F461633

General Info

Members Datasets Scaffolds Average Seq Length
543 342 1086 212

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10452562|Ga0207707_104525621
Length 253
Sequence MVTDPGHLLDASFTISHQTVPIMSGDHHHQSNRPTLARAAKVPVIGIGGPVGSGKTALVEALCRQLRDQYSLAVVTNDIFTKEDAEFLTRRGALSGDRIVGVETGGCPHTAIREDASHNQEAVDAFIRRIEGIELIFVESGGDNLAATFSPELADHVIYVIDVAAGDKIPRKGGPGITRSDLLVINKIDLAPHVGADLSVMERDSKRMRGKGPFVFTNLLTGIGLADVVEWVQQFLPSRPQGAKVAYDRIRGA

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
178 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
181 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
182 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
188 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
189 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
190 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
192 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
218 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
303 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
304 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
307 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
308 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
311 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
317 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
318 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
319 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
320 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
321 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
322 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
323 2643221651 Afipia sp. Root123D2 Isolate Unclassified
324 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
325 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
326 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
327 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
328 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
329 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
330 2904699407
331 2906610324
332 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
333 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
334 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
335 2922425934
336 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
337 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
338 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
339 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
340 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
341 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
342 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 0.74
Isolates 4.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 2.95
Rhizoplane 7
Rhizosphere 76.61
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10452562 3300025912 Bacteria 1098
2 LJQas_1006597 3300000549 Bacteria 1442
3 JGI25406J46586_10006332 3300003203 Bacteria 5460
4 JGI25153J46596_10000082 3300003215 Bacteria 112797
5 Ga0070683_100021042 3300005329 Bacteria 5817
6 Ga0070683_100033745 3300005329 Bacteria 4669
7 Ga0070690_100002273 3300005330 Bacteria 10293
8 Ga0070670_100074998 3300005331 Bacteria 2907
9 Ga0070670_100116256 3300005331 Bacteria 2306
10 Ga0070666_10026927 3300005335 Bacteria 3761
11 Ga0070680_100010866 3300005336 Bacteria 7034
12 Ga0070680_100127606 3300005336 Bacteria 2126
13 Ga0068868_100017094 3300005338 Bacteria 5397
14 Ga0070660_100080643 3300005339 Bacteria 2554
15 Ga0070660_100143138 3300005339 Bacteria 1919
16 Ga0070660_100215921 3300005339 Bacteria 1558
17 Ga0070660_100562694 3300005339 Bacteria 951
18 Ga0070689_100075254 3300005340 Bacteria 2643
19 Ga0070689_100304938 3300005340 Bacteria 1326
20 Ga0070691_10005180 3300005341 Bacteria 5925
21 Ga0070661_100012217 3300005344 Bacteria 6004
22 Ga0070675_100521210 3300005354 Bacteria 1072
23 Ga0070671_100019470 3300005355 Bacteria 5524
24 Ga0070671_100029240 3300005355 Bacteria 4543
25 Ga0070673_100251094 3300005364 Bacteria 1542
26 Ga0070688_100046591 3300005365 Bacteria 2685
27 Ga0070667_100030370 3300005367 Bacteria 4507
28 Ga0070667_100032882 3300005367 Bacteria 4329
29 Ga0070709_10001499 3300005434 Bacteria 12626
30 Ga0070709_10226365 3300005434 Bacteria 1336
31 Ga0070714_100014065 3300005435 Bacteria 6421
32 Ga0070714_100029341 3300005435 Bacteria 4573
33 Ga0070714_100109285 3300005435 Bacteria 2446
34 Ga0070713_100000667 3300005436 Bacteria 21946
35 Ga0070713_100004640 3300005436 Bacteria 9268
36 Ga0070713_100041948 3300005436 Bacteria 3731
37 Ga0070713_100072661 3300005436 Bacteria 2910
38 Ga0070713_100864315 3300005436 Bacteria 869
39 Ga0070710_10000248 3300005437 Bacteria 25378
40 Ga0070710_10005159 3300005437 Bacteria 6183
41 Ga0070710_10047059 3300005437 Bacteria 2405
42 Ga0070701_10055100 3300005438 Bacteria 2075
43 Ga0070711_100016896 3300005439 Bacteria 4639
44 Ga0070711_100032928 3300005439 Bacteria 3449
45 Ga0070711_100594051 3300005439 Bacteria 923
46 Ga0070700_100186141 3300005441 Bacteria 1448
47 Ga0070708_100158074 3300005445 Bacteria 2111
48 Ga0070708_100428004 3300005445 Bacteria 1248
49 Ga0070708_100513050 3300005445 Bacteria 1131
50 Ga0070663_100134172 3300005455 Bacteria 1883
51 Ga0070678_100198248 3300005456 Bacteria 1655
52 Ga0070662_100488459 3300005457 Bacteria 1026
53 Ga0068867_100571538 3300005459 Bacteria 982
