F461477

General Info

Members Datasets Scaffolds Average Seq Length
542 254 1084 185

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10047469|Ga0105248_100474693
Length 206
Sequence MLCATAHQPVRFSSFKEDDVGTTWIAGVLMATALISAGRPSVAQDKGKTAAAELESSSQAALEKLTGSVQLAKLLRPKAQAILVFPTVTKAGLGIGGQYGEGSLLKNGTAAAYYKTTGASFGLQAGGQKYGYAMFFMNAKALDEFVNANGFEVGVGPSVVLVDEGMAKTTTTNTLKDDIYAFVFGQKGLMAGLGIQGNKITKITPK

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
168 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
182 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
183 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
184 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
185 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
186 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
187 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
251 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 1.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 6.46
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 14.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10047469 3300009177 Bacteria 4815
2 ARcpr5oldR_c017297 3300000041 Bacteria 632
3 ARcpr5yngRDRAFT_c010908 3300000043 Bacteria 770
4 ARSoilOldRDRAFT_c002145 3300000044 Bacteria 1775
5 JGI24752J21851_1023936 3300001976 Bacteria 800
6 JGI24743J22301_10011833 3300001991 Bacteria 1579
7 JGI24743J22301_10068912 3300001991 Unclassified 736
8 JGI24749J21850_1029110 3300002076 Bacteria 790
9 JGI24749J21850_1039370 3300002076 Unclassified 690
10 JGI24744J21845_10013883 3300002077 Unclassified 1622
11 JGI24033J26618_1004684 3300002155 Eukaryota 1483
12 JGI24034J26672_10011734 3300002239 Eukaryota 1316
13 JGI24742J22300_10021636 3300002244 Eukaryota 1099
14 Ga0058858_1389923 3300004785 Bacteria 1585
15 Ga0058859_11561597 3300004798 Bacteria 750
16 Ga0058859_11718926 3300004798 Bacteria 810
17 Ga0058859_11761540 3300004798 Bacteria 1586
18 Ga0058861_11596372 3300004800 Bacteria 1620
19 Ga0058860_10020708 3300004801 Bacteria 1739
20 Ga0065714_10247968 3300005288 Bacteria 781
21 Ga0065704_10272924 3300005289 Bacteria 939
22 Ga0065712_10000691 3300005290 Bacteria 16475
23 Ga0065712_10068422 3300005290 Bacteria 10762
24 Ga0065712_10074122 3300005290 Unclassified 4180
25 Ga0065712_10079369 3300005290 Bacteria 3225
26 Ga0065715_10000241 3300005293 Bacteria 25430
27 Ga0065715_10010985 3300005293 Unclassified 2867
28 Ga0065715_10090178 3300005293 Bacteria 7471
29 Ga0065715_10362626 3300005293 Bacteria 929
30 Ga0065707_10023084 3300005295 Unclassified 1871
31 Ga0065707_10131710 3300005295 Bacteria 1909
32 Ga0065707_10166082 3300005295 Bacteria 1521
33 Ga0065707_10173098 3300005295 Unclassified 1470
34 Ga0070676_10006833 3300005328 Bacteria 6111
35 Ga0070676_10765052 3300005328 Bacteria 710
36 Ga0070683_100001615 3300005329 Bacteria 17444
37 Ga0070690_100028607 3300005330 Bacteria 3452
38 Ga0070690_100327363 3300005330 Bacteria 1106
39 Ga0070690_101005870 3300005330 Unclassified 657
40 Ga0070670_100008949 3300005331 Bacteria 8553
41 Ga0070670_100013168 3300005331 Bacteria 7083
42 Ga0070670_100039117 3300005331 Bacteria 4078
43 Ga0070670_100041497 3300005331 Bacteria 3955
44 Ga0070670_100087092 3300005331 Unclassified 2684
45 Ga0070670_100212032 3300005331 Unclassified 1684
46 Ga0070677_10002324 3300005333 Bacteria 6074
47 Ga0070677_10133531 3300005333 Bacteria 1136
48 Ga0068869_100027179 3300005334 Bacteria 3987
49 Ga0070666_10006950 3300005335 Bacteria 6975
50 Ga0070666_10149663 3300005335 Bacteria 1628
51 Ga0070666_10170753 3300005335 Bacteria 1523
52 Ga0068868_100016088 3300005338 Bacteria 5547
53 Ga0068868_100088462 3300005338 Unclassified 2493
54 Ga0068868_100289272 3300005338 Bacteria 1389
55 Ga0070660_100370636 3300005339 Bacteria 1181
56 Ga0070689_100006085 3300005340 Bacteria 8313
57 Ga0070687_100011349 3300005343 Bacteria 3895
58 Ga0070687_100134811 3300005343 Bacteria 1430
59 Ga0070687_100850131 3300005343 Bacteria 650
60 Ga0070661_100208191 3300005344 Bacteria 1496
61 Ga0070668_100010697 3300005347 Bacteria 6825
62 Ga0070668_100047297 3300005347 Bacteria 3308
63 Ga0070668_100048456 3300005347 Unclassified 3267
64 Ga0070668_100655001 3300005347 Bacteria 923
65 Ga0070669_100010460 3300005353 Bacteria 6588
66 Ga0070669_100046889 3300005353 Unclassified 3151
67 Ga0070669_100216982 3300005353 Bacteria 1511
