298412_c1
1054 nmdc:mga06r32_50389_c1
1055 nmdc:mga08y16_1646_c1
1056 nmdc:mga08y16_222622_c1
1057 nmdc:mga08y16_226320_c1
1058 nmdc:mga08y16_353_c1
1059 nmdc:mga08y16_58854_c1
1060 nmdc:mga0n895_4653_c1
1061 nmdc:mga0n895_587899_c1
1062 nmdc:mga0n895_73565_c1
1063 nmdc:mga0rr50_1008678_c1
1064 nmdc:mga0rr50_1023939_c1
1065 nmdc:mga0rr50_160932_c1
1066 nmdc:mga0rr50_271294_c1
1067 nmdc:mga0rr50_32310_c1
1068 nmdc:mga0rr50_69831_c1
1069 nmdc:mga08x19_158670_c1
1070 nmdc:mga0a205_129920_c1
1071 nmdc:mga0a205_14986_c2
1072 nmdc:mga0a205_223003_c1
1073 nmdc:mga0a205_33822_c1
1074 nmdc:mga0a205_508599_c1
1075 nmdc:mga0a205_89834_c1
1076 nmdc:mga0a205_9698_c1
1077 Ga0501084_0054793
1078 Ga0590071_002897
1079 Ga0590075_001952
1080 Ga0590075_022889
1081 Ga0590077_000272
1082 Ga0590077_003865
1083 Ga0501082_0033979
1084 Ga0501082_0125533
1085 Ga0501082_0283163
1086 Ga0530510_1413026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

37

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1moj-assembly1.cif.gz_A crystal structure of an archaeal dps-homologue from halobacterium salinarum 0.98 47 89
3v1b-assembly1.cif.gz_B crystal structure of de novo designed mid1-apo2 0.8603 53 89
1jig-assembly1.cif.gz_A dlp-2 from bacillus anthracis 0.8537 48 89
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7964 1 148
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.7916 1 148
ID Description Score Start End Superfamily
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9849 3 90 1.10.1510.10
3v1bA00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9833 53 88 4.10.860.20
1mojA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.98 47 89 1.20.1260.10
af_Q86K90_1153_1377_1.10.3380.30 Mainly Alpha;Orthogonal Bundle;Sec63 N-terminal domain-like fold; 0.9697 44 86 1.10.3380.30
1ng6A01 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9638 1 90 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A382G0K5-F1-model_v4 GatB/YqeY domain-containing protein 0.9946 1 91 GO:0016884
AF-A0A3E0PA94-F1-model_v4 GatB/YqeY domain-containing protein 0.9876 1 148 GO:0016884
AF-A0A3E0PA94-F1-model_v4 GatB/YqeY domain-containing protein 0.981 1 148 GO:0016884
AF-A0A522Q1X1-F1-model_v4 GatB/YqeY domain-containing protein 0.9675 1 149 GO:0016884
AF-A0A2V8GMR9-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9671 1 148 GO:0016740
GO:0016884

Map