54 Ga0070685_10015589 3300005466 Bacteria 4039
55 Ga0070706_100075061 3300005467 Bacteria 3129
56 Ga0070707_100031016 3300005468 Bacteria 5090
57 Ga0070707_100201719 3300005468 Bacteria 1939
58 Ga0070707_100224974 3300005468 Bacteria 1827
59 Ga0070698_100023650 3300005471 Bacteria 6419
60 Ga0070698_100229492 3300005471 Bacteria 1789
61 Ga0070699_100009781 3300005518 Bacteria 8297
62 Ga0070699_100042020 3300005518 Bacteria 3955
63 Ga0070679_100125183 3300005530 Bacteria 2553
64 Ga0070679_100270506 3300005530 Bacteria 1653
65 Ga0070684_100006227 3300005535 Bacteria 9209
66 Ga0070697_100358477 3300005536 Bacteria 1260
67 Ga0070697_100434691 3300005536 Bacteria 1142
68 Ga0070672_100152395 3300005543 Bacteria 1913
69 Ga0070686_100011985 3300005544 Bacteria 4929
70 Ga0070696_100027869 3300005546 Bacteria 3852
71 Ga0070696_100112405 3300005546 Bacteria 1963
72 Ga0070665_100016617 3300005548 Bacteria 7374
73 Ga0070665_100190754 3300005548 Bacteria 2050
74 Ga0070704_100027783 3300005549 Bacteria 3757
75 Ga0070704_101304402 3300005549 Bacteria 664
76 Ga0068855_100714150 3300005563 Bacteria 1071
77 Ga0068857_100224574 3300005577 Bacteria 1716
78 Ga0068856_100024482 3300005614 Bacteria 5878
79 Ga0070702_100185541 3300005615 Bacteria 1365
80 Ga0068852_100049076 3300005616 Bacteria 3609
81 Ga0068852_100432992 3300005616 Bacteria 1299
82 Ga0068859_100026100 3300005617 Bacteria 5861
83 Ga0068859_101321704 3300005617 Bacteria 795
84 Ga0068864_100011024 3300005618 Bacteria 7472
85 Ga0068866_10056000 3300005718 Bacteria 2027
86 Ga0068866_10110817 3300005718 Bacteria 1531
87 Ga0068870_10133002 3300005840 Bacteria 1447
88 Ga0068863_100714438 3300005841 Bacteria 996
89 Ga0068863_101590275 3300005841 Bacteria 663
90 Ga0068860_100572988 3300005843 Bacteria 1132
91 Ga0068862_100005038 3300005844 Bacteria 11117
92 Ga0068862_100758360 3300005844 Bacteria 945
93 Ga0081455_10003539 3300005937 Bacteria 17922
94 Ga0081540_1009546 3300005983 Bacteria 6676
95 Ga0081539_10002647 3300005985 Bacteria 24446
96 Ga0081539_10043801 3300005985 Bacteria 2590
97 Ga0081539_10095599 3300005985 Bacteria 1526
98 Ga0070717_10002358 3300006028 Bacteria 13305
99 Ga0070717_10005997 3300006028 Bacteria 8902
100 Ga0070717_10008523 3300006028 Bacteria 7657
101 Ga0075365_10020146 3300006038 Bacteria 4130
102 Ga0075368_10284463 3300006042 Bacteria 711
103 Ga0075363_100063046 3300006048 Bacteria 2000
104 Ga0075363_100099732 3300006048 Bacteria 1606
105 Ga0070715_10002924 3300006163 Bacteria 5335
106 Ga0070715_10018426 3300006163 Bacteria 2660
107 Ga0070716_100000809 3300006173 Bacteria 13464
108 Ga0070716_100006665 3300006173 Bacteria 5651
109 Ga0070712_100015589 3300006175 Bacteria 4900
110 Ga0075362_10010322 3300006177 Bacteria 3643
111 Ga0075367_10014825 3300006178 Bacteria 4223
112 Ga0075369_10045045 3300006186 Bacteria 1896
113 Ga0075366_10005599 3300006195 Bacteria 6814
114 Ga0075366_10071607 3300006195 Bacteria 2065
115 Ga0075366_10269947 3300006195 Bacteria 1039
116 Ga0097621_100022175 3300006237 Bacteria 4926
117 Ga0075370_10001494 3300006353 Bacteria 10200
118 Ga0075370_10016634 3300006353 Bacteria 3959
119 Ga0068871_100159856 3300006358 Bacteria 1926
120 Ga0068871_100202800 3300006358 Bacteria 1713
121 Ga0075428_100435309 3300006844 Bacteria 1405
122 Ga0075428_100963657 3300006844 Bacteria 904
123 Ga0075430_100148509 3300006846 Bacteria 1952
124 Ga0075430_100258981 3300006846 Bacteria 1441
125 Ga0075430_100781373 3300006846 Bacteria 787
126 Ga0075431_100004178 3300006847 Bacteria 14124
127 Ga0075431_100083112 3300006847 Bacteria 3305
128 Ga0075431_100259788 3300006847 Bacteria 1762
129 Ga0075433_10005667 3300006852 Bacteria 9814
130 Ga0075433_10638515 3300006852 Bacteria 934
131 Ga0075433_10697880 3300006852 Bacteria 889
132 Ga0075434_100003971 3300006871 Bacteria 13247
133 Ga0075429_100031569 3300006880 Bacteria 4603
134 Ga0068865_100012761 3300006881 Bacteria 5296
135 Ga0075436_100008022 3300006914 Bacteria 7229
136 Ga0075436_100024362 3300006914 Bacteria 4160
137 Ga0097620_100026100 3300006931 Bacteria 5861
138 Ga0097620_101321763 3300006931 Bacteria 795
139 Ga0075435_100707192 3300007076 Bacteria 876
140 Ga0105250_10305467 3300009092 Bacteria 689
141 Ga0105240_10150531 3300009093 Bacteria 2772
142 Ga0111539_10004902 3300009094 Bacteria 17425
143 Ga0111539_10016480 3300009094 Bacteria 9163
144 Ga0111539_10899018 3300009094 Bacteria 1030
145 Ga0105245_10192953 3300009098 Bacteria 1952
146 Ga0105247_10016187 3300009101 Bacteria 4467
147 Ga0114129_10000169 3300009147 Bacteria 70876
148 Ga0114129_10030046 3300009147 Bacteria 7694
149 Ga0114129_10039368 3300009147 Bacteria 6664
150 Ga0114129_10209419 3300009147 Bacteria 2636
151 Ga0105243_10122848 3300009148 Bacteria 2192
152 Ga0105241_10021983 3300009174 Bacteria 4722
153 Ga0105242_10008786 3300009176 Bacteria 7751
154 Ga0105242_10102150 3300009176 Bacteria 2431
155 Ga0105242_10561205 3300009176 Bacteria 1096
156 Ga0105248_10006018 3300009177 Bacteria 13316
157 Ga0105248_10094306 3300009177 Bacteria 3370
158 Ga0105237_10099379 3300009545 Bacteria 2901
159 Ga0105237_10405669 3300009545 Bacteria 1368
160 Ga0105238_10032707 3300009551 Bacteria 5293
161 Ga0105238_10075306 3300009551 Bacteria 3367
162 Ga0105249_10000966 3300009553 Bacteria 25437
163 Ga0105249_10050702 3300009553 Bacteria 3784
164 Ga0105239_10364620 3300010375 Bacteria 1632