68 Ga0070675_100024628 3300005354 Bacteria 4820
69 Ga0070675_100178237 3300005354 Unclassified 1836
70 Ga0070675_100427058 3300005354 Bacteria 1186
71 Ga0070671_100059697 3300005355 Bacteria 3174
72 Ga0070671_100455306 3300005355 Bacteria 1098
73 Ga0070671_100616846 3300005355 Unclassified 938
74 Ga0070674_100054135 3300005356 Unclassified 2774
75 Ga0070674_100245606 3300005356 Bacteria 1404
76 Ga0070674_100420680 3300005356 Bacteria 1096
77 Ga0070673_100010592 3300005364 Bacteria 6249
78 Ga0070673_100054037 3300005364 Bacteria 3158
79 Ga0070673_100175616 3300005364 Bacteria 1831
80 Ga0070673_100275479 3300005364 Unclassified 1474
81 Ga0070688_100202691 3300005365 Unclassified 1389
82 Ga0070688_100584380 3300005365 Bacteria 853
83 Ga0070659_100146981 3300005366 Bacteria 1921
84 Ga0070667_100007599 3300005367 Bacteria 8990
85 Ga0070667_100019116 3300005367 Bacteria 5682
86 Ga0070667_100569083 3300005367 Bacteria 1042
87 Ga0070667_101197849 3300005367 Bacteria 711
88 Ga0070701_10007648 3300005438 Bacteria 4632
89 Ga0070700_100006215 3300005441 Bacteria 6366
90 Ga0070700_100384322 3300005441 Bacteria 1051
91 Ga0070700_100767910 3300005441 Bacteria 773
92 Ga0070708_100588835 3300005445 Unclassified 1049
93 Ga0070663_100028094 3300005455 Bacteria 3826
94 Ga0070663_100140187 3300005455 Bacteria 1845
95 Ga0070663_100368719 3300005455 Bacteria 1166
96 Ga0070678_100004584 3300005456 Bacteria 7853
97 Ga0070678_100017934 3300005456 Bacteria 4574
98 Ga0070678_100072816 3300005456 Unclassified 2577
99 Ga0070678_100268212 3300005456 Bacteria 1438
100 Ga0070678_100294886 3300005456 Bacteria 1376
101 Ga0070678_100381906 3300005456 Bacteria 1219
102 Ga0070662_100013915 3300005457 Bacteria 5360
103 Ga0070662_100175208 3300005457 Unclassified 1687
104 Ga0070662_100344492 3300005457 Bacteria 1220
105 Ga0070662_100470214 3300005457 Bacteria 1046
106 Ga0068867_100009331 3300005459 Bacteria 6924
107 Ga0068867_100237623 3300005459 Bacteria 1476
108 Ga0068867_100676976 3300005459 Bacteria 908
109 Ga0070685_10053363 3300005466 Unclassified 2342
110 Ga0070685_10185289 3300005466 Bacteria 1343
111 Ga0070685_10214853 3300005466 Bacteria 1257
112 Ga0070685_10307285 3300005466 Bacteria 1071
113 Ga0070699_101505545 3300005518 Bacteria 617
114 Ga0070684_100367677 3300005535 Bacteria 1324
115 Ga0070684_100430340 3300005535 Bacteria 1219
116 Ga0070684_100597126 3300005535 Bacteria 1026
117 Ga0070672_100007157 3300005543 Bacteria 7549
118 Ga0070672_100222294 3300005543 Bacteria 1584
119 Ga0070672_100526508 3300005543 Bacteria 1024
120 Ga0070686_100044170 3300005544 Bacteria 2799
121 Ga0070686_100161113 3300005544 Bacteria 1580
122 Ga0070686_100374140 3300005544 Bacteria 1076
123 Ga0070696_100544617 3300005546 Bacteria 929
124 Ga0070693_100207651 3300005547 Bacteria 1276
125 Ga0070665_100014484 3300005548 Bacteria 7909
126 Ga0070665_100041087 3300005548 Bacteria 4648
127 Ga0070665_100100466 3300005548 Bacteria 2897
128 Ga0070704_100012552 3300005549 Bacteria 5234
129 Ga0070704_100157351 3300005549 Bacteria 1793
130 Ga0070664_100002767 3300005564 Bacteria 14156
131 Ga0070664_100062891 3300005564 Bacteria 3165
132 Ga0070664_100113566 3300005564 Bacteria 2366
133 Ga0070664_100344692 3300005564 Bacteria 1354
134 Ga0070664_100447602 3300005564 Bacteria 1185
135 Ga0068857_100100799 3300005577 Bacteria 2591
136 Ga0068857_101435289 3300005577 Bacteria 672
137 Ga0068854_100339504 3300005578 Bacteria 1226
138 Ga0068854_100761177 3300005578 Bacteria 841
139 Ga0068856_101197696 3300005614 Bacteria 776
140 Ga0070702_100001612 3300005615 Bacteria 9330
141 Ga0068852_100059557 3300005616 Bacteria 3312
142 Ga0068859_100042817 3300005617 Bacteria 4549
143 Ga0068859_100163051 3300005617 Bacteria 2308
144 Ga0068859_100672444 3300005617 Bacteria 1127
145 Ga0068864_100059495 3300005618 Bacteria 3306
146 Ga0068864_100332039 3300005618 Bacteria 1431
147 Ga0068864_100401280 3300005618 Bacteria 1303
148 Ga0068864_100724407 3300005618 Unclassified 973
149 Ga0068866_10003474 3300005718 Bacteria 6454
150 Ga0068866_10063110 3300005718 Bacteria 1930
151 Ga0068851_10052245 3300005834 Bacteria 2078
152 Ga0068870_10092322 3300005840 Bacteria 1695
153 Ga0068870_10133814 3300005840 Bacteria 1443
154 Ga0068863_100010032 3300005841 Bacteria 9217
155 Ga0068863_100319656 3300005841 Bacteria 1507
156 Ga0068863_100431213 3300005841 Bacteria 1292
