F461515

General Info

Members Datasets Scaffolds Average Seq Length
542 243 1084 266

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0429474|Ga0395901_0429474_119_958
Length 279
Sequence MTEPAIHLGARPMAVLAHELKASYAFIERNFFLSRRYWGWEIAFLVYSAAGALSISLIGAQAGDPRLLLTLMVGAIFWNYLSVVFSWIAETIAVERWEGTLEYTMMAPIRRWSQLLGSVLYAMVYGLIHTAVILVVLVLFFPQLDFTGANPLTIVAFMLLGSFSFVGIGMIAAILPLLYVERGAQMTFVLQSCLLLVSGVYYSIDILPGWMQVLSHLSPATYVLDGVRKGLIDGAPVTALVGDVWPLILMGAVLIPFGLWAFGRAERYAKRTGKLKRVG

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
168 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 9.04
Rhizosphere 89.67
Stem 0
Stem Tuber 0
Unclassified 12.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0429474 3300038443 Bacteria 1354
2 rootH1_10033475 3300003316 Unclassified 1554
3 rootH2_10185188 3300003320 Bacteria 2252
4 rootL2_10012610 3300003322 Bacteria 2409
5 rootH1_10180577 3300003323 Unclassified 1654
6 JGI26129J50193_1000961 3300003349 Unclassified 1895
7 Ga0065707_10016749 3300005295 Bacteria 2267
8 Ga0065707_10099636 3300005295 Bacteria 2990
9 Ga0070683_100336709 3300005329 Bacteria 1437
10 Ga0070670_100430368 3300005331 Bacteria 1167
11 Ga0070666_10159594 3300005335 Bacteria 1576
12 Ga0070680_100000018 3300005336 Bacteria 85499
13 Ga0070680_100219483 3300005336 Bacteria 1605
14 Ga0070682_100140659 3300005337 Bacteria 1645
15 Ga0068868_100099007 3300005338 Unclassified 2358
16 Ga0070689_100004080 3300005340 Bacteria 9836
17 Ga0070691_10070558 3300005341 Bacteria 1695
18 Ga0070691_10184487 3300005341 Unclassified 1088
19 Ga0070687_100119324 3300005343 Unclassified 1506
20 Ga0070661_100582892 3300005344 Unclassified 903
21 Ga0070668_100112818 3300005347 Bacteria 2165
22 Ga0070675_100259266 3300005354 Unclassified 1523
23 Ga0070671_100416030 3300005355 Unclassified 1151
24 Ga0070674_100006330 3300005356 Bacteria 6896
25 Ga0070674_100049109 3300005356 Bacteria 2900
26 Ga0070688_100164773 3300005365 Unclassified 1525
27 Ga0070659_100017304 3300005366 Bacteria 5421
28 Ga0070701_10088674 3300005438 Bacteria 1690
29 Ga0070701_10216691 3300005438 Bacteria 1140
30 Ga0070705_100005937 3300005440 Bacteria 5969
31 Ga0070705_100007457 3300005440 Bacteria 5382
32 Ga0070700_100053407 3300005441 Bacteria 2521
33 Ga0070700_100101083 3300005441 Bacteria 1900
34 Ga0070694_100198074 3300005444 Bacteria 1495
35 Ga0070694_100225708 3300005444 Unclassified 1407
36 Ga0070708_100014485 3300005445 Bacteria 6490
37 Ga0070708_100070824 3300005445 Bacteria 3138
38 Ga0070663_100036166 3300005455 Bacteria 3430
39 Ga0070678_100173811 3300005456 Bacteria 1757
40 Ga0070678_100199697 3300005456 Bacteria 1650
41 Ga0070662_100010425 3300005457 Bacteria 6096
42 Ga0070662_100011301 3300005457 Bacteria 5886
43 Ga0070681_10161023 3300005458 Bacteria 2168
44 Ga0068867_100013600 3300005459 Bacteria 5763
45 Ga0070685_10006448 3300005466 Bacteria 5986
46 Ga0070706_100002794 3300005467 Bacteria 17459
47 Ga0070706_100104674 3300005467 Bacteria 2632
48 Ga0070706_100122741 3300005467 Bacteria 2422
49 Ga0070706_100179845 3300005467 Bacteria 1974
50 Ga0070707_100004371 3300005468 Bacteria 13242
51 Ga0070707_100029008 3300005468 Bacteria 5267
52 Ga0070707_100064557 3300005468 Bacteria 3515
53 Ga0070707_100249077 3300005468 Bacteria 1729
54 Ga0070707_100375972 3300005468 Bacteria 1380
55 Ga0070707_100415527 3300005468 Bacteria 1305
56 Ga0070698_100002355 3300005471 Bacteria 20876
57 Ga0070698_100013941 3300005471 Bacteria 8501
58 Ga0070698_100136735 3300005471 Bacteria 2404
59 Ga0070698_100150901 3300005471 Bacteria 2272
60 Ga0070698_100267916 3300005471 Bacteria 1640
61 Ga0070698_100429136 3300005471 Bacteria 1256
62 Ga0070699_100000748 3300005518 Bacteria 30071
63 Ga0070699_100123646 3300005518 Bacteria 2277
64 Ga0070699_100201760 3300005518 Bacteria 1769
65 Ga0070699_100322838 3300005518 Bacteria 1388
66 Ga0070699_100339146 3300005518 Bacteria 1353
67 Ga0070679_100090548 3300005530 Bacteria 3047
68 Ga0070679_100460179 3300005530 Bacteria 1217
69 Ga0070684_100005556 3300005535 Bacteria 9677
70 Ga0070684_100123325 3300005535 Bacteria 2332
71 Ga0070684_100220504 3300005535 Bacteria 1730
72 Ga0070684_100572507 3300005535 Bacteria 1049
73 Ga0070697_100007331 3300005536 Bacteria 8581
74 Ga0070697_100008530 3300005536 Bacteria 8001
75 Ga0070697_100037192 3300005536 Bacteria 3933
76 Ga0070697_100045855 3300005536 Bacteria 3543
77 Ga0070697_100050973 3300005536 Bacteria 3362
78 Ga0070697_100116930 3300005536 Bacteria 2227
79 Ga0070697_100228502 3300005536 Bacteria 1587
80 Ga0068853_100146092 3300005539 Bacteria 2125
81 Ga0070672_100022690 3300005543 Bacteria 4615
82 Ga0070672_100241378 3300005543 Bacteria 1520
83 Ga0070686_100014407 3300005544 Bacteria 4559
84 Ga0070686_100086765 3300005544 Bacteria 2084
85 Ga0070686_100160789 3300005544 Bacteria 1581
86 Ga0070695_100008532 3300005545 Bacteria 6084
87 Ga0070695_100020661 3300005545 Bacteria 4021
88 Ga0070695_100337773 3300005545 Bacteria 1125
89 Ga0070695_100367677 3300005545 Unclassified 1082
90 Ga0070695_100501623 3300005545 Bacteria 939
91 Ga0070696_100000741 3300005546 Bacteria 20841