165 Ga0105246_10011785 3300011119 Bacteria 5433
166 Ga0105246_10755646 3300011119 Bacteria 858
167 Ga0157369_10143949 3300013105 Bacteria 2521
168 Ga0157374_10151110 3300013296 Bacteria 2258
169 Ga0157374_11127082 3300013296 Bacteria 805
170 Ga0157378_10050600 3300013297 Bacteria 3697
171 Ga0157378_10623611 3300013297 Bacteria 1092
172 Ga0157372_10077245 3300013307 Bacteria 3760
173 Ga0157375_10008454 3300013308 Bacteria 9016
174 Ga0157375_10057361 3300013308 Unclassified 3849
175 Ga0157375_10125899 3300013308 Bacteria 2677
176 Ga0157375_10132186 3300013308 Bacteria 2616
177 Ga0157375_10624064 3300013308 Bacteria 1236
178 Ga0163163_10118020 3300014325 Bacteria 2685
179 Ga0163163_10193906 3300014325 Bacteria 2080
180 Ga0163163_10369083 3300014325 Bacteria 1492
181 Ga0157376_10661678 3300014969 Bacteria 1046
182 Ga0163161_10034366 3300017792 Bacteria 3627
183 Ga0213872_10043063 3300021361 Bacteria 2058
184 Ga0213876_10055851 3300021384 Bacteria 2085
185 Ga0213875_10099507 3300021388 Bacteria 1357
186 Ga0224712_10125143 3300022467 Bacteria 1117
187 Ga0209233_1002202 3300025261 Bacteria 7308
188 Ga0209564_1000477 3300025295 Bacteria 66843
189 Ga0209758_1000119 3300025297 Bacteria 195545
190 Ga0209758_1070577 3300025297 Bacteria 1101
191 Ga0209257_1000301 3300025304 Bacteria 108454
192 Ga0207692_10017543 3300025898 Bacteria 3195
193 Ga0207692_10081087 3300025898 Bacteria 1736
194 Ga0207642_10012688 3300025899 Bacteria 3051
195 Ga0207710_10016095 3300025900 Bacteria 3164
196 Ga0207680_10002152 3300025903 Bacteria 9235
197 Ga0207685_10000835 3300025905 Bacteria 5753
198 Ga0207699_10000837 3300025906 Bacteria 14654
199 Ga0207699_10003993 3300025906 Bacteria 7059
200 Ga0207699_10223802 3300025906 Bacteria 1286
201 Ga0207645_10056109 3300025907 Bacteria 2515
202 Ga0207643_10160525 3300025908 Bacteria 1352
203 Ga0207684_10017709 3300025910 Bacteria 6112
204 Ga0207684_10071647 3300025910 Bacteria 2944
205 Ga0207654_10017060 3300025911 Bacteria 3790
206 Ga0207707_10162487 3300025912 Bacteria 1952
207 Ga0207695_10549089 3300025913 Bacteria 1037
208 Ga0207693_10004460 3300025915 Bacteria 11828
209 Ga0207693_10005986 3300025915 Bacteria 10085
210 Ga0207663_10000371 3300025916 Bacteria 19632
211 Ga0207663_10512177 3300025916 Bacteria 933
212 Ga0207660_10028259 3300025917 Bacteria 3835
213 Ga0207660_10256350 3300025917 Bacteria 1382
214 Ga0207657_10028226 3300025919 Bacteria 5122
215 Ga0207657_10029602 3300025919 Bacteria 4982
216 Ga0207657_10162783 3300025919 Bacteria 1811
217 Ga0207657_10410489 3300025919 Bacteria 1065
218 Ga0207652_10085242 3300025921 Bacteria 2769
219 Ga0207652_10085729 3300025921 Bacteria 2760
220 Ga0207646_10190128 3300025922 Bacteria 1854
221 Ga0207646_10264167 3300025922 Bacteria 1555
222 Ga0207646_10365049 3300025922 Bacteria 1304
223 Ga0207650_10222695 3300025925 Bacteria 1519
224 Ga0207650_10692943 3300025925 Bacteria 860
225 Ga0207687_10031382 3300025927 Bacteria 3590
226 Ga0207700_10000278 3300025928 Bacteria 30513
227 Ga0207700_10014843 3300025928 Bacteria 5116
228 Ga0207700_10030231 3300025928 Bacteria 3833
229 Ga0207700_10196730 3300025928 Bacteria 1697
230 Ga0207664_10010659 3300025929 Bacteria 6498
231 Ga0207664_10059821 3300025929 Bacteria 3036
232 Ga0207664_10118870 3300025929 Bacteria 2209
233 Ga0207664_10236577 3300025929 Bacteria 1589
234 Ga0207644_10024802 3300025931 Bacteria 4119
235 Ga0207644_10058088 3300025931 Bacteria 2795
236 Ga0207690_10184190 3300025932 Bacteria 1574
237 Ga0207706_10085129 3300025933 Bacteria 2780
238 Ga0207686_10019857 3300025934 Bacteria 3830
239 Ga0207686_10121724 3300025934 Bacteria 1777
240 Ga0207686_10603822 3300025934 Bacteria 864
241 Ga0207709_10486148 3300025935 Bacteria 961
242 Ga0207670_10199841 3300025936 Bacteria 1518
243 Ga0207665_10000402 3300025939 Bacteria 29788
244 Ga0207665_10000654 3300025939 Bacteria 23305
245 Ga0207691_10274587 3300025940 Bacteria 1451
246 Ga0207711_10004053 3300025941 Bacteria 12576
247 Ga0207689_10081634 3300025942 Bacteria 2658
248 Ga0207661_10001495 3300025944 Bacteria 15826
249 Ga0207661_11192588 3300025944 Bacteria 700
250 Ga0207667_10042359 3300025949 Bacteria 4840
251 Ga0207651_10063178 3300025960 Bacteria 2584
252 Ga0207712_10185416 3300025961 Bacteria 1638
253 Ga0207712_10568420 3300025961 Bacteria 977
254 Ga0207658_10019831 3300025986 Bacteria 4653
255 Ga0207677_10008562 3300026023 Bacteria 5722
256 Ga0207677_10251001 3300026023 Bacteria 1437
257 Ga0207703_10161910 3300026035 Bacteria 1960
258 Ga0207678_10007015 3300026067 Bacteria 10000
259 Ga0207708_10277775 3300026075 Bacteria 1356
260 Ga0207702_10157258 3300026078 Bacteria 2073
261 Ga0207641_10118708 3300026088 Bacteria 2356
262 Ga0207641_10362535 3300026088 Bacteria 1384
263 Ga0207676_10142395 3300026095 Bacteria 2054
264 Ga0207676_11002182 3300026095 Bacteria 823
265 Ga0207674_10085352 3300026116 Bacteria 3152
266 Ga0207675_100060000 3300026118 Bacteria 3551
267 Ga0207683_10001639 3300026121 Bacteria 20049
268 Ga0207683_10123468 3300026121 Bacteria 2326
269 Ga0207698_10053749 3300026142 Bacteria 3094
270 Ga0207698_10334704 3300026142 Bacteria 1423
271 Ga0207428_10007198 3300027907 Bacteria 10177
272 Ga0268266_10060154 3300028379 Bacteria 3274
273 Ga0268265_10011219 3300028380 Bacteria 6057
274 Ga0268265_10049923 3300028380 Bacteria 3150