157 Ga0068863_100508520 3300005841 Unclassified 1187
158 Ga0068858_100012685 3300005842 Bacteria 7940
159 Ga0068858_100398493 3300005842 Bacteria 1322
160 Ga0068858_101151554 3300005842 Bacteria 762
161 Ga0068860_100012202 3300005843 Bacteria 8464
162 Ga0068860_100240780 3300005843 Bacteria 1760
163 Ga0068862_100060425 3300005844 Bacteria 3256
164 Ga0068862_100092982 3300005844 Bacteria 2629
165 Ga0068862_100261305 3300005844 Bacteria 1580
166 Ga0068862_100551808 3300005844 Bacteria 1100
167 Ga0081540_1026060 3300005983 Bacteria 3348
168 Ga0070715_10319117 3300006163 Bacteria 838
169 Ga0097621_100018428 3300006237 Bacteria 5332
170 Ga0097621_100067461 3300006237 Bacteria 2949
171 Ga0097621_100091300 3300006237 Bacteria 2549
172 Ga0097621_100236081 3300006237 Unclassified 1597
173 Ga0068871_100052649 3300006358 Bacteria 3297
174 Ga0068871_100289712 3300006358 Bacteria 1434
175 Ga0068871_100622805 3300006358 Bacteria 983
176 Ga0068871_100927091 3300006358 Bacteria 808
177 Ga0075428_100004146 3300006844 Bacteria 15956
178 Ga0075428_100087093 3300006844 Unclassified 3407
179 Ga0075428_100100112 3300006844 Bacteria 3160
180 Ga0075428_100106853 3300006844 Bacteria 3051
181 Ga0075428_100759104 3300006844 Bacteria 1032
182 Ga0075430_100015081 3300006846 Bacteria 6576
183 Ga0075431_100002795 3300006847 Bacteria 16913
184 Ga0075433_10102313 3300006852 Bacteria 2537
185 Ga0075433_10743561 3300006852 Bacteria 858
186 Ga0075434_100739890 3300006871 Bacteria 1000
187 Ga0075429_100361139 3300006880 Bacteria 1272
188 Ga0068865_100003541 3300006881 Bacteria 9369
189 Ga0068865_100043756 3300006881 Bacteria 3062
190 Ga0068865_100044453 3300006881 Bacteria 3040
191 Ga0097620_100042817 3300006931 Bacteria 4549
192 Ga0097620_100163051 3300006931 Bacteria 2308
193 Ga0097620_100672347 3300006931 Bacteria 1127
194 Ga0075435_100540389 3300007076 Bacteria 1009
195 Ga0111539_10118989 3300009094 Unclassified 3095
196 Ga0111539_10163168 3300009094 Bacteria 2606
197 Ga0111539_10165823 3300009094 Unclassified 2583
198 Ga0111539_10529610 3300009094 Unclassified 1373
199 Ga0111539_10537088 3300009094 Bacteria 1362
200 Ga0111539_10740715 3300009094 Bacteria 1144
201 Ga0105245_10608403 3300009098 Bacteria 1120
202 Ga0105245_10616173 3300009098 Bacteria 1113
203 Ga0105245_11138718 3300009098 Bacteria 827
204 Ga0105247_10031626 3300009101 Bacteria 3212
205 Ga0114129_10000600 3300009147 Bacteria 44447
206 Ga0114129_10004533 3300009147 Bacteria 19610
207 Ga0114129_10113311 3300009147 Bacteria 3740
208 Ga0105243_10008632 3300009148 Bacteria 7817
209 Ga0105243_10078299 3300009148 Bacteria 2691
210 Ga0105243_10845602 3300009148 Bacteria 906
211 Ga0105241_10133759 3300009174 Bacteria 2011
212 Ga0105242_10006222 3300009176 Bacteria 9195
213 Ga0105242_10240731 3300009176 Bacteria 1626
214 Ga0105242_10302216 3300009176 Bacteria 1461
215 Ga0105242_10412711 3300009176 Bacteria 1263
216 Ga0105248_10016536 3300009177 Bacteria 8124
217 Ga0105248_10042882 3300009177 Bacteria 5073
218 Ga0105248_10381450 3300009177 Bacteria 1587
219 Ga0105248_10709953 3300009177 Bacteria 1135
220 Ga0105248_10741542 3300009177 Bacteria 1108
221 Ga0105248_10984580 3300009177 Unclassified 953
222 Ga0105248_11327628 3300009177 Bacteria 814
223 Ga0105237_10699741 3300009545 Bacteria 1020
224 Ga0105238_10794145 3300009551 Bacteria 962
225 Ga0105249_10009478 3300009553 Bacteria 8527
226 Ga0105249_10028413 3300009553 Bacteria 5047
227 Ga0105249_10049061 3300009553 Bacteria 3850
228 Ga0105239_10303339 3300010375 Bacteria 1798
229 Ga0105246_10496436 3300011119 Bacteria 1036
230 Ga0157374_10102931 3300013296 Bacteria 2739
231 Ga0157374_10140057 3300013296 Bacteria 2348
232 Ga0157374_10220419 3300013296 Bacteria 1861
233 Ga0157378_10003767 3300013297 Bacteria 13435
234 Ga0157378_10040443 3300013297 Bacteria 4134
235 Ga0157378_10350698 3300013297 Bacteria 1441
236 Ga0157378_10821120 3300013297 Bacteria 956
237 Ga0163162_10006696 3300013306 Bacteria 11169
238 Ga0163162_10011390 3300013306 Bacteria 8671
239 Ga0163162_10036332 3300013306 Bacteria 4909
240 Ga0163162_10287209 3300013306 Bacteria 1777
241 Ga0163162_10611690 3300013306 Bacteria 1215
242 Ga0157375_10008153 3300013308 Bacteria 9167
243 Ga0157375_10050567 3300013308 Bacteria 4077
244 Ga0163163_10048957 3300014325 Bacteria 4158
245 Ga0163163_10125751 3300014325 Bacteria 2602