92 Ga0070696_100005510 3300005546 Bacteria 8444
93 Ga0070696_100012623 3300005546 Bacteria 5672
94 Ga0070696_100035692 3300005546 Bacteria 3424
95 Ga0070696_100044658 3300005546 Bacteria 3068
96 Ga0070696_100175111 3300005546 Unclassified 1589
97 Ga0070693_100016448 3300005547 Bacteria 3830
98 Ga0070704_100095406 3300005549 Bacteria 2227
99 Ga0070704_100124024 3300005549 Bacteria 1990
100 Ga0070704_100312396 3300005549 Bacteria 1314
101 Ga0070704_100320487 3300005549 Unclassified 1298
102 Ga0070664_100057903 3300005564 Bacteria 3295
103 Ga0068857_100412066 3300005577 Unclassified 1259
104 Ga0068854_100546704 3300005578 Unclassified 982
105 Ga0070702_100004517 3300005615 Bacteria 6365
106 Ga0068852_100071739 3300005616 Bacteria 3042
107 Ga0068852_100661696 3300005616 Unclassified 1052
108 Ga0068859_100016631 3300005617 Bacteria 7385
109 Ga0068864_100013228 3300005618 Bacteria 6834
110 Ga0068864_100203953 3300005618 Bacteria 1818
111 Ga0068864_100291521 3300005618 Bacteria 1525
112 Ga0068863_100119812 3300005841 Bacteria 2508
113 Ga0068858_100077254 3300005842 Bacteria 3093
114 Ga0068858_100171684 3300005842 Bacteria 2044
115 Ga0068860_100076616 3300005843 Bacteria 3181
116 Ga0068862_100100614 3300005844 Bacteria 2528
117 Ga0081538_10062208 3300005981 Bacteria 2131
118 Ga0081539_10001542 3300005985 Bacteria 38504
119 Ga0081539_10010440 3300005985 Bacteria 7543
120 Ga0075365_10063014 3300006038 Bacteria 2481
121 Ga0097621_100213102 3300006237 Bacteria 1681
122 Ga0075428_100001431 3300006844 Bacteria 25463
123 Ga0075431_100404587 3300006847 Bacteria 1366
124 Ga0075433_10029292 3300006852 Bacteria 4689
125 Ga0075434_100043329 3300006871 Bacteria 4463
126 Ga0075434_100117919 3300006871 Bacteria 2668
127 Ga0075434_100202396 3300006871 Bacteria 2006
128 Ga0075434_100396052 3300006871 Bacteria 1402
129 Ga0075429_100113383 3300006880 Bacteria 2370
130 Ga0068865_100002642 3300006881 Bacteria 10646
131 Ga0075436_100090235 3300006914 Bacteria 2130
132 Ga0097620_100016631 3300006931 Bacteria 7385
133 Ga0075435_100036205 3300007076 Bacteria 3920
134 Ga0075435_100086220 3300007076 Bacteria 2585
135 Ga0075435_100200970 3300007076 Bacteria 1689
136 Ga0105240_10889915 3300009093 Unclassified 958
137 Ga0111539_10023130 3300009094 Bacteria 7632
138 Ga0111539_10115650 3300009094 Bacteria 3145
139 Ga0111539_10187579 3300009094 Bacteria 2414
140 Ga0111539_10284099 3300009094 Bacteria 1926
141 Ga0105245_10017767 3300009098 Bacteria 6207
142 Ga0105245_10045595 3300009098 Bacteria 3916
143 Ga0105245_10161301 3300009098 Bacteria 2128
144 Ga0105245_10193254 3300009098 Bacteria 1951
145 Ga0105245_10220791 3300009098 Bacteria 1829
146 Ga0105245_10272141 3300009098 Bacteria 1652
147 Ga0114129_10001927 3300009147 Bacteria 28355
148 Ga0114129_10120845 3300009147 Bacteria 3606
149 Ga0114129_10300038 3300009147 Bacteria 2141
150 Ga0114129_10916650 3300009147 Unclassified 1109
151 Ga0105243_10138585 3300009148 Bacteria 2072
152 Ga0105241_10617888 3300009174 Unclassified 981
153 Ga0105242_10349974 3300009176 Bacteria 1364
154 Ga0105238_10291496 3300009551 Bacteria 1614
155 Ga0105238_10620946 3300009551 Unclassified 1090
156 Ga0105249_10003799 3300009553 Bacteria 13037
157 Ga0105249_10006188 3300009553 Bacteria 10388
158 Ga0105249_10309429 3300009553 Bacteria 1587
159 Ga0105249_10338791 3300009553 Unclassified 1520
160 Ga0105249_10371929 3300009553 Bacteria 1453
161 Ga0105239_10008935 3300010375 Bacteria 11337
162 Ga0105239_10393240 3300010375 Bacteria 1568
163 Ga0105239_10536144 3300010375 Bacteria 1332
164 Ga0105246_10018380 3300011119 Bacteria 4455
165 Ga0157370_10298370 3300013104 Bacteria 1488
166 Ga0157378_10007754 3300013297 Bacteria 9368
167 Ga0163162_10027318 3300013306 Bacteria 5643
168 Ga0157375_10005661 3300013308 Bacteria 10873
169 Ga0157375_10047571 3300013308 Unclassified 4190
170 Ga0157375_10092124 3300013308 Bacteria 3094
171 Ga0157375_10201767 3300013308 Bacteria 2145
172 Ga0163163_10019106 3300014325 Bacteria 6430
173 Ga0163163_10105718 3300014325 Bacteria 2841
174 Ga0163163_10154082 3300014325 Bacteria 2342
175 Ga0157380_10073712 3300014326 Bacteria 2769
176 Ga0157380_10085417 3300014326 Bacteria 2590
177 Ga0157380_10166958 3300014326 Bacteria 1919
178 Ga0157380_10317383 3300014326 Bacteria 1443
179 Ga0157380_10725911 3300014326 Bacteria 1002
180 Ga0157377_10012849 3300014745 Bacteria 4221
181 Ga0157377_10171437 3300014745 Bacteria 1357
182 Ga0157379_10003281 3300014968 Bacteria 13708
183 Ga0157379_10059146 3300014968 Bacteria 3427
184 Ga0157376_10285737 3300014969 Bacteria 1556
185 Ga0157376_10541268 3300014969 Unclassified 1151
186 Ga0163161_10122743 3300017792 Bacteria 1953
187 Ga0207688_10060777 3300025901 Bacteria 2129
188 Ga0207688_10339473 3300025901 Unclassified 924
189 Ga0207680_10064308 3300025903 Bacteria 2249
190 Ga0207647_10130267 3300025904 Bacteria 1479
191 Ga0207643_10091003 3300025908 Bacteria 1779
192 Ga0207684_10002777 3300025910 Bacteria 17441
193 Ga0207684_10047176 3300025910 Bacteria 3654
194 Ga0207684_10076684 3300025910 Bacteria 2841
195 Ga0207684_10298430 3300025910 Bacteria 1389