275 Ga0268264_10981009 3300028381 Bacteria 851
276 Ga0268264_11394349 3300028381 Bacteria 711
277 Ga0265318_10113304 3300028577 Bacteria 997
278 Ga0265338_10137374 3300028800 Bacteria 1919
279 Ga0265324_10000045 3300029957 Bacteria 107095
280 Ga0265330_10191134 3300031235 Bacteria 866
281 Ga0265325_10004448 3300031241 Bacteria 8863
282 Ga0265325_10013096 3300031241 Bacteria 4726
283 Ga0265325_10053346 3300031241 Bacteria 2073
284 Ga0265325_10062558 3300031241 Bacteria 1885
285 Ga0265340_10056756 3300031247 Bacteria 1883
286 Ga0265339_10000001 3300031249 Bacteria 613713
287 Ga0265339_10138652 3300031249 Bacteria 1239
288 Ga0307513_10086997 3300031456 Bacteria 3201
289 Ga0307513_10148639 3300031456 Bacteria 2256
290 Ga0307408_100036937 3300031548 Bacteria 3437
291 Ga0265313_10001601 3300031595 Bacteria 21013
292 Ga0265313_10148883 3300031595 Bacteria 1002
293 Ga0307508_10274885 3300031616 Bacteria 1278
294 Ga0307508_10372852 3300031616 Bacteria 1018
295 Ga0316575_10207288 3300031665 Bacteria 817
296 Ga0316579_10192124 3300031691 Bacteria 987
297 Ga0265342_10000290 3300031712 Bacteria 56854
298 Ga0265342_10046417 3300031712 Bacteria 2611
299 Ga0265342_10111096 3300031712 Bacteria 1551
300 Ga0316576_10090017 3300031727 Bacteria 2285
301 Ga0316576_10102791 3300031727 Bacteria 2137
302 Ga0316578_10010323 3300031728 Bacteria 4844
303 Ga0316578_10077478 3300031728 Bacteria 1974
304 Ga0316577_10089188 3300031733 Bacteria 1726
305 Ga0307409_100045463 3300031995 Bacteria 3315
306 Ga0307416_100083981 3300032002 Bacteria 2704
307 Ga0307416_100311930 3300032002 Bacteria 1570
308 Ga0307414_10543084 3300032004 Bacteria 1035
309 Ga0307415_101053899 3300032126 Bacteria 759
310 Ga0316583_10043396 3300032133 Bacteria 1589
311 Ga0316583_10059558 3300032133 Bacteria 1339
312 Ga0316585_10001973 3300032137 Bacteria 5480
313 Ga0316580_10015339 3300032139 Bacteria 2343
314 Ga0316580_10034572 3300032139 Bacteria 1564
315 Ga0316593_10060667 3300032168 Bacteria 1292
316 Ga0315911_1000005 3300033442 Bacteria 426255
317 Ga0316588_1000374 3300033528 Bacteria 5858
318 Ga0316596_1002745 3300033541 Bacteria 3792
319 Ga0373959_0010797 3300034820 Bacteria 1603
320 Ga0373956_0029219 3300035119 Bacteria 2403
321 Ga0373946_0108666 3300035171 Bacteria 1252
322 Ga0373955_0031114 3300035172 Bacteria 2794
323 Ga0316574_0027017 3300035398 Bacteria 3455
324 Ga0373927_0028113 3300035695 Bacteria 3670
325 Ga0373933_0000105 3300035724 Bacteria 53488
326 Ga0316582_0130873 3300036647 Bacteria 1685
327 Ga0316584_0044384 3300036712 Bacteria 3314
328 Ga0316584_0494071 3300036712 Bacteria 860
329 Ga0373925_0050689 3300037068 Bacteria 3097
330 Ga0395899_0261808 3300037312 Bacteria 1183
331 Ga0395900_0119009 3300037418 Bacteria 2711
332 Ga0395900_0206509 3300037418 Bacteria 1985
333 Ga0395898_0515186 3300037466 Bacteria 1137
334 Ga0395898_1065917 3300037466 Bacteria 742
335 Ga0395905_0063800 3300037471 Bacteria 3447
336 Ga0316581_0052048 3300037588 Bacteria 1255
337 Ga0436364_0481824 3300037853 Bacteria 2132
338 Ga0436364_0801724 3300037853 Bacteria 3847
339 Ga0436364_1313926 3300037853 Bacteria 2078
340 Ga0395901_0043035 3300038443 Bacteria 4684
341 Ga0400486_20732 3300038742 Bacteria 10090
342 Ga0436365_1260870 3300039437 Bacteria 1988
343 Ga0436365_1304456 3300039437 Bacteria 1255
344 Ga0436365_1475799 3300039437 Bacteria 2456
345 Ga0436365_1748177 3300039437 Bacteria 865
346 Ga0436360_0651118 3300039438 Bacteria 1257
347 Ga0436360_1199124 3300039438 Bacteria 1119
348 Ga0436361_0032021 3300039447 Bacteria 3895
349 Ga0436361_0870414 3300039447 Bacteria 1364
350 Ga0436363_0017439 3300039450 Bacteria 730
351 Ga0436363_0143098 3300039450 Bacteria 783
352 Ga0436363_0879252 3300039450 Bacteria 964
353 Ga0436363_0907811 3300039450 Bacteria 1419
354 Ga0436363_0917989 3300039450 Bacteria 2474
355 Ga0436362_0295451 3300039453 Bacteria 5590
356 Ga0439453_0001375 3300041408 Bacteria 3104
357 Ga0451845_0536594 3300041501 Bacteria 675
358 Ga0439464_0080639 3300042439 Bacteria 972
359 Ga0439460_0026206 3300042461 Bacteria 1629
360 Ga0439440_0055971 3300042993 Bacteria 996
361 Ga0453683_0030858 3300044673 Bacteria 3387
362 Ga0453683_0060455 3300044673 Bacteria 2369
363 Ga0466966_0303447 3300044684 Bacteria 959
364 Ga0466957_0042216 3300044842 Bacteria 2758
365 Ga0451576_0247555 3300045051 Bacteria 1863
366 Ga0495603_0082598 3300046455 Bacteria 1882
367 Ga0495638_0001102 3300046460 Bacteria 26299
368 Ga0495638_0056677 3300046460 Bacteria 2431
369 Ga0495585_0317053 3300046492 Bacteria 763
370 Ga0495630_0194934 3300046517 Bacteria 1546
371 Ga0495631_0224847 3300046518 Bacteria 801
372 Ga0495644_0108828 3300046523 Bacteria 1051
373 Ga0495663_0028697 3300046525 Bacteria 1639
374 Ga0495640_0111227 3300046533 Bacteria 1790
375 Ga0495586_0051117 3300046535 Bacteria 2237
376 Ga0495586_0381994 3300046535 Bacteria 810
377 Ga0495586_0505576 3300046535 Bacteria 697
378 Ga0495656_0060760 3300046615 Bacteria 1648
379 Ga0495625_0248539 3300046660 Bacteria 1155
380 Ga0495659_0050019 3300046664 Bacteria 1519
381 Ga0495599_0304801 3300046678 Bacteria 961
382 Ga0495658_0047546 3300046683 Bacteria 2417
383 Ga0495613_0351873 3300046689 Bacteria 1012
384 Ga0495674_0455385 3300047319 Bacteria 1028
385 Ga0495675_0301580 3300047444 Bacteria 951
386 Ga0495684_0128270 3300047471 Bacteria 1907