246 Ga0163163_10129961 3300014325 Bacteria 2558
247 Ga0163163_11255699 3300014325 Bacteria 803
248 Ga0163163_11863637 3300014325 Unclassified 661
249 Ga0157380_10006440 3300014326 Bacteria 8268
250 Ga0157380_10634558 3300014326 Bacteria 1063
251 Ga0157377_10017638 3300014745 Bacteria 3695
252 Ga0157379_10020085 3300014968 Bacteria 5903
253 Ga0157376_10046138 3300014969 Bacteria 3592
254 Ga0157376_10075413 3300014969 Bacteria 2878
255 Ga0157376_10100670 3300014969 Bacteria 2524
256 Ga0157376_10222025 3300014969 Bacteria 1751
257 Ga0157376_10643943 3300014969 Bacteria 1059
258 Ga0157376_11147568 3300014969 Bacteria 804
259 Ga0163161_10004075 3300017792 Bacteria 10219
260 Ga0163161_10012619 3300017792 Bacteria 5870
261 Ga0163161_10579918 3300017792 Unclassified 922
262 Ga0206352_10217028 3300020078 Bacteria 1689
263 Ga0207666_1016220 3300025271 Bacteria 1067
264 Ga0207697_10001536 3300025315 Bacteria 12519
265 Ga0207697_10013228 3300025315 Bacteria 3444
266 Ga0207697_10111971 3300025315 Bacteria 1169
267 Ga0207697_10198882 3300025315 Bacteria 881
268 Ga0207682_10002189 3300025893 Bacteria 8827
269 Ga0207642_10027418 3300025899 Unclassified 2331
270 Ga0207642_10028598 3300025899 Bacteria 2298
271 Ga0207642_10046890 3300025899 Bacteria 1928
272 Ga0207642_10364691 3300025899 Unclassified 856
273 Ga0207688_10004154 3300025901 Bacteria 7890
274 Ga0207688_10059037 3300025901 Bacteria 2159
275 Ga0207688_10175886 3300025901 Bacteria 1275
276 Ga0207680_10005540 3300025903 Bacteria 6035
277 Ga0207680_10116787 3300025903 Bacteria 1739
278 Ga0207647_10363490 3300025904 Unclassified 819
279 Ga0207645_10010473 3300025907 Bacteria 6366
280 Ga0207645_10166111 3300025907 Unclassified 1445
281 Ga0207645_10306295 3300025907 Bacteria 1058
282 Ga0207643_10006758 3300025908 Bacteria 6152
283 Ga0207707_10489490 3300025912 Bacteria 1050
284 Ga0207662_10001873 3300025918 Bacteria 10349
285 Ga0207662_10740324 3300025918 Bacteria 691
286 Ga0207681_10022289 3300025923 Bacteria 4039
287 Ga0207681_10027730 3300025923 Bacteria 3664
288 Ga0207681_10107972 3300025923 Bacteria 2019
289 Ga0207650_10018416 3300025925 Bacteria 4901
290 Ga0207650_10024674 3300025925 Bacteria 4277
291 Ga0207650_10029554 3300025925 Bacteria 3941
292 Ga0207650_10042656 3300025925 Bacteria 3328
293 Ga0207650_10057464 3300025925 Unclassified 2893
294 Ga0207650_10265553 3300025925 Bacteria 1393
295 Ga0207659_10001685 3300025926 Bacteria 13117
296 Ga0207659_10126133 3300025926 Bacteria 1969
297 Ga0207659_10614962 3300025926 Bacteria 927
298 Ga0207687_10864225 3300025927 Bacteria 773
299 Ga0207644_10026207 3300025931 Bacteria 4015
300 Ga0207644_10041324 3300025931 Bacteria 3261
301 Ga0207644_10295925 3300025931 Bacteria 1303
302 Ga0207644_10473271 3300025931 Bacteria 1031
303 Ga0207706_10015760 3300025933 Bacteria 6831
304 Ga0207706_10082261 3300025933 Bacteria 2830
305 Ga0207706_10368034 3300025933 Bacteria 1248
306 Ga0207706_10447841 3300025933 Bacteria 1117
307 Ga0207706_10481423 3300025933 Bacteria 1072
308 Ga0207706_10547930 3300025933 Bacteria 996
309 Ga0207686_10015094 3300025934 Bacteria 4313
310 Ga0207686_10048768 3300025934 Bacteria 2625
311 Ga0207686_10058073 3300025934 Bacteria 2438
312 Ga0207686_10216873 3300025934 Bacteria 1379
313 Ga0207686_10280881 3300025934 Unclassified 1229
314 Ga0207709_10094156 3300025935 Unclassified 1966
315 Ga0207670_10082174 3300025936 Bacteria 2257
316 Ga0207670_10114720 3300025936 Unclassified 1947
317 Ga0207669_10018712 3300025937 Bacteria 3588
318 Ga0207669_10392851 3300025937 Bacteria 1084
319 Ga0207669_11304317 3300025937 Bacteria 617
320 Ga0207704_10012155 3300025938 Bacteria 4265
321 Ga0207704_10038715 3300025938 Bacteria 2769
322 Ga0207704_10044889 3300025938 Bacteria 2621
323 Ga0207691_10034338 3300025940 Bacteria 4717
324 Ga0207691_10092409 3300025940 Bacteria 2710
325 Ga0207691_10454545 3300025940 Bacteria 1090
326 Ga0207711_10011956 3300025941 Bacteria 7214
327 Ga0207711_10022524 3300025941 Bacteria 5269
328 Ga0207711_10155821 3300025941 Bacteria 2064
329 Ga0207711_10257350 3300025941 Bacteria 1604
330 Ga0207711_10330094 3300025941 Bacteria 1410
331 Ga0207711_10824263 3300025941 Bacteria 864
332 Ga0207689_10023309 3300025942 Bacteria 5197
333 Ga0207661_10003626 3300025944 Bacteria 10750
334 Ga0207679_10002062 3300025945 Bacteria 12463
335 Ga0207679_10195916 3300025945 Bacteria 1684