196 Ga0207684_10308353 3300025910 Bacteria 1364
197 Ga0207684_10464623 3300025910 Bacteria 1086
198 Ga0207707_10171357 3300025912 Bacteria 1897
199 Ga0207660_10000001 3300025917 Bacteria 1034169
200 Ga0207662_10001585 3300025918 Bacteria 11136
201 Ga0207662_10044556 3300025918 Bacteria 2619
202 Ga0207662_10091867 3300025918 Bacteria 1868
203 Ga0207657_10506554 3300025919 Bacteria 945
204 Ga0207649_10057009 3300025920 Bacteria 2441
205 Ga0207649_10108752 3300025920 Bacteria 1848
206 Ga0207646_10012780 3300025922 Bacteria 8053
207 Ga0207646_10020121 3300025922 Bacteria 6190
208 Ga0207646_10029282 3300025922 Bacteria 5006
209 Ga0207646_10051186 3300025922 Bacteria 3695
210 Ga0207646_10086914 3300025922 Bacteria 2798
211 Ga0207646_10134412 3300025922 Bacteria 2227
212 Ga0207646_10198401 3300025922 Bacteria 1812
213 Ga0207646_10554570 3300025922 Bacteria 1033
214 Ga0207681_10202501 3300025923 Unclassified 1525
215 Ga0207681_10536398 3300025923 Bacteria 962
216 Ga0207694_10214993 3300025924 Unclassified 1567
217 Ga0207659_10302084 3300025926 Unclassified 1315
218 Ga0207687_10041554 3300025927 Bacteria 3158
219 Ga0207687_10078367 3300025927 Bacteria 2379
220 Ga0207687_10194249 3300025927 Bacteria 1582
221 Ga0207690_10156368 3300025932 Bacteria 1695
222 Ga0207690_10276268 3300025932 Unclassified 1307
223 Ga0207706_10011810 3300025933 Bacteria 7954
224 Ga0207706_10026181 3300025933 Bacteria 5221
225 Ga0207706_10030391 3300025933 Bacteria 4819
226 Ga0207686_10190055 3300025934 Bacteria 1463
227 Ga0207686_10266981 3300025934 Unclassified 1257
228 Ga0207686_10480635 3300025934 Bacteria 961
229 Ga0207709_10041589 3300025935 Bacteria 2759
230 Ga0207669_10033212 3300025937 Bacteria 2909
231 Ga0207669_10252815 3300025937 Unclassified 1313
232 Ga0207704_10060091 3300025938 Bacteria 2350
233 Ga0207704_10593219 3300025938 Bacteria 906
234 Ga0207704_10642351 3300025938 Unclassified 873
235 Ga0207691_10034318 3300025940 Bacteria 4718
236 Ga0207691_10301640 3300025940 Bacteria 1376
237 Ga0207689_10062464 3300025942 Bacteria 3063
238 Ga0207689_10314800 3300025942 Unclassified 1298
239 Ga0207661_10252469 3300025944 Bacteria 1568
240 Ga0207661_10410440 3300025944 Bacteria 1229
241 Ga0207712_10066214 3300025961 Bacteria 2582
242 Ga0207712_10311563 3300025961 Bacteria 1295
243 Ga0207640_10027133 3300025981 Bacteria 3487
244 Ga0207640_10086161 3300025981 Unclassified 2162
245 Ga0207640_10093219 3300025981 Bacteria 2092
246 Ga0207677_10353079 3300026023 Bacteria 1233
247 Ga0207703_10122172 3300026035 Bacteria 2237
248 Ga0207703_10245480 3300026035 Bacteria 1611
249 Ga0207703_10487936 3300026035 Unclassified 1155
250 Ga0207678_10009395 3300026067 Bacteria 8605
251 Ga0207708_10078104 3300026075 Bacteria 2541
252 Ga0207641_10091967 3300026088 Bacteria 2656
253 Ga0207641_10485717 3300026088 Bacteria 1198
254 Ga0207648_10006662 3300026089 Bacteria 11462
255 Ga0207648_10321833 3300026089 Bacteria 1390
256 Ga0207676_10024517 3300026095 Bacteria 4465
257 Ga0207676_10225323 3300026095 Bacteria 1672
258 Ga0207676_10771583 3300026095 Unclassified 936
259 Ga0207674_10015875 3300026116 Bacteria 8254
260 Ga0207674_10158689 3300026116 Bacteria 2217
261 Ga0207674_10282681 3300026116 Bacteria 1607
262 Ga0207674_10364916 3300026116 Bacteria 1396
263 Ga0207675_100045200 3300026118 Bacteria 4114
264 Ga0207683_10418699 3300026121 Bacteria 1234
265 Ga0207698_10040314 3300026142 Bacteria 3469
266 Ga0207698_10402072 3300026142 Bacteria 1309
267 Ga0207698_10680650 3300026142 Unclassified 1022
268 Ga0209996_1017199 3300027395 Unclassified 998
269 Ga0210002_1005939 3300027617 Unclassified 1834
270 Ga0209983_1038656 3300027665 Bacteria 1030
271 Ga0209966_1003475 3300027695 Bacteria 2649
272 Ga0209998_10000182 3300027717 Bacteria 22489
273 Ga0209974_10000654 3300027876 Bacteria 11736
274 Ga0209974_10012736 3300027876 Bacteria 2809
275 Ga0207428_10046684 3300027907 Bacteria 3483
276 Ga0207428_10192501 3300027907 Bacteria 1537
277 Ga0207428_10249497 3300027907 Unclassified 1324
278 Ga0268265_10265157 3300028380 Unclassified 1529
279 Ga0268264_10094957 3300028381 Bacteria 2579
280 Ga0268264_10153035 3300028381 Bacteria 2070
281 Ga0265319_1010271 3300028563 Bacteria 3916
282 Ga0265319_1021062 3300028563 Bacteria 2400
283 Ga0265319_1049563 3300028563 Bacteria 1390
284 Ga0265334_10011149 3300028573 Bacteria 3789
285 Ga0265318_10011730 3300028577 Bacteria 3757
286 Ga0265318_10034005 3300028577 Bacteria 1966
287 Ga0265338_10060695 3300028800 Bacteria 3319
288 Ga0265324_10020810 3300029957 Bacteria 2356
289 Ga0265332_10034713 3300031238 Bacteria 2191
290 Ga0265320_10014863 3300031240 Bacteria 4415
291 Ga0265320_10118705 3300031240 Bacteria 1207
292 Ga0265329_10065390 3300031242 Bacteria 1151
293 Ga0265340_10024626 3300031247 Bacteria 3055
294 Ga0265339_10071237 3300031249 Bacteria 1852
295 Ga0265331_10014915 3300031250 Bacteria 4122
296 Ga0316579_10093868 3300031691 Bacteria 1434
297 Ga0265314_10013518 3300031711 Bacteria 6591
298 Ga0265314_10069632 3300031711 Bacteria 2360
299 Ga0316576_10020094 3300031727 Bacteria 4587
300 Ga0316576_10098599 3300031727 Bacteria 2182