387 Ga0495686_0148822 3300047472 Bacteria 1376
388 Ga0495615_0108341 3300048090 Bacteria 792
389 Ga0496100_0141471 3300048903 Bacteria 1706
390 Ga0496101_0015489 3300048904 Bacteria 5141
391 Ga0496101_0015625 3300048904 Bacteria 5120
392 Ga0496101_0238642 3300048904 Bacteria 1414
393 Ga0496102_0005603 3300048905 Bacteria 10660
394 Ga0496102_0045137 3300048905 Bacteria 4000
395 Ga0496102_0048482 3300048905 Bacteria 3862
396 Ga0496102_0274089 3300048905 Bacteria 1590
397 Ga0496103_0026222 3300048906 Bacteria 3528
398 Ga0496104_0000912 3300048907 Bacteria 25341
399 Ga0496104_0006370 3300048907 Bacteria 10382
400 Ga0496105_0082821 3300048908 Bacteria 2650
401 Ga0496106_0079602 3300048909 Bacteria 2516
402 Ga0496107_0226915 3300048910 Bacteria 1389
403 Ga0496107_0397997 3300048910 Bacteria 1024
404 Ga0496108_0033113 3300048911 Bacteria 4293
405 Ga0496109_0133761 3300048912 Bacteria 2316
406 Ga0496109_0143087 3300048912 Bacteria 2236
407 Ga0496109_0944361 3300048912 Bacteria 800
408 Ga0496110_0067298 3300048913 Bacteria 3169
409 Ga0496110_0511205 3300048913 Bacteria 1093
410 Ga0496111_0070277 3300048914 Bacteria 2546
411 Ga0496111_0293607 3300048914 Bacteria 1205
412 Ga0496111_0440523 3300048914 Bacteria 962
413 Ga0496112_0007586 3300048915 Bacteria 9640
414 Ga0496112_0010264 3300048915 Bacteria 8489
415 Ga0496112_0031540 3300048915 Bacteria 5142
416 Ga0496112_0303979 3300048915 Bacteria 1540
417 Ga0496112_0311931 3300048915 Bacteria 1518
418 Ga0496112_0561498 3300048915 Bacteria 1075
419 Ga0496113_0002041 3300048916 Bacteria 11593
420 Ga0496113_0235029 3300048916 Bacteria 1462
421 Ga0496113_0427728 3300048916 Bacteria 1064
422 Ga0496114_0011416 3300048917 Bacteria 7098
423 Ga0496114_0209699 3300048917 Bacteria 1708
424 Ga0496115_0004735 3300048918 Bacteria 9867
425 Ga0496115_0009664 3300048918 Bacteria 7176
426 Ga0496116_0112254 3300048919 Bacteria 1598
427 Ga0496121_0385297 3300048924 Bacteria 923
428 Ga0496125_0397030 3300048928 Bacteria 807
429 Ga0496126_0008327 3300048929 Bacteria 11198
430 Ga0496126_0173894 3300048929 Bacteria 1833
431 Ga0501034_0065062 3300049571 Bacteria 3659
432 Ga0501036_0155795 3300049572 Bacteria 1927
433 Ga0501038_0254382 3300049574 Bacteria 1390
434 Ga0501039_0658344 3300049575 Bacteria 820
435 Ga0501041_0361012 3300049577 Bacteria 918
436 Ga0501042_0099028 3300049578 Bacteria 2096
437 Ga0501042_0118923 3300049578 Bacteria 1902
438 Ga0501046_0598887 3300049580 Bacteria 782
439 Ga0501048_0280312 3300049582 Bacteria 1185
440 Ga0501048_0420801 3300049582 Bacteria 956
441 Ga0501067_0008047 3300049583 Bacteria 5858
442 Ga0501068_0091354 3300049584 Bacteria 1879
443 Ga0501068_0168731 3300049584 Bacteria 1380
444 Ga0501068_0442179 3300049584 Bacteria 841
445 Ga0501069_0021617 3300049585 Bacteria 3495
446 Ga0501072_0067693 3300049588 Bacteria 2818
447 Ga0501072_0096783 3300049588 Bacteria 2345
448 Ga0501073_0450366 3300049589 Bacteria 890
449 Ga0501074_0482629 3300049590 Bacteria 878
450 Ga0501075_0011562 3300049591 Bacteria 6249
451 Ga0501075_0248738 3300049591 Bacteria 1355
452 Ga0501075_0480817 3300049591 Bacteria 947
453 Ga0501076_0036299 3300049592 Bacteria 3862
454 Ga0501076_0064079 3300049592 Bacteria 2929
455 Ga0501076_0315262 3300049592 Bacteria 1283
456 Ga0501077_0010241 3300049593 Bacteria 5837
457 Ga0501077_0020242 3300049593 Bacteria 4212
458 Ga0501080_0395079 3300049742 Bacteria 1245
459 Ga0501081_0001648 3300049743 Bacteria 13815
460 Ga0501083_0022783 3300049744 Bacteria 4346
461 Ga0501083_0026864 3300049744 Bacteria 3977
462 Ga0501283_008522 3300049779 Bacteria 1480
463 Ga0501044_0224514 3300049823 Bacteria 1828
464 Ga0501045_0117453 3300049824 Bacteria 1974
465 nmdc:mga03n38_137712_c1 3300050490 Bacteria 1216
466 nmdc:mga00v17_64953_c1 3300050491 Bacteria 2250
467 nmdc:mga0yw44_34837_c1 3300050492 Bacteria 2953
468 nmdc:mga0yw44_524254_c1 3300050492 Bacteria 804
469 nmdc:mga0k408_4162_c1 3300050493 Bacteria 7678
470 nmdc:mga05p37_22200_c1 3300050507 Bacteria 7694
471 nmdc:mga05p37_25065_c1 3300050507 Bacteria 7251
472 nmdc:mga05p37_270457_c1 3300050507 Bacteria 2031
473 nmdc:mga05p37_50836_c1 3300050507 Bacteria 5097
474 nmdc:mga05p37_71222_c1 3300050507 Bacteria 4276
475 nmdc:mga09592_292152_c1 3300050508 Bacteria 1413
476 nmdc:mga09592_67354_c1 3300050508 Bacteria 3036
477 nmdc:mga09592_875249_c1 3300050508 Bacteria 756
478 nmdc:mga0qj67_168635_c1 3300050509 Bacteria 1777
479 nmdc:mga0qj67_75365_c1 3300050509 Bacteria 2697
480 nmdc:mga06r32_140584_c1 3300050510 Bacteria 2390
481 nmdc:mga06r32_336208_c1 3300050510 Bacteria 1495
482 nmdc:mga06r32_57021_c1 3300050510 Bacteria 3752
483 nmdc:mga06r32_85984_c1 3300050510 Bacteria 3067
484 nmdc:mga08y16_20622_c1 3300050511 Bacteria 6955
485 nmdc:mga08y16_770193_c1 3300050511 Bacteria 957
486 nmdc:mga0n895_32264_c1 3300050512 Bacteria 5027
487 nmdc:mga0n895_516604_c1 3300050512 Bacteria 1202
488 nmdc:mga0n895_551028_c1 3300050512 Bacteria 1159
489 nmdc:mga0rr50_379008_c1 3300050513 Bacteria 1193
490 nmdc:mga08x19_36343_c1 3300050514 Bacteria 3120
491 nmdc:mga0a205_34140_c1 3300050515 Bacteria 4880
492 nmdc:mga0a205_380589_c1 3300050515 Bacteria 1277
493 nmdc:mga0sz30_337534_c1 3300050516 Bacteria 673
494 Ga0500578_0023411 3300053086 Bacteria 3965
495 Ga0500583_0122338 3300053092 Bacteria 1288
496 Ga0500651_0013928 3300053093 Bacteria 4911