336 Ga0207679_10241617 3300025945 Unclassified 1530
337 Ga0207651_10007617 3300025960 Bacteria 5778
338 Ga0207651_10787338 3300025960 Bacteria 842
339 Ga0207651_10818305 3300025960 Bacteria 826
340 Ga0207712_10000070 3300025961 Bacteria 125324
341 Ga0207712_10052530 3300025961 Bacteria 2855
342 Ga0207712_10312260 3300025961 Unclassified 1294
343 Ga0207712_10621956 3300025961 Unclassified 936
344 Ga0207668_10001602 3300025972 Bacteria 13207
345 Ga0207668_10017756 3300025972 Bacteria 4464
346 Ga0207668_10109424 3300025972 Unclassified 2070
347 Ga0207640_10610059 3300025981 Bacteria 925
348 Ga0207658_10004849 3300025986 Bacteria 9296
349 Ga0207658_10010672 3300025986 Bacteria 6244
350 Ga0207658_10256314 3300025986 Bacteria 1489
351 Ga0207658_10441773 3300025986 Bacteria 1150
352 Ga0207658_11091354 3300025986 Unclassified 729
353 Ga0207677_10014351 3300026023 Bacteria 4624
354 Ga0207677_10201945 3300026023 Bacteria 1581
355 Ga0207703_10004279 3300026035 Bacteria 11742
356 Ga0207703_10269212 3300026035 Bacteria 1543
357 Ga0207703_11373762 3300026035 Bacteria 679
358 Ga0207678_10033473 3300026067 Bacteria 4476
359 Ga0207678_10095485 3300026067 Bacteria 2541
360 Ga0207678_10127451 3300026067 Bacteria 2171
361 Ga0207708_10005767 3300026075 Bacteria 9152
362 Ga0207708_10315674 3300026075 Bacteria 1274
363 Ga0207708_10367360 3300026075 Bacteria 1184
364 Ga0207708_10382171 3300026075 Bacteria 1161
365 Ga0207641_10007662 3300026088 Bacteria 8977
366 Ga0207641_10395476 3300026088 Bacteria 1326
367 Ga0207648_10006806 3300026089 Bacteria 11326
368 Ga0207648_10149413 3300026089 Bacteria 2061
369 Ga0207648_10150031 3300026089 Unclassified 2057
370 Ga0207676_10042596 3300026095 Bacteria 3492
371 Ga0207676_10140509 3300026095 Unclassified 2066
372 Ga0207676_10217664 3300026095 Bacteria 1699
373 Ga0207676_10413796 3300026095 Bacteria 1263
374 Ga0207674_10148247 3300026116 Bacteria 2304
375 Ga0207674_10355797 3300026116 Bacteria 1416
376 Ga0207683_10010940 3300026121 Bacteria 7739
377 Ga0207683_10031318 3300026121 Bacteria 4616
378 Ga0207683_10092127 3300026121 Bacteria 2701
379 Ga0207683_10378349 3300026121 Bacteria 1301
380 Ga0207683_10733638 3300026121 Bacteria 916
381 Ga0207698_11712239 3300026142 Bacteria 644
382 Ga0209971_1006439 3300027682 Unclassified 2775
383 Ga0209974_10181432 3300027876 Unclassified 771
384 Ga0207428_10090605 3300027907 Bacteria 2375
385 Ga0207428_10101655 3300027907 Bacteria 2221
386 Ga0268266_10102379 3300028379 Unclassified 2526
387 Ga0268265_10048049 3300028380 Bacteria 3201
388 Ga0268265_10069925 3300028380 Bacteria 2728
389 Ga0268265_10214887 3300028380 Bacteria 1678
390 Ga0268265_10892566 3300028380 Bacteria 872
391 Ga0268264_10016472 3300028381 Bacteria 6052
392 Ga0268264_10232625 3300028381 Bacteria 1703
393 Ga0316576_10255420 3300031727 Bacteria 1315
394 Ga0316577_10428182 3300031733 Unclassified 752
395 Ga0307406_10465650 3300031901 Bacteria 1017
396 Ga0307412_10498455 3300031911 Unclassified 1013
397 Ga0307412_10822737 3300031911 Bacteria 808
398 Ga0307409_100214241 3300031995 Unclassified 1733
399 Ga0307416_100135829 3300032002 Bacteria 2224
400 Ga0307416_100436533 3300032002 Unclassified 1358
401 Ga0307414_10217361 3300032004 Bacteria 1567
402 Ga0307414_10317217 3300032004 Unclassified 1325
403 Ga0307411_10154841 3300032005 Bacteria 1708
404 Ga0307411_10249645 3300032005 Unclassified 1394
405 Ga0307415_100033497 3300032126 Bacteria 3336
406 Ga0373934_0032662 3300035086 Bacteria 2042
407 Ga0373951_0149507 3300035091 Bacteria 654
408 Ga0373941_0055697 3300035115 Bacteria 1272
409 Ga0373953_0068201 3300035117 Bacteria 1464
410 Ga0373953_0134360 3300035117 Bacteria 1056
411 Ga0373956_0003329 3300035119 Bacteria 6473
412 Ga0373957_0048399 3300035120 Bacteria 1620
413 Ga0373955_0022247 3300035172 Bacteria 3213
414 Ga0373955_0302014 3300035172 Unclassified 965
415 Ga0373937_0000017 3300036401 Bacteria 144650
416 Ga0373937_0020119 3300036401 Bacteria 5981
417 Ga0373937_0681389 3300036401 Bacteria 974
418 Ga0316582_0035074 3300036647 Bacteria 3095
419 Ga0316584_0171255 3300036712 Bacteria 1610
420 Ga0373925_0554441 3300037068 Unclassified 945
421 Ga0451807_0925784 3300041486 Bacteria 730
422 Ga0451845_0215563 3300041501 Bacteria 638
423 Ga0451853_2689388 3300041512 Bacteria 736
424 Ga0439455_0090948 3300042012 Bacteria 837