301 Ga0307413_10412664 3300031824 Bacteria 1061
302 Ga0307406_10093846 3300031901 Bacteria 2027
303 Ga0307407_10263559 3300031903 Bacteria 1186
304 Ga0307407_10330779 3300031903 Unclassified 1072
305 Ga0307409_100090344 3300031995 Bacteria 2507
306 Ga0307416_100114695 3300032002 Bacteria 2384
307 Ga0307416_100593909 3300032002 Bacteria 1186
308 Ga0307416_100615347 3300032002 Unclassified 1167
309 Ga0307416_100737253 3300032002 Unclassified 1077
310 Ga0307411_10204593 3300032005 Unclassified 1519
311 Ga0307411_10385513 3300032005 Bacteria 1154
312 Ga0373941_0024803 3300035115 Bacteria 1726
313 Ga0373945_0024095 3300035116 Bacteria 2107
314 Ga0373946_0163142 3300035171 Unclassified 1048
315 Ga0316574_0092051 3300035398 Bacteria 1934
316 Ga0395901_0267057 3300038443 Unclassified 1780
317 Ga0242420_036095 3300038996 Bacteria 932
318 Ga0436365_1218605 3300039437 Bacteria 1839
319 Ga0451849_0254358 3300041505 Unclassified 1028
320 Ga0450923_000231 3300042125 Bacteria 5456
321 Ga0439446_0020691 3300042156 Bacteria 1855
322 Ga0439435_0034706 3300042436 Unclassified 1388
323 Ga0451577_0101128 3300042876 Bacteria 2576
324 Ga0451577_0668365 3300042876 Bacteria 942
325 Ga0453683_0170386 3300044673 Bacteria 1379
326 Ga0453683_0201242 3300044673 Bacteria 1264
327 Ga0453684_0514733 3300044712 Bacteria 1323
328 Ga0451576_0097501 3300045051 Bacteria 3057
329 Ga0451576_0310143 3300045051 Bacteria 1651
330 Ga0495603_0211939 3300046455 Unclassified 1119
331 Ga0495603_0323138 3300046455 Bacteria 886
332 Ga0495651_0013602 3300046462 Bacteria 6291
333 Ga0495653_0306090 3300046463 Unclassified 1035
334 Ga0495630_0270151 3300046517 Unclassified 1299
335 Ga0495630_0324415 3300046517 Bacteria 1177
336 Ga0495630_0388038 3300046517 Bacteria 1070
337 Ga0495666_0238512 3300046526 Unclassified 830
338 Ga0495656_0199133 3300046615 Bacteria 993
339 Ga0495634_0187303 3300046642 Bacteria 1293
340 Ga0495599_0132043 3300046678 Bacteria 1551
341 Ga0495674_0283949 3300047319 Bacteria 1355
342 Ga0495680_0334995 3300047322 Unclassified 1056
343 Ga0495614_0082506 3300048089 Bacteria 1394
344 Ga0496100_0016718 3300048903 Bacteria 4315
345 Ga0496100_0540583 3300048903 Bacteria 901
346 Ga0496101_0063571 3300048904 Bacteria 2687
347 Ga0496101_0097403 3300048904 Bacteria 2196
348 Ga0496102_0116459 3300048905 Bacteria 2494
349 Ga0496102_0121760 3300048905 Bacteria 2437
350 Ga0496102_0233438 3300048905 Unclassified 1734
351 Ga0496102_0329716 3300048905 Bacteria 1438
352 Ga0496102_0476900 3300048905 Bacteria 1169
353 Ga0496103_0202164 3300048906 Bacteria 1278
354 Ga0496104_0019594 3300048907 Bacteria 6193
355 Ga0496104_0020780 3300048907 Bacteria 6021
356 Ga0496104_0036957 3300048907 Bacteria 4566
357 Ga0496104_0202353 3300048907 Bacteria 1898
358 Ga0496104_0375810 3300048907 Bacteria 1334
359 Ga0496105_0005031 3300048908 Bacteria 10010
360 Ga0496105_0012440 3300048908 Bacteria 6737
361 Ga0496105_0118565 3300048908 Bacteria 2183
362 Ga0496106_0052499 3300048909 Unclassified 3076
363 Ga0496106_0158084 3300048909 Bacteria 1791
364 Ga0496108_0014782 3300048911 Bacteria 6371
365 Ga0496108_0015157 3300048911 Bacteria 6289
366 Ga0496108_0057968 3300048911 Bacteria 3254
367 Ga0496108_0072104 3300048911 Bacteria 2915
368 Ga0496108_0086005 3300048911 Bacteria 2669
369 Ga0496108_0088059 3300048911 Bacteria 2638
370 Ga0496108_0141984 3300048911 Bacteria 2069
371 Ga0496108_0151902 3300048911 Bacteria 1998
372 Ga0496109_0050519 3300048912 Bacteria 3787
373 Ga0496109_0079213 3300048912 Bacteria 3026
374 Ga0496109_0093938 3300048912 Bacteria 2776
375 Ga0496109_0138039 3300048912 Bacteria 2279
376 Ga0496109_0259903 3300048912 Bacteria 1635
377 Ga0496110_0022081 3300048913 Bacteria 5398
378 Ga0496110_0036889 3300048913 Bacteria 4247
379 Ga0496110_0669511 3300048913 Bacteria 938
380 Ga0496111_0169123 3300048914 Bacteria 1624
381 Ga0496111_0232523 3300048914 Unclassified 1369
382 Ga0496112_0000005 3300048915 Bacteria 525541
383 Ga0496112_0006041 3300048915 Bacteria 10571
384 Ga0496112_0156371 3300048915 Bacteria 2247
385 Ga0496112_0208026 3300048915 Bacteria 1914
386 Ga0496112_0362270 3300048915 Bacteria 1392
387 Ga0496113_0089924 3300048916 Bacteria 2364
388 Ga0496113_0264019 3300048916 Bacteria 1375
389 Ga0496114_0049304 3300048917 Bacteria 3503
390 Ga0496114_0084279 3300048917 Bacteria 2691
391 Ga0496114_0158952 3300048917 Archaea 1964
392 Ga0496114_0163027 3300048917 Bacteria 1940
393 Ga0501031_0005495 3300049568 Bacteria 8249
394 Ga0501036_0042607 3300049572 Bacteria 3843
395 Ga0501036_0056368 3300049572 Bacteria 3329
396 Ga0501036_0120250 3300049572 Bacteria 2218
397 Ga0501036_0523935 3300049572 Unclassified 986
398 Ga0501037_0040262 3300049573 Bacteria 3439
399 Ga0501037_0058045 3300049573 Bacteria 2825
400 Ga0501037_0120628 3300049573 Bacteria 1886
401 Ga0501037_0125019 3300049573 Bacteria 1847
402 Ga0501038_0014112 3300049574 Bacteria 7278
403 Ga0501038_0079264 3300049574 Bacteria 2770
404 Ga0501038_0310519 3300049574 Bacteria 1236
405 Ga0501039_0063373 3300049575 Bacteria 2864
406 Ga0501039_0173686 3300049575 Bacteria 1694