497 Ga0500556_0098862 3300053104 Bacteria 1122
498 Ga0500642_0000191 3300053130 Bacteria 24993
499 Ga0500642_0013079 3300053130 Bacteria 3036
500 Ga0500642_0023183 3300053130 Bacteria 2488
501 Ga0500642_0075452 3300053130 Bacteria 1541
502 Ga0500652_185080 3300053131 Bacteria 852
503 Ga0500568_0029629 3300053139 Bacteria 2269
504 Ga0500588_0005383 3300053146 Bacteria 2842
505 Ga0500604_0004193 3300053151 Bacteria 3836
506 Ga0500604_0010003 3300053151 Bacteria 2533
507 Ga0500616_0002930 3300053153 Bacteria 13590
508 Ga0500609_001048 3300053731 Bacteria 4128
509 Ga0501084_0038163 3300054114 Bacteria 4016
510 Ga0501084_0042868 3300054114 Bacteria 3785
511 Ga0501084_0540088 3300054114 Bacteria 985
512 Ga0501084_0761261 3300054114 Bacteria 816
513 Ga0501082_0007311 3300060353 Bacteria 9529
514 Ga0501082_0007634 3300060353 Bacteria 9328
515 Ga0501082_0148658 3300060353 Bacteria 2035
516 Ga0501082_0377455 3300060353 Bacteria 1237
517 Ga0530510_0099077 3300061734 Bacteria 2131
518 2512730595 2512564039 Bacteria 8739048
519 2513657516 2513237096 Bacteria 8722461
520 2513861156 2513237137 Bacteria 9558895
521 2513916769 2513237145 Bacteria 8979722
522 2517889677 2517572143 Bacteria 9484767
523 2524533155 2524023228 Bacteria 10118060
524 2644290447 2643221651 Bacteria 4798932
525 2671119529 2667528175 Bacteria 7532676
526 2728755320 2728368998 Bacteria 8720350
527 2793070342 2791355197 Bacteria 8420563
528 2824666886 2824661429 Bacteria 9877870
529 2903750066 2903748898 Bacteria 9972761
530 2904692022 2904690495 Bacteria 9412302
531 2904707565
532 2906614655
533 2906643570 2906635258 Bacteria 8601019
534 2906660979 2906660503 Bacteria 8595048
535 2908757301 2908756301 Bacteria 8864324
536 2922426517
537 2980126777 2980125574 Bacteria 5567337
538 3005475859 3005474847 Bacteria 9259049
539 8006937175 8006933436 Bacteria 10410654
540 8006977185 8006973647 Bacteria 10679141
541 8019561482 8019555841 Bacteria 9642137
542 8019571557 8019565922 Bacteria 9639779
543 8056692968 8056689827 Bacteria 6712655
544 Ga0207707_10452562
545 LJQas_1006597
546 JGI25406J46586_10006332
547 JGI25153J46596_10000082
548 Ga0070683_100021042
549 Ga0070683_100033745
550 Ga0070690_100002273
551 Ga0070670_100074998
552 Ga0070670_100116256
553 Ga0070666_10026927
554 Ga0070680_100010866
555 Ga0070680_100127606
556 Ga0068868_100017094
557 Ga0070660_100080643
558 Ga0070660_100143138
559 Ga0070660_100215921
560 Ga0070660_100562694
561 Ga0070689_100075254
562 Ga0070689_100304938
563 Ga0070691_10005180
564 Ga0070661_100012217
565 Ga0070675_100521210
566 Ga0070671_100019470
567 Ga0070671_100029240
568 Ga0070673_100251094
569 Ga0070688_100046591
570 Ga0070667_100030370
571 Ga0070667_100032882
572 Ga0070709_10001499
573 Ga0070709_10226365
574 Ga0070714_100014065
575 Ga0070714_100029341
576 Ga0070714_100109285
577 Ga0070713_100000667
578 Ga0070713_100004640
579 Ga0070713_100041948
580 Ga0070713_100072661
581 Ga0070713_100864315
582 Ga0070710_10000248
583 Ga0070710_10005159
584 Ga0070710_10047059
585 Ga0070701_10055100
586 Ga0070711_100016896
587 Ga0070711_100032928
588 Ga0070711_100594051
589 Ga0070700_100186141
590 Ga0070708_100158074
591 Ga0070708_100428004
592 Ga0070708_100513050
593 Ga0070663_100134172
594 Ga0070678_100198248
595 Ga0070662_100488459
596 Ga0068867_100571538
597 Ga0070685_10015589
598 Ga0070706_100075061
599 Ga0070707_100031016
600 Ga0070707_100201719
601 Ga0070707_100224974
602 Ga0070698_100023650
603 Ga0070698_100229492
604 Ga0070699_100009781
605 Ga0070699_100042020
606 Ga0070679_100125183
607 Ga0070679_100270506
608 Ga0070684_100006227
609 Ga0070697_100358477
610 Ga0070697_100434691
611 Ga0070672_100152395
612 Ga0070686_100011985
613 Ga0070696_100027869
614 Ga0070696_100112405
615 Ga0070665_100016617
616 Ga0070665_100190754
617 Ga0070704_100027783
618 Ga0070704_101304402
619 Ga0068855_100714150
620 Ga0068857_100224574
621 Ga0068856_100024482
622 Ga0070702_100185541
623 Ga0068852_100049076
624 Ga0068852_100432992
625 Ga0068859_100026100
626 Ga0068859_101321704
627 Ga0068864_100011024
628 Ga0068866_10056000
629 Ga0068866_10110817
630 Ga0068870_10133002
631 Ga0068863_100714438
632 Ga0068863_101590275
633 Ga0068860_100572988
634 Ga0068862_100005038
635 Ga0068862_100758360
636 Ga0081455_10003539
637 Ga0081540_1009546
638 Ga0081539_10002647
639 Ga0081539_10043801
640 Ga0081539_10095599
641 Ga0070717_10002358
642 Ga0070717_10005997
643 Ga0070717_10008523
644 Ga0075365_10020146
645 Ga0075368_10284463
646 Ga0075363_100063046
647 Ga0075363_100099732
648 Ga0070715_10002924
649 Ga0070715_10018426
650 Ga0070716_100000809
651 Ga0070716_100006665
652 Ga0070712_100015589
653 Ga0075362_10010322
654 Ga0075367_10014825
655 Ga0075369_10045045
656 Ga0075366_10005599
657 Ga0075366_10071607
658 Ga0075366_10269947
659 Ga0097621_100022175
660 Ga0075370_10001494
661 Ga0075370_10016634
662 Ga0068871_100159856
663 Ga0068871_100202800
664 Ga0075428_100435309
665 Ga0075428_100963657
666 Ga0075430_100148509
667 Ga0075430_100258981
668 Ga0075430_100781373
669 Ga0075431_100004178
670 Ga0075431_100083112
671 Ga0075431_100259788
672 Ga0075433_10005667
673 Ga0075433_10638515
674 Ga0075433_10697880
675 Ga0075434_100003971
676 Ga0075429_100031569
677 Ga0068865_100012761
678 Ga0075436_100008022
679 Ga0075436_100024362
680 Ga0097620_100026100
681 Ga0097620_101321763
682 Ga0075435_100707192