425 Ga0450923_041352 3300042125 Bacteria 970
426 Ga0450894_002708 3300042131 Bacteria 2351
427 Ga0450896_028699 3300042133 Bacteria 836
428 Ga0450889_012572 3300042144 Bacteria 889
429 Ga0450908_012598 3300042184 Unclassified 1533
430 Ga0439464_0006265 3300042439 Bacteria 3096
431 Ga0439464_0023388 3300042439 Bacteria 1706
432 Ga0450918_013982 3300042531 Unclassified 1396
433 Ga0451577_0272056 3300042876 Unclassified 1534
434 Ga0451577_0536801 3300042876 Bacteria 1062
435 Ga0439440_0005604 3300042993 Bacteria 2499
436 Ga0453684_0244149 3300044712 Bacteria 2066
437 Ga0451576_0254803 3300045051 Bacteria 1834
438 Ga0451576_0630333 3300045051 Bacteria 1126
439 Ga0495591_042824 3300046458 Bacteria 1278
440 Ga0495629_0233743 3300046459 Unclassified 1267
441 Ga0495629_0600040 3300046459 Bacteria 736
442 Ga0495651_0087750 3300046462 Bacteria 2339
443 Ga0495651_0356654 3300046462 Bacteria 965
444 Ga0495653_0010602 3300046463 Bacteria 7546
445 Ga0495582_0057535 3300046473 Bacteria 2144
446 Ga0495639_0125089 3300046475 Unclassified 1228
447 Ga0495639_0306911 3300046475 Bacteria 792
448 Ga0495628_0211518 3300046516 Bacteria 1459
449 Ga0495628_0333204 3300046516 Unclassified 1118
450 Ga0495630_0179365 3300046517 Bacteria 1615
451 Ga0495663_0088218 3300046525 Bacteria 1008
452 Ga0495642_0058966 3300046528 Bacteria 1590
453 Ga0495654_0166971 3300046530 Bacteria 962
454 Ga0495640_0128167 3300046533 Unclassified 1644
455 Ga0495587_0123555 3300046536 Bacteria 1482
456 Ga0495598_0040846 3300046537 Bacteria 1354
457 Ga0495645_0007033 3300046543 Bacteria 7826
458 Ga0495667_0079296 3300046559 Bacteria 2135
459 Ga0495656_0156749 3300046615 Bacteria 1104
460 Ga0495656_0212345 3300046615 Bacteria 965
461 Ga0495635_0042992 3300046663 Bacteria 3119
462 Ga0495659_0350319 3300046664 Unclassified 631
463 Ga0495647_0049191 3300046681 Unclassified 1633
464 Ga0495658_0042226 3300046683 Bacteria 2545
465 Ga0495658_0050996 3300046683 Bacteria 2343
466 Ga0495658_0262800 3300046683 Bacteria 1087
467 Ga0495669_0163347 3300046684 Bacteria 1057
468 Ga0495613_0138481 3300046689 Bacteria 1740
469 Ga0495600_0032483 3300046809 Bacteria 3387
470 Ga0495600_0333614 3300046809 Bacteria 952
471 Ga0495581_0215784 3300047315 Bacteria 1122
472 Ga0495672_0123273 3300047320 Bacteria 1374
473 Ga0495680_0086098 3300047322 Bacteria 2365
474 Ga0496101_0100907 3300048904 Bacteria 2160
475 Ga0496101_0735115 3300048904 Bacteria 779
476 Ga0496102_0252777 3300048905 Unclassified 1662
477 Ga0496102_0754053 3300048905 Bacteria 896
478 Ga0496104_0014156 3300048907 Bacteria 7199
479 Ga0496104_0023496 3300048907 Bacteria 5667
480 Ga0496105_0069156 3300048908 Bacteria 2918
481 Ga0496105_0225741 3300048908 Bacteria 1523
482 Ga0496106_0012824 3300048909 Bacteria 6188
483 Ga0496106_0558932 3300048909 Bacteria 918
484 Ga0496106_0993949 3300048909 Bacteria 660
485 Ga0496108_0002862 3300048911 Bacteria 13853
486 Ga0496108_0008851 3300048911 Bacteria 8155
487 Ga0496108_0040301 3300048911 Bacteria 3893
488 Ga0496108_0049448 3300048911 Bacteria 3517
489 Ga0496108_0287756 3300048911 Bacteria 1431
490 Ga0496109_0003519 3300048912 Bacteria 13078
491 Ga0496109_0023101 3300048912 Bacteria 5516
492 Ga0496109_0356721 3300048912 Unclassified 1381
493 Ga0496110_0007456 3300048913 Bacteria 8741
494 Ga0496110_0132611 3300048913 Bacteria 2250
495 Ga0496110_0170694 3300048913 Bacteria 1973
496 Ga0496110_0308132 3300048913 Bacteria 1442
497 Ga0496111_0016324 3300048914 Bacteria 5115
498 Ga0496111_0573782 3300048914 Unclassified 827
499 Ga0496112_0012272 3300048915 Bacteria 7867
500 Ga0496112_0026438 3300048915 Bacteria 5584
501 Ga0496112_0289431 3300048915 Bacteria 1584
502 Ga0496113_0151498 3300048916 Bacteria 1830
503 Ga0496113_0176778 3300048916 Bacteria 1691
504 Ga0496113_0264844 3300048916 Bacteria 1373
505 Ga0496114_0001411 3300048917 Bacteria 18238
506 Ga0496114_0281110 3300048917 Bacteria 1467
507 Ga0496114_0936859 3300048917 Bacteria 748
508 Ga0501039_0220773 3300049575 Unclassified 1490
509 Ga0501043_0488640 3300049579 Bacteria 921
510 Ga0501068_0393726 3300049584 Bacteria 893
511 Ga0501072_0106931 3300049588 Bacteria 2225
512 Ga0501209_000607 3300049656 Bacteria 4438
513 Ga0501080_0307871 3300049742 Bacteria 1436
514 Ga0501081_0111089 3300049743 Bacteria 1945
515 Ga0501045_0725652 3300049824 Bacteria 733
516 nmdc:mga05p37_11_c1 3300050507 Bacteria 149577