407 Ga0501039_0203782 3300049575 Bacteria 1555
408 Ga0501040_0003187 3300049576 Bacteria 10620
409 Ga0501040_0026966 3300049576 Bacteria 3865
410 Ga0501040_0127234 3300049576 Unclassified 1790
411 Ga0501041_0002687 3300049577 Bacteria 10140
412 Ga0501041_0014885 3300049577 Bacteria 4618
413 Ga0501041_0123698 3300049577 Bacteria 1609
414 Ga0501041_0343748 3300049577 Bacteria 942
415 Ga0501042_0008913 3300049578 Bacteria 6655
416 Ga0501042_0026404 3300049578 Bacteria 4080
417 Ga0501042_0159100 3300049578 Bacteria 1629
418 Ga0501042_0220586 3300049578 Bacteria 1368
419 Ga0501042_0323651 3300049578 Bacteria 1114
420 Ga0501046_0231435 3300049580 Bacteria 1365
421 Ga0501048_0022981 3300049582 Bacteria 4557
422 Ga0501048_0050053 3300049582 Bacteria 2976
423 Ga0501048_0069050 3300049582 Bacteria 2496
424 Ga0501048_0094411 3300049582 Bacteria 2110
425 Ga0501048_0179220 3300049582 Bacteria 1502
426 Ga0501048_0212692 3300049582 Bacteria 1371
427 Ga0501067_0026746 3300049583 Bacteria 3194
428 Ga0501067_0068366 3300049583 Bacteria 1967
429 Ga0501067_0138531 3300049583 Bacteria 1355
430 Ga0501068_0010099 3300049584 Bacteria 5298
431 Ga0501068_0049541 3300049584 Bacteria 2537
432 Ga0501068_0056034 3300049584 Bacteria 2389
433 Ga0501068_0118211 3300049584 Bacteria 1652
434 Ga0501068_0135195 3300049584 Bacteria 1543
435 Ga0501068_0242421 3300049584 Bacteria 1147
436 Ga0501069_0010045 3300049585 Bacteria 5005
437 Ga0501069_0279950 3300049585 Bacteria 976
438 Ga0501069_0312320 3300049585 Unclassified 923
439 Ga0501070_0130102 3300049586 Bacteria 2080
440 Ga0501070_0137162 3300049586 Bacteria 2020
441 Ga0501070_0189135 3300049586 Bacteria 1693
442 Ga0501070_0399432 3300049586 Bacteria 1112
443 Ga0501071_0001192 3300049587 Bacteria 14666
444 Ga0501071_0012313 3300049587 Bacteria 5797
445 Ga0501071_0014682 3300049587 Bacteria 5360
446 Ga0501071_0077615 3300049587 Bacteria 2426
447 Ga0501071_0432392 3300049587 Bacteria 1006
448 Ga0501072_0003818 3300049588 Bacteria 11375
449 Ga0501072_0019864 3300049588 Bacteria 5199
450 Ga0501072_0067930 3300049588 Bacteria 2813
451 Ga0501072_0082427 3300049588 Bacteria 2550
452 Ga0501072_0193314 3300049588 Bacteria 1623
453 Ga0501072_0227937 3300049588 Bacteria 1484
454 Ga0501072_0261825 3300049588 Unclassified 1376
455 Ga0501073_0033971 3300049589 Bacteria 3631
456 Ga0501073_0357894 3300049589 Bacteria 1008
457 Ga0501074_0001051 3300049590 Bacteria 18010
458 Ga0501074_0005907 3300049590 Bacteria 8825
459 Ga0501074_0045754 3300049590 Bacteria 3165
460 Ga0501074_0087653 3300049590 Bacteria 2229
461 Ga0501074_0148302 3300049590 Bacteria 1678
462 Ga0501075_0039849 3300049591 Bacteria 3516
463 Ga0501075_0063060 3300049591 Bacteria 2794
464 Ga0501075_0077367 3300049591 Bacteria 2518
465 Ga0501075_0082892 3300049591 Bacteria 2429
466 Ga0501075_0168691 3300049591 Bacteria 1670
467 Ga0501075_0335794 3300049591 Bacteria 1152
468 Ga0501076_0010626 3300049592 Bacteria 6837
469 Ga0501076_0020040 3300049592 Bacteria 5115
470 Ga0501076_0029040 3300049592 Bacteria 4298
471 Ga0501076_0069502 3300049592 Bacteria 2814
472 Ga0501076_0342916 3300049592 Bacteria 1226
473 Ga0501077_0028611 3300049593 Bacteria 3542
474 Ga0501077_0045291 3300049593 Bacteria 2795
475 Ga0501077_0130811 3300049593 Unclassified 1591
476 Ga0501077_0206200 3300049593 Bacteria 1249
477 Ga0501077_0216269 3300049593 Bacteria 1218
478 Ga0501079_0008785 3300049741 Bacteria 7656
479 Ga0501079_0024705 3300049741 Bacteria 4611
480 Ga0501079_0079087 3300049741 Bacteria 2543
481 Ga0501079_0090588 3300049741 Bacteria 2369
482 Ga0501079_0113760 3300049741 Bacteria 2104
483 Ga0501079_0229730 3300049741 Bacteria 1449
484 Ga0501079_0537467 3300049741 Bacteria 919
485 Ga0501080_0003897 3300049742 Bacteria 13211
486 Ga0501080_0041780 3300049742 Bacteria 4271
487 Ga0501080_0209826 3300049742 Bacteria 1785
488 Ga0501080_0224085 3300049742 Bacteria 1720
489 Ga0501080_0595862 3300049742 Bacteria 981
490 Ga0501081_0002834 3300049743 Bacteria 11004
491 Ga0501081_0029031 3300049743 Bacteria 3735
492 Ga0501081_0133087 3300049743 Unclassified 1778
493 Ga0501081_0174013 3300049743 Bacteria 1555
494 Ga0501081_0245560 3300049743 Bacteria 1306
495 Ga0501081_0254524 3300049743 Bacteria 1282
496 Ga0501083_0061617 3300049744 Bacteria 2504
497 Ga0501083_0307261 3300049744 Bacteria 1031
498 Ga0501035_0013981 3300049822 Bacteria 7405
499 Ga0501035_0151017 3300049822 Bacteria 2016
500 Ga0501044_0140098 3300049823 Bacteria 2408
501 Ga0501045_0006443 3300049824 Bacteria 8133
502 Ga0501045_0009006 3300049824 Bacteria 6972
503 Ga0501045_0042408 3300049824 Bacteria 3311
504 Ga0501045_0191833 3300049824 Bacteria 1523
505 nmdc:mga05p37_106915_c1 3300050507 Bacteria 3442
506 nmdc:mga05p37_851_c1 3300050507 Bacteria 34350
507 nmdc:mga09592_39689_c1 3300050508 Bacteria 3954
508 nmdc:mga06r32_123746_c1 3300050510 Bacteria 2552
509 nmdc:mga08y16_320701_c1 3300050511 Bacteria 1595
510 nmdc:mga08y16_95809_c1 3300050511 Bacteria 3091
511 nmdc:mga0n895_127759_c1 3300050512 Bacteria 2566
512 nmdc:mga0n895_375981_c1 3300050512 Unclassified 1438