683 Ga0105250_10305467
684 Ga0105240_10150531
685 Ga0111539_10004902
686 Ga0111539_10016480
687 Ga0111539_10899018
688 Ga0105245_10192953
689 Ga0105247_10016187
690 Ga0114129_10000169
691 Ga0114129_10030046
692 Ga0114129_10039368
693 Ga0114129_10209419
694 Ga0105243_10122848
695 Ga0105241_10021983
696 Ga0105242_10008786
697 Ga0105242_10102150
698 Ga0105242_10561205
699 Ga0105248_10006018
700 Ga0105248_10094306
701 Ga0105237_10099379
702 Ga0105237_10405669
703 Ga0105238_10032707
704 Ga0105238_10075306
705 Ga0105249_10000966
706 Ga0105249_10050702
707 Ga0105239_10364620
708 Ga0105246_10011785
709 Ga0105246_10755646
710 Ga0157369_10143949
711 Ga0157374_10151110
712 Ga0157374_11127082
713 Ga0157378_10050600
714 Ga0157378_10623611
715 Ga0157372_10077245
716 Ga0157375_10008454
717 Ga0157375_10057361
718 Ga0157375_10125899
719 Ga0157375_10132186
720 Ga0157375_10624064
721 Ga0163163_10118020
722 Ga0163163_10193906
723 Ga0163163_10369083
724 Ga0157376_10661678
725 Ga0163161_10034366
726 Ga0213872_10043063
727 Ga0213876_10055851
728 Ga0213875_10099507
729 Ga0224712_10125143
730 Ga0209233_1002202
731 Ga0209564_1000477
732 Ga0209758_1000119
733 Ga0209758_1070577
734 Ga0209257_1000301
735 Ga0207692_10017543
736 Ga0207692_10081087
737 Ga0207642_10012688
738 Ga0207710_10016095
739 Ga0207680_10002152
740 Ga0207685_10000835
741 Ga0207699_10000837
742 Ga0207699_10003993
743 Ga0207699_10223802
744 Ga0207645_10056109
745 Ga0207643_10160525
746 Ga0207684_10017709
747 Ga0207684_10071647
748 Ga0207654_10017060
749 Ga0207707_10162487
750 Ga0207695_10549089
751 Ga0207693_10004460
752 Ga0207693_10005986
753 Ga0207663_10000371
754 Ga0207663_10512177
755 Ga0207660_10028259
756 Ga0207660_10256350
757 Ga0207657_10028226
758 Ga0207657_10029602
759 Ga0207657_10162783
760 Ga0207657_10410489
761 Ga0207652_10085242
762 Ga0207652_10085729
763 Ga0207646_10190128
764 Ga0207646_10264167
765 Ga0207646_10365049
766 Ga0207650_10222695
767 Ga0207650_10692943
768 Ga0207687_10031382
769 Ga0207700_10000278
770 Ga0207700_10014843
771 Ga0207700_10030231
772 Ga0207700_10196730
773 Ga0207664_10010659
774 Ga0207664_10059821
775 Ga0207664_10118870
776 Ga0207664_10236577
777 Ga0207644_10024802
778 Ga0207644_10058088
779 Ga0207690_10184190
780 Ga0207706_10085129
781 Ga0207686_10019857
782 Ga0207686_10121724
783 Ga0207686_10603822
784 Ga0207709_10486148
785 Ga0207670_10199841
786 Ga0207665_10000402
787 Ga0207665_10000654
788 Ga0207691_10274587
789 Ga0207711_10004053
790 Ga0207689_10081634
791 Ga0207661_10001495
792 Ga0207661_11192588
793 Ga0207667_10042359
794 Ga0207651_10063178
795 Ga0207712_10185416
796 Ga0207712_10568420
797 Ga0207658_10019831
798 Ga0207677_10008562
799 Ga0207677_10251001
800 Ga0207703_10161910
801 Ga0207678_10007015
802 Ga0207708_10277775
803 Ga0207702_10157258
804 Ga0207641_10118708
805 Ga0207641_10362535
806 Ga0207676_10142395
807 Ga0207676_11002182
808 Ga0207674_10085352
809 Ga0207675_100060000
810 Ga0207683_10001639
811 Ga0207683_10123468
812 Ga0207698_10053749
813 Ga0207698_10334704
814 Ga0207428_10007198
815 Ga0268266_10060154
816 Ga0268265_10011219
817 Ga0268265_10049923
818 Ga0268264_10981009
819 Ga0268264_11394349
820 Ga0265318_10113304
821 Ga0265338_10137374
822 Ga0265324_10000045
823 Ga0265330_10191134
824 Ga0265325_10004448
825 Ga0265325_10013096
826 Ga0265325_10053346
827 Ga0265325_10062558
828 Ga0265340_10056756
829 Ga0265339_10000001
830 Ga0265339_10138652
831 Ga0307513_10086997
832 Ga0307513_10148639
833 Ga0307408_100036937
834 Ga0265313_10001601
835 Ga0265313_10148883
836 Ga0307508_10274885
837 Ga0307508_10372852
838 Ga0316575_10207288
839 Ga0316579_10192124
840 Ga0265342_10000290
841 Ga0265342_10046417
842 Ga0265342_10111096
843 Ga0316576_10090017
844 Ga0316576_10102791
845 Ga0316578_10010323
846 Ga0316578_10077478
847 Ga0316577_10089188
848 Ga0307409_100045463
849 Ga0307416_100083981
850 Ga0307416_100311930
851 Ga0307414_10543084
852 Ga0307415_101053899
853 Ga0316583_10043396
854 Ga0316583_10059558
855 Ga0316585_10001973
856 Ga0316580_10015339
857 Ga0316580_10034572
858 Ga0316593_10060667
859 Ga0315911_1000005
860 Ga0316588_1000374
861 Ga0316596_1002745
862 Ga0373959_0010797
863 Ga0373956_0029219
864 Ga0373946_0108666
865 Ga0373955_0031114
866 Ga0316574_0027017
867 Ga0373927_0028113
868 Ga0373933_0000105
869 Ga0316582_0130873
870 Ga0316584_0044384
871 Ga0316584_0494071
872 Ga0373925_0050689
873 Ga0395899_0261808
874 Ga0395900_0119009
875 Ga0395900_0206509
876 Ga0395898_0515186
877 Ga0395898_1065917
878 Ga0395905_0063800
879 Ga0316581_0052048
880 Ga0436364_0481824
881 Ga0436364_0801724
882 Ga0436364_1313926
883 Ga0395901_0043035
884 Ga0400486_20732
885 Ga0436365_1260870
886 Ga0436365_1304456
887 Ga0436365_1475799
888 Ga0436365_1748177
889 Ga0436360_0651118
890 Ga0436360_1199124
891 Ga0436361_0032021
892 Ga0436361_0870414
893 Ga0436363_0017439
894 Ga0436363_0143098
895 Ga0436363_0879252
896 Ga0436363_0907811
897 Ga0436363_0917989
898 Ga0436362_0295451
899 Ga0439453_0001375
900 Ga0451845_0536594
901 Ga0439464_0080639
902 Ga0439460_0026206
903 Ga0439440_0055971
904 Ga0453683_0030858
905 Ga0453683_0060455
906 Ga0466966_0303447
907 Ga0466957_0042216
908 Ga0451576_0247555
909 Ga0495603_0082598
910 Ga0495638_0001102
911 Ga0495638_0056677
912 Ga0495585_0317053
913 Ga0495630_0194934
914 Ga0495631_0224847
915 Ga0495644_0108828
916 Ga0495663_0028697