517 nmdc:mga05p37_1459_c1 3300050507 Bacteria 27476
518 nmdc:mga09592_630481_c1 3300050508 Unclassified 916
519 nmdc:mga0qj67_9344_c1 3300050509 Bacteria 7292
520 nmdc:mga06r32_2279_c1 3300050510 Bacteria 17166
521 nmdc:mga08y16_147312_c1 3300050511 Unclassified 2447
522 nmdc:mga08y16_525700_c1 3300050511 Bacteria 1199
523 nmdc:mga08y16_797197_c1 3300050511 Bacteria 938
524 nmdc:mga08y16_8492_c1 3300050511 Bacteria 10758
525 nmdc:mga08y16_987393_c1 3300050511 Bacteria 823
526 nmdc:mga0n895_645463_c1 3300050512 Bacteria 1058
527 nmdc:mga0rr50_279128_c1 3300050513 Bacteria 1394
528 nmdc:mga0a205_505856_c1 3300050515 Bacteria 1065
529 nmdc:mga0a205_65744_c1 3300050515 Unclassified 3504
530 Ga0495601_0013879 3300053077 Bacteria 4851
531 Ga0495601_0016459 3300053077 Bacteria 4481
532 Ga0495601_0155604 3300053077 Unclassified 1493
533 Ga0495601_0455084 3300053077 Bacteria 828
534 Ga0495595_0007004 3300053084 Bacteria 4604
535 Ga0495619_0023250 3300053085 Bacteria 3972
536 Ga0495619_0044524 3300053085 Bacteria 2913
537 Ga0500628_057397 3300053129 Unclassified 942
538 Ga0500568_0009841 3300053139 Bacteria 4517
539 Ga0501084_0078969 3300054114 Bacteria 2758
540 Ga0501082_0183552 3300060353 Bacteria 1820
541 Ga0501082_0305268 3300060353 Bacteria 1386
542 Ga0530510_0050508 3300061734 Bacteria 3004
543 Ga0105248_10047469
544 ARcpr5oldR_c017297
545 ARcpr5yngRDRAFT_c010908
546 ARSoilOldRDRAFT_c002145
547 JGI24752J21851_1023936
548 JGI24743J22301_10011833
549 JGI24743J22301_10068912
550 JGI24749J21850_1029110
551 JGI24749J21850_1039370
552 JGI24744J21845_10013883
553 JGI24033J26618_1004684
554 JGI24034J26672_10011734
555 JGI24742J22300_10021636
556 Ga0058858_1389923
557 Ga0058859_11561597
558 Ga0058859_11718926
559 Ga0058859_11761540
560 Ga0058861_11596372
561 Ga0058860_10020708
562 Ga0065714_10247968
563 Ga0065704_10272924
564 Ga0065712_10000691
565 Ga0065712_10068422
566 Ga0065712_10074122
567 Ga0065712_10079369
568 Ga0065715_10000241
569 Ga0065715_10010985
570 Ga0065715_10090178
571 Ga0065715_10362626
572 Ga0065707_10023084
573 Ga0065707_10131710
574 Ga0065707_10166082
575 Ga0065707_10173098
576 Ga0070676_10006833
577 Ga0070676_10765052
578 Ga0070683_100001615
579 Ga0070690_100028607
580 Ga0070690_100327363
581 Ga0070690_101005870
582 Ga0070670_100008949
583 Ga0070670_100013168
584 Ga0070670_100039117
585 Ga0070670_100041497
586 Ga0070670_100087092
587 Ga0070670_100212032
588 Ga0070677_10002324
589 Ga0070677_10133531
590 Ga0068869_100027179
591 Ga0070666_10006950
592 Ga0070666_10149663
593 Ga0070666_10170753
594 Ga0068868_100016088
595 Ga0068868_100088462
596 Ga0068868_100289272
597 Ga0070660_100370636
598 Ga0070689_100006085
599 Ga0070687_100011349
600 Ga0070687_100134811
601 Ga0070687_100850131
602 Ga0070661_100208191
603 Ga0070668_100010697
604 Ga0070668_100047297
605 Ga0070668_100048456
606 Ga0070668_100655001
607 Ga0070669_100010460
608 Ga0070669_100046889
609 Ga0070669_100216982
610 Ga0070675_100024628
611 Ga0070675_100178237
612 Ga0070675_100427058
613 Ga0070671_100059697
614 Ga0070671_100455306
615 Ga0070671_100616846
616 Ga0070674_100054135
617 Ga0070674_100245606
618 Ga0070674_100420680
619 Ga0070673_100010592
620 Ga0070673_100054037
621 Ga0070673_100175616
622 Ga0070673_100275479
623 Ga0070688_100202691
624 Ga0070688_100584380
625 Ga0070659_100146981
626 Ga0070667_100007599
627 Ga0070667_100019116
628 Ga0070667_100569083
629 Ga0070667_101197849
630 Ga0070701_10007648
631 Ga0070700_100006215
632 Ga0070700_100384322
633 Ga0070700_100767910
634 Ga0070708_100588835
635 Ga0070663_100028094
636 Ga0070663_100140187
637 Ga0070663_100368719
638 Ga0070678_100004584
639 Ga0070678_100017934
640 Ga0070678_100072816
641 Ga0070678_100268212
642 Ga0070678_100294886
643 Ga0070678_100381906
644 Ga0070662_100013915
645 Ga0070662_100175208
646 Ga0070662_100344492
647 Ga0070662_100470214
648 Ga0068867_100009331
649 Ga0068867_100237623
650 Ga0068867_100676976
651 Ga0070685_10053363
652 Ga0070685_10185289
653 Ga0070685_10214853
654 Ga0070685_10307285
655 Ga0070699_101505545
656 Ga0070684_100367677
657 Ga0070684_100430340
658 Ga0070684_100597126
659 Ga0070672_100007157
660 Ga0070672_100222294
661 Ga0070672_100526508
662 Ga0070686_100044170
663 Ga0070686_100161113
664 Ga0070686_100374140
665 Ga0070696_100544617
666 Ga0070693_100207651
667 Ga0070665_100014484