513 nmdc:mga0n895_52718_c1 3300050512 Bacteria 3994
514 nmdc:mga0rr50_143392_c1 3300050513 Bacteria 1924
515 nmdc:mga0rr50_69214_c1 3300050513 Bacteria 2685
516 nmdc:mga08x19_124897_c1 3300050514 Bacteria 1727
517 nmdc:mga0a205_29611_c1 3300050515 Bacteria 5240
518 nmdc:mga0a205_45468_c2 3300050515 Bacteria 3599
519 Ga0495601_0034482 3300053077 Bacteria 3158
520 Ga0495601_0053947 3300053077 Bacteria 2542
521 Ga0495612_0003231 3300053078 Bacteria 6758
522 Ga0495612_0112032 3300053078 Bacteria 1169
523 Ga0495595_0052246 3300053084 Bacteria 1896
524 Ga0495619_0149102 3300053085 Bacteria 1613
525 Ga0501084_0009045 3300054114 Bacteria 8241
526 Ga0501084_0022205 3300054114 Bacteria 5296
527 Ga0501084_0062925 3300054114 Bacteria 3106
528 Ga0501084_0185549 3300054114 Bacteria 1755
529 Ga0501084_0237035 3300054114 Bacteria 1540
530 Ga0501084_0248918 3300054114 Bacteria 1500
531 Ga0501084_0250584 3300054114 Unclassified 1495
532 Ga0590071_022826 3300059421 Unclassified 1477
533 Ga0590077_007375 3300059426 Bacteria 2250
534 Ga0501082_0007255 3300060353 Bacteria 9561
535 Ga0501082_0013163 3300060353 Bacteria 7113
536 Ga0501082_0122903 3300060353 Bacteria 2251
537 Ga0501082_0217589 3300060353 Bacteria 1662
538 Ga0530510_0008218 3300061734 Bacteria 7279
539 Ga0530510_0029656 3300061734 Bacteria 3927
540 Ga0530510_0051365 3300061734 Bacteria 2979
541 Ga0530510_0105664 3300061734 Bacteria 2061
542 Ga0530510_0484030 3300061734 Bacteria 937
543 Ga0395901_0429474
544 rootH1_10033475
545 rootH2_10185188
546 rootL2_10012610
547 rootH1_10180577
548 JGI26129J50193_1000961
549 Ga0065707_10016749
550 Ga0065707_10099636
551 Ga0070683_100336709
552 Ga0070670_100430368
553 Ga0070666_10159594
554 Ga0070680_100000018
555 Ga0070680_100219483
556 Ga0070682_100140659
557 Ga0068868_100099007
558 Ga0070689_100004080
559 Ga0070691_10070558
560 Ga0070691_10184487
561 Ga0070687_100119324
562 Ga0070661_100582892
563 Ga0070668_100112818
564 Ga0070675_100259266
565 Ga0070671_100416030
566 Ga0070674_100006330
567 Ga0070674_100049109
568 Ga0070688_100164773
569 Ga0070659_100017304
570 Ga0070701_10088674
571 Ga0070701_10216691
572 Ga0070705_100005937
573 Ga0070705_100007457
574 Ga0070700_100053407
575 Ga0070700_100101083
576 Ga0070694_100198074
577 Ga0070694_100225708
578 Ga0070708_100014485
579 Ga0070708_100070824
580 Ga0070663_100036166
581 Ga0070678_100173811
582 Ga0070678_100199697
583 Ga0070662_100010425
584 Ga0070662_100011301
585 Ga0070681_10161023
586 Ga0068867_100013600
587 Ga0070685_10006448
588 Ga0070706_100002794
589 Ga0070706_100104674
590 Ga0070706_100122741
591 Ga0070706_100179845
592 Ga0070707_100004371
593 Ga0070707_100029008
594 Ga0070707_100064557
595 Ga0070707_100249077
596 Ga0070707_100375972
597 Ga0070707_100415527
598 Ga0070698_100002355
599 Ga0070698_100013941
600 Ga0070698_100136735
601 Ga0070698_100150901
602 Ga0070698_100267916
603 Ga0070698_100429136
604 Ga0070699_100000748
605 Ga0070699_100123646
606 Ga0070699_100201760
607 Ga0070699_100322838
608 Ga0070699_100339146
609 Ga0070679_100090548
610 Ga0070679_100460179
611 Ga0070684_100005556
612 Ga0070684_100123325
613 Ga0070684_100220504
614 Ga0070684_100572507
615 Ga0070697_100007331
616 Ga0070697_100008530
617 Ga0070697_100037192
618 Ga0070697_100045855
619 Ga0070697_100050973
620 Ga0070697_100116930
621 Ga0070697_100228502
622 Ga0068853_100146092
623 Ga0070672_100022690
624 Ga0070672_100241378
625 Ga0070686_100014407
626 Ga0070686_100086765
627 Ga0070686_100160789
628 Ga0070695_100008532
629 Ga0070695_100020661
630 Ga0070695_100337773
631 Ga0070695_100367677
632 Ga0070695_100501623
633 Ga0070696_100000741
634 Ga0070696_100005510
635 Ga0070696_100012623
636 Ga0070696_100035692
637 Ga0070696_100044658
638 Ga0070696_100175111
639 Ga0070693_100016448
640 Ga0070704_100095406
641 Ga0070704_100124024
642 Ga0070704_100312396
643 Ga0070704_100320487
644 Ga0070664_100057903
645 Ga0068857_100412066
646 Ga0068854_100546704
647 Ga0070702_100004517
648 Ga0068852_100071739
649 Ga0068852_100661696
650 Ga0068859_100016631
651 Ga0068864_100013228
652 Ga0068864_100203953
653 Ga0068864_100291521
654 Ga0068863_100119812
655 Ga0068858_100077254
656 Ga0068858_100171684
657 Ga0068860_100076616
658 Ga0068862_100100614
659 Ga0081538_10062208
660 Ga0081539_10001542
661 Ga0081539_10010440
662 Ga0075365_10063014
663 Ga0097621_100213102
664 Ga0075428_100001431
665 Ga0075431_100404587
666 Ga0075433_10029292
667 Ga0075434_100043329
668 Ga0075434_100117919
669 Ga0075434_100202396
670 Ga0075434_100396052
671 Ga0075429_100113383
672 Ga0068865_100002642
673 Ga0075436_100090235
674 Ga0097620_100016631
675 Ga0075435_100036205
676 Ga0075435_100086220
677 Ga0075435_100200970
678 Ga0105240_10889915
679 Ga0111539_10023130
680 Ga0111539_10115650
681 Ga0111539_10187579
682 Ga0111539_10284099
683 Ga0105245_10017767
684 Ga0105245_10045595
685 Ga0105245_10161301
686 Ga0105245_10193254
687 Ga0105245_10220791
688 Ga0105245_10272141
689 Ga0114129_10001927
690 Ga0114129_10120845
691 Ga0114129_10300038
692 Ga0114129_10916650
693 Ga0105243_10138585
694 Ga0105241_10617888
695 Ga0105242_10349974
696 Ga0105238_10291496