917 Ga0495640_0111227
918 Ga0495586_0051117
919 Ga0495586_0381994
920 Ga0495586_0505576
921 Ga0495656_0060760
922 Ga0495625_0248539
923 Ga0495659_0050019
924 Ga0495599_0304801
925 Ga0495658_0047546
926 Ga0495613_0351873
927 Ga0495674_0455385
928 Ga0495675_0301580
929 Ga0495684_0128270
930 Ga0495686_0148822
931 Ga0495615_0108341
932 Ga0496100_0141471
933 Ga0496101_0015489
934 Ga0496101_0015625
935 Ga0496101_0238642
936 Ga0496102_0005603
937 Ga0496102_0045137
938 Ga0496102_0048482
939 Ga0496102_0274089
940 Ga0496103_0026222
941 Ga0496104_0000912
942 Ga0496104_0006370
943 Ga0496105_0082821
944 Ga0496106_0079602
945 Ga0496107_0226915
946 Ga0496107_0397997
947 Ga0496108_0033113
948 Ga0496109_0133761
949 Ga0496109_0143087
950 Ga0496109_0944361
951 Ga0496110_0067298
952 Ga0496110_0511205
953 Ga0496111_0070277
954 Ga0496111_0293607
955 Ga0496111_0440523
956 Ga0496112_0007586
957 Ga0496112_0010264
958 Ga0496112_0031540
959 Ga0496112_0303979
960 Ga0496112_0311931
961 Ga0496112_0561498
962 Ga0496113_0002041
963 Ga0496113_0235029
964 Ga0496113_0427728
965 Ga0496114_0011416
966 Ga0496114_0209699
967 Ga0496115_0004735
968 Ga0496115_0009664
969 Ga0496116_0112254
970 Ga0496121_0385297
971 Ga0496125_0397030
972 Ga0496126_0008327
973 Ga0496126_0173894
974 Ga0501034_0065062
975 Ga0501036_0155795
976 Ga0501038_0254382
977 Ga0501039_0658344
978 Ga0501041_0361012
979 Ga0501042_0099028
980 Ga0501042_0118923
981 Ga0501046_0598887
982 Ga0501048_0280312
983 Ga0501048_0420801
984 Ga0501067_0008047
985 Ga0501068_0091354
986 Ga0501068_0168731
987 Ga0501068_0442179
988 Ga0501069_0021617
989 Ga0501072_0067693
990 Ga0501072_0096783
991 Ga0501073_0450366
992 Ga0501074_0482629
993 Ga0501075_0011562
994 Ga0501075_0248738
995 Ga0501075_0480817
996 Ga0501076_0036299
997 Ga0501076_0064079
998 Ga0501076_0315262
999 Ga0501077_0010241
1000 Ga0501077_0020242
1001 Ga0501080_0395079
1002 Ga0501081_0001648
1003 Ga0501083_0022783
1004 Ga0501083_0026864
1005 Ga0501283_008522
1006 Ga0501044_0224514
1007 Ga0501045_0117453
1008 nmdc:mga03n38_137712_c1
1009 nmdc:mga00v17_64953_c1
1010 nmdc:mga0yw44_34837_c1
1011 nmdc:mga0yw44_524254_c1
1012 nmdc:mga0k408_4162_c1
1013 nmdc:mga05p37_22200_c1
1014 nmdc:mga05p37_25065_c1
1015 nmdc:mga05p37_270457_c1
1016 nmdc:mga05p37_50836_c1
1017 nmdc:mga05p37_71222_c1
1018 nmdc:mga09592_292152_c1
1019 nmdc:mga09592_67354_c1
1020 nmdc:mga09592_875249_c1
1021 nmdc:mga0qj67_168635_c1
1022 nmdc:mga0qj67_75365_c1
1023 nmdc:mga06r32_140584_c1
1024 nmdc:mga06r32_336208_c1
1025 nmdc:mga06r32_57021_c1
1026 nmdc:mga06r32_85984_c1
1027 nmdc:mga08y16_20622_c1
1028 nmdc:mga08y16_770193_c1
1029 nmdc:mga0n895_32264_c1
1030 nmdc:mga0n895_516604_c1
1031 nmdc:mga0n895_551028_c1
1032 nmdc:mga0rr50_379008_c1
1033 nmdc:mga08x19_36343_c1
1034 nmdc:mga0a205_34140_c1
1035 nmdc:mga0a205_380589_c1
1036 nmdc:mga0sz30_337534_c1
1037 Ga0500578_0023411
1038 Ga0500583_0122338
1039 Ga0500651_0013928
1040 Ga0500556_0098862
1041 Ga0500642_0000191
1042 Ga0500642_0013079
1043 Ga0500642_0023183
1044 Ga0500642_0075452
1045 Ga0500652_185080
1046 Ga0500568_0029629
1047 Ga0500588_0005383
1048 Ga0500604_0004193
1049 Ga0500604_0010003
1050 Ga0500616_0002930
1051 Ga0500609_001048
1052 Ga0501084_0038163
1053 Ga0501084_0042868
1054 Ga0501084_0540088
1055 Ga0501084_0761261
1056 Ga0501082_0007311
1057 Ga0501082_0007634
1058 Ga0501082_0148658
1059 Ga0501082_0377455
1060 Ga0530510_0099077
1061 2512730595
1062 2513657516
1063 2513861156
1064 2513916769
1065 2517889677
1066 2524533155
1067 2644290447
1068 2671119529
1069 2728755320
1070 2793070342
1071 2824666886
1072 2903750066
1073 2904692022
1074 2904707565
1075 2906614655
1076 2906643570
1077 2906660979
1078 2908757301
1079 2922426517
1080 2980126777
1081 3005475859
1082 8006937175
1083 8006977185
1084 8019561482
1085 8019571557
1086 8056692968

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

43

216

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9328 7 204
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9237 7 204
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.9177 8 198
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.8908 8 198
2hf9-assembly1.cif.gz_A crystal structure of hypb from methanocaldococcus jannaschii in the triphosphate form 0.8589 3 204
ID Description Score Start End Superfamily
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9269 5 200 3.40.50.300
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9178 5 200 3.40.50.300
af_P0AAN3_68_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8005 7 200 3.40.50.300
2wsmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7961 7 199 3.40.50.300
4lpsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7661 6 209 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C1Z988-F1-model_v4 Urease accessory protein UreG 0.966 124 203 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A6A8FMF7-F1-model_v4 Urease accessory protein UreG 0.96 123 198 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A7V3UJ50-F1-model_v4 Urease accessory protein UreG 0.9596 124 198 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A6N6PVF4-F1-model_v4 Urease accessory protein UreG 0.958 114 201 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A3C1Z988-F1-model_v4 Urease accessory protein UreG 0.9543 124 203 GO:0003924
GO:0005525
GO:0016151
GO:0043419

Map