697 Ga0105238_10620946
698 Ga0105249_10003799
699 Ga0105249_10006188
700 Ga0105249_10309429
701 Ga0105249_10338791
702 Ga0105249_10371929
703 Ga0105239_10008935
704 Ga0105239_10393240
705 Ga0105239_10536144
706 Ga0105246_10018380
707 Ga0157370_10298370
708 Ga0157378_10007754
709 Ga0163162_10027318
710 Ga0157375_10005661
711 Ga0157375_10047571
712 Ga0157375_10092124
713 Ga0157375_10201767
714 Ga0163163_10019106
715 Ga0163163_10105718
716 Ga0163163_10154082
717 Ga0157380_10073712
718 Ga0157380_10085417
719 Ga0157380_10166958
720 Ga0157380_10317383
721 Ga0157380_10725911
722 Ga0157377_10012849
723 Ga0157377_10171437
724 Ga0157379_10003281
725 Ga0157379_10059146
726 Ga0157376_10285737
727 Ga0157376_10541268
728 Ga0163161_10122743
729 Ga0207688_10060777
730 Ga0207688_10339473
731 Ga0207680_10064308
732 Ga0207647_10130267
733 Ga0207643_10091003
734 Ga0207684_10002777
735 Ga0207684_10047176
736 Ga0207684_10076684
737 Ga0207684_10298430
738 Ga0207684_10308353
739 Ga0207684_10464623
740 Ga0207707_10171357
741 Ga0207660_10000001
742 Ga0207662_10001585
743 Ga0207662_10044556
744 Ga0207662_10091867
745 Ga0207657_10506554
746 Ga0207649_10057009
747 Ga0207649_10108752
748 Ga0207646_10012780
749 Ga0207646_10020121
750 Ga0207646_10029282
751 Ga0207646_10051186
752 Ga0207646_10086914
753 Ga0207646_10134412
754 Ga0207646_10198401
755 Ga0207646_10554570
756 Ga0207681_10202501
757 Ga0207681_10536398
758 Ga0207694_10214993
759 Ga0207659_10302084
760 Ga0207687_10041554
761 Ga0207687_10078367
762 Ga0207687_10194249
763 Ga0207690_10156368
764 Ga0207690_10276268
765 Ga0207706_10011810
766 Ga0207706_10026181
767 Ga0207706_10030391
768 Ga0207686_10190055
769 Ga0207686_10266981
770 Ga0207686_10480635
771 Ga0207709_10041589
772 Ga0207669_10033212
773 Ga0207669_10252815
774 Ga0207704_10060091
775 Ga0207704_10593219
776 Ga0207704_10642351
777 Ga0207691_10034318
778 Ga0207691_10301640
779 Ga0207689_10062464
780 Ga0207689_10314800
781 Ga0207661_10252469
782 Ga0207661_10410440
783 Ga0207712_10066214
784 Ga0207712_10311563
785 Ga0207640_10027133
786 Ga0207640_10086161
787 Ga0207640_10093219
788 Ga0207677_10353079
789 Ga0207703_10122172
790 Ga0207703_10245480
791 Ga0207703_10487936
792 Ga0207678_10009395
793 Ga0207708_10078104
794 Ga0207641_10091967
795 Ga0207641_10485717
796 Ga0207648_10006662
797 Ga0207648_10321833
798 Ga0207676_10024517
799 Ga0207676_10225323
800 Ga0207676_10771583
801 Ga0207674_10015875
802 Ga0207674_10158689
803 Ga0207674_10282681
804 Ga0207674_10364916
805 Ga0207675_100045200
806 Ga0207683_10418699
807 Ga0207698_10040314
808 Ga0207698_10402072
809 Ga0207698_10680650
810 Ga0209996_1017199
811 Ga0210002_1005939
812 Ga0209983_1038656
813 Ga0209966_1003475
814 Ga0209998_10000182
815 Ga0209974_10000654
816 Ga0209974_10012736
817 Ga0207428_10046684
818 Ga0207428_10192501
819 Ga0207428_10249497
820 Ga0268265_10265157
821 Ga0268264_10094957
822 Ga0268264_10153035
823 Ga0265319_1010271
824 Ga0265319_1021062
825 Ga0265319_1049563
826 Ga0265334_10011149
827 Ga0265318_10011730
828 Ga0265318_10034005
829 Ga0265338_10060695
830 Ga0265324_10020810
831 Ga0265332_10034713
832 Ga0265320_10014863
833 Ga0265320_10118705
834 Ga0265329_10065390
835 Ga0265340_10024626
836 Ga0265339_10071237
837 Ga0265331_10014915
838 Ga0316579_10093868
839 Ga0265314_10013518
840 Ga0265314_10069632
841 Ga0316576_10020094
842 Ga0316576_10098599
843 Ga0307413_10412664
844 Ga0307406_10093846
845 Ga0307407_10263559
846 Ga0307407_10330779
847 Ga0307409_100090344
848 Ga0307416_100114695
849 Ga0307416_100593909
850 Ga0307416_100615347
851 Ga0307416_100737253
852 Ga0307411_10204593
853 Ga0307411_10385513
854 Ga0373941_0024803
855 Ga0373945_0024095
856 Ga0373946_0163142
857 Ga0316574_0092051
858 Ga0395901_0267057
859 Ga0242420_036095
860 Ga0436365_1218605
861 Ga0451849_0254358
862 Ga0450923_000231
863 Ga0439446_0020691
864 Ga0439435_0034706
865 Ga0451577_0101128
866 Ga0451577_0668365
867 Ga0453683_0170386
868 Ga0453683_0201242
869 Ga0453684_0514733
870 Ga0451576_0097501
871 Ga0451576_0310143
872 Ga0495603_0211939
873 Ga0495603_0323138
874 Ga0495651_0013602
875 Ga0495653_0306090
876 Ga0495630_0270151
877 Ga0495630_0324415
878 Ga0495630_0388038
879 Ga0495666_0238512
880 Ga0495656_0199133
881 Ga0495634_0187303
882 Ga0495599_0132043
883 Ga0495674_0283949
884 Ga0495680_0334995
885 Ga0495614_0082506
886 Ga0496100_0016718
887 Ga0496100_0540583
888 Ga0496101_0063571
889 Ga0496101_0097403
890 Ga0496102_0116459
891 Ga0496102_0121760
892 Ga0496102_0233438
893 Ga0496102_0329716
894 Ga0496102_0476900
895 Ga0496103_0202164
896 Ga0496104_0019594
897 Ga0496104_0020780
898 Ga0496104_0036957
899 Ga0496104_0202353
900 Ga0496104_0375810
901 Ga0496105_0005031
902 Ga0496105_0012440
903 Ga0496105_0118565
904 Ga0496106_0052499
905 Ga0496106_0158084
906 Ga0496108_0014782
907 Ga0496108_0015157
908 Ga0496108_0057968
909 Ga0496108_0072104
910 Ga0496108_0086005
911 Ga0496108_0088059
912 Ga0496108_0141984
913 Ga0496108_0151902
914 Ga0496109_0050519
915 Ga0496109_0079213
916 Ga0496109_0093938
917 Ga0496109_0138039
918 Ga0496109_0259903
919 Ga0496110_0022081
920 Ga0496110_0036889
921 Ga0496110_0669511
922 Ga0496111_0169123
923 Ga0496111_0232523
924 Ga0496112_0000005
925 Ga0496112_0006041
926 Ga0496112_0156371
927 Ga0496112_0208026
928 Ga0496112_0362270
929 Ga0496113_0089924
930 Ga0496113_0264019
931 Ga0496114_0049304
932 Ga0496114_0084279
933 Ga0496114_0158952
934 Ga0496114_0163027
935 Ga0501031_0005495
936 Ga0501036_0042607
937 Ga0501036_0056368
938 Ga0501036_0120250
939 Ga0501036_0523935
940 Ga0501037_0040262
941 Ga0501037_0058045
942 Ga0501037_0120628
943 Ga0501037_0125019
944 Ga0501038_0014112
945 Ga0501038_0079264
946 Ga0501038_0310519
947 Ga0501039_0063373
948 Ga0501039_0173686
949 Ga0501039_0203782
950 Ga0501040_0003187
951 Ga0501040_0026966
952 Ga0501040_0127234
953 Ga0501041_0002687
954 Ga0501041_0014885
955 Ga0501041_0123698
956 Ga0501041_0343748
957 Ga0501042_0008913
958 Ga0501042_0026404
959 Ga0501042_0159100
960 Ga0501042_0220586
961 Ga0501042_0323651
962 Ga0501046_0231435
963 Ga0501048_0022981
964 Ga0501048_0050053
965 Ga0501048_0069050
966 Ga0501048_0094411
967 Ga0501048_0179220
968 Ga0501048_0212692
969 Ga0501067_0026746
970 Ga0501067_0068366
971 Ga0501067_0138531
972 Ga0501068_0010099
973 Ga0501068_0049541
974 Ga0501068_0056034
975 Ga0501068_0118211
976 Ga0501068_0135195
977 Ga0501068_0242421
978 Ga0501069_0010045
979 Ga0501069_0279950
980 Ga0501069_0312320
981 Ga0501070_0130102
982 Ga0501070_0137162
983 Ga0501070_0189135
984 Ga0501070_0399432
985 Ga0501071_0001192
986 Ga0501071_0012313
987 Ga0501071_0014682
988 Ga0501071_0077615
989 Ga0501071_0432392
990 Ga0501072_0003818
991 Ga0501072_0019864
992 Ga0501072_0067930
993 Ga0501072_0082427
994 Ga0501072_0193314
995 Ga0501072_0227937
996 Ga0501072_0261825
997 Ga0501073_0033971
998 Ga0501073_0357894
999 Ga0501074_0001051
1000 Ga0501074_0005907
1001 Ga0501074_0045754
1002 Ga0501074_0087653
1003 Ga0501074_0148302
1004 Ga0501075_0039849
1005 Ga0501075_0063060
1006 Ga0501075_0077367
1007 Ga0501075_0082892
1008 Ga0501075_0168691
1009 Ga0501075_0335794
1010 Ga0501076_0010626
1011 Ga0501076_0020040
1012 Ga0501076_0029040
1013 Ga0501076_0069502
1014 Ga0501076_0342916
1015 Ga0501077_0028611
1016 Ga0501077_0045291
1017 Ga0501077_0130811
1018 Ga0501077_0206200
1019 Ga0501077_0216269
1020 Ga0501079_0008785
1021 Ga0501079_0024705
1022 Ga0501079_0079087
1023 Ga0501079_0090588
1024 Ga0501079_0113760
1025 Ga0501079_0229730
1026 Ga0501079_0537467
1027 Ga0501080_0003897
1028 Ga0501080_0041780
1029 Ga0501080_0209826
1030 Ga0501080_0224085
1031 Ga0501080_0595862
1032 Ga0501081_0002834
1033 Ga0501081_0029031
1034 Ga0501081_0133087
1035 Ga0501081_0174013
1036 Ga0501081_0245560
1037 Ga0501081_0254524
1038 Ga0501083_0061617
1039 Ga0501083_0307261
1040 Ga0501035_0013981
1041 Ga0501035_0151017
1042 Ga0501044_0140098
1043 Ga0501045_0006443
1044 Ga0501045_0009006
1045 Ga0501045_0042408
1046 Ga0501045_0191833
1047 nmdc:mga05p37_106915_c1
1048 nmdc:mga05p37_851_c1
1049 nmdc:mga09592_39689_c1
1050 nmdc:mga06r32_123746_c1
1051 nmdc:mga08y16_320701_c1
1052 nmdc:mga08y16_95809_c1
1053 nmdc:mga0n895_127759_c1
1054 nmdc:mga0n895_375981_c1
1055 nmdc:mga0n895_52718_c1
1056 nmdc:mga0rr50_143392_c1
1057 nmdc:mga0rr50_69214_c1
1058 nmdc:mga08x19_124897_c1
1059 nmdc:mga0a205_29611_c1
1060 nmdc:mga0a205_45468_c2
1061 Ga0495601_0034482
1062 Ga0495601_0053947
1063 Ga0495612_0003231
1064 Ga0495612_0112032
1065 Ga0495595_0052246
1066 Ga0495619_0149102
1067 Ga0501084_0009045
1068 Ga0501084_0022205
1069 Ga0501084_0062925
1070 Ga0501084_0185549
1071 Ga0501084_0237035
1072 Ga0501084_0248918
1073 Ga0501084_0250584
1074 Ga0590071_022826
1075 Ga0590077_007375
1076 Ga0501082_0007255
1077 Ga0501082_0013163
1078 Ga0501082_0122903
1079 Ga0501082_0217589
1080 Ga0530510_0008218
1081 Ga0530510_0029656
1082 Ga0530510_0051365
1083 Ga0530510_0105664
1084 Ga0530510_0484030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

42

260

0.86

PF01061

ABC2_membrane

ABC-2 type transporter

23

232

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.6675 4 258
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.6616 12 257
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.661 4 258
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.6561 7 258
7roq-assembly1.cif.gz_A alternative structure of human abca1 0.6527 53 251
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8366 55 248 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7568 55 244 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6936 53 242 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6282 55 248 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5655 55 244 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A1F8Q3N1-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9589 118 266 GO:0016020
GO:0140359
AF-A0A359KP33-F1-model_v4 Transport permease protein 0.9434 141 266 GO:0005886
GO:0140359
AF-A0A7V9AXV9-F1-model_v4 Transport permease protein 0.935 131 266 GO:0043190
GO:0140359
AF-A0A1F8Q3N1-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9344 118 266 GO:0016020
GO:0140359
AF-A0A359KP33-F1-model_v4 Transport permease protein 0.9292 141 266 GO:0005886
GO:0140359

Map