668 Ga0070665_100041087
669 Ga0070665_100100466
670 Ga0070704_100012552
671 Ga0070704_100157351
672 Ga0070664_100002767
673 Ga0070664_100062891
674 Ga0070664_100113566
675 Ga0070664_100344692
676 Ga0070664_100447602
677 Ga0068857_100100799
678 Ga0068857_101435289
679 Ga0068854_100339504
680 Ga0068854_100761177
681 Ga0068856_101197696
682 Ga0070702_100001612
683 Ga0068852_100059557
684 Ga0068859_100042817
685 Ga0068859_100163051
686 Ga0068859_100672444
687 Ga0068864_100059495
688 Ga0068864_100332039
689 Ga0068864_100401280
690 Ga0068864_100724407
691 Ga0068866_10003474
692 Ga0068866_10063110
693 Ga0068851_10052245
694 Ga0068870_10092322
695 Ga0068870_10133814
696 Ga0068863_100010032
697 Ga0068863_100319656
698 Ga0068863_100431213
699 Ga0068863_100508520
700 Ga0068858_100012685
701 Ga0068858_100398493
702 Ga0068858_101151554
703 Ga0068860_100012202
704 Ga0068860_100240780
705 Ga0068862_100060425
706 Ga0068862_100092982
707 Ga0068862_100261305
708 Ga0068862_100551808
709 Ga0081540_1026060
710 Ga0070715_10319117
711 Ga0097621_100018428
712 Ga0097621_100067461
713 Ga0097621_100091300
714 Ga0097621_100236081
715 Ga0068871_100052649
716 Ga0068871_100289712
717 Ga0068871_100622805
718 Ga0068871_100927091
719 Ga0075428_100004146
720 Ga0075428_100087093
721 Ga0075428_100100112
722 Ga0075428_100106853
723 Ga0075428_100759104
724 Ga0075430_100015081
725 Ga0075431_100002795
726 Ga0075433_10102313
727 Ga0075433_10743561
728 Ga0075434_100739890
729 Ga0075429_100361139
730 Ga0068865_100003541
731 Ga0068865_100043756
732 Ga0068865_100044453
733 Ga0097620_100042817
734 Ga0097620_100163051
735 Ga0097620_100672347
736 Ga0075435_100540389
737 Ga0111539_10118989
738 Ga0111539_10163168
739 Ga0111539_10165823
740 Ga0111539_10529610
741 Ga0111539_10537088
742 Ga0111539_10740715
743 Ga0105245_10608403
744 Ga0105245_10616173
745 Ga0105245_11138718
746 Ga0105247_10031626
747 Ga0114129_10000600
748 Ga0114129_10004533
749 Ga0114129_10113311
750 Ga0105243_10008632
751 Ga0105243_10078299
752 Ga0105243_10845602
753 Ga0105241_10133759
754 Ga0105242_10006222
755 Ga0105242_10240731
756 Ga0105242_10302216
757 Ga0105242_10412711
758 Ga0105248_10016536
759 Ga0105248_10042882
760 Ga0105248_10381450
761 Ga0105248_10709953
762 Ga0105248_10741542
763 Ga0105248_10984580
764 Ga0105248_11327628
765 Ga0105237_10699741
766 Ga0105238_10794145
767 Ga0105249_10009478
768 Ga0105249_10028413
769 Ga0105249_10049061
770 Ga0105239_10303339
771 Ga0105246_10496436
772 Ga0157374_10102931
773 Ga0157374_10140057
774 Ga0157374_10220419
775 Ga0157378_10003767
776 Ga0157378_10040443
777 Ga0157378_10350698
778 Ga0157378_10821120
779 Ga0163162_10006696
780 Ga0163162_10011390
781 Ga0163162_10036332
782 Ga0163162_10287209
783 Ga0163162_10611690
784 Ga0157375_10008153
785 Ga0157375_10050567
786 Ga0163163_10048957
787 Ga0163163_10125751
788 Ga0163163_10129961
789 Ga0163163_11255699
790 Ga0163163_11863637
791 Ga0157380_10006440
792 Ga0157380_10634558
793 Ga0157377_10017638
794 Ga0157379_10020085
795 Ga0157376_10046138
796 Ga0157376_10075413
797 Ga0157376_10100670
798 Ga0157376_10222025
799 Ga0157376_10643943
800 Ga0157376_11147568
801 Ga0163161_10004075
802 Ga0163161_10012619
803 Ga0163161_10579918
804 Ga0206352_10217028
805 Ga0207666_1016220
806 Ga0207697_10001536
807 Ga0207697_10013228
808 Ga0207697_10111971
809 Ga0207697_10198882
810 Ga0207682_10002189
811 Ga0207642_10027418
812 Ga0207642_10028598
813 Ga0207642_10046890
814 Ga0207642_10364691
815 Ga0207688_10004154
816 Ga0207688_10059037
817 Ga0207688_10175886
818 Ga0207680_10005540
819 Ga0207680_10116787
820 Ga0207647_10363490
821 Ga0207645_10010473
822 Ga0207645_10166111
823 Ga0207645_10306295
824 Ga0207643_10006758
825 Ga0207707_10489490
826 Ga0207662_10001873
827 Ga0207662_10740324
828 Ga0207681_10022289
829 Ga0207681_10027730
830 Ga0207681_10107972
831 Ga0207650_10018416
832 Ga0207650_10024674
833 Ga0207650_10029554
834 Ga0207650_10042656
835 Ga0207650_10057464
836 Ga0207650_10265553
837 Ga0207659_10001685
838 Ga0207659_10126133
839 Ga0207659_10614962
840 Ga0207687_10864225
841 Ga0207644_10026207
842 Ga0207644_10041324
843 Ga0207644_10295925
844 Ga0207644_10473271
845 Ga0207706_10015760
846 Ga0207706_10082261
847 Ga0207706_10368034
848 Ga0207706_10447841
849 Ga0207706_10481423
850 Ga0207706_10547930
851 Ga0207686_10015094
852 Ga0207686_10048768
853 Ga0207686_10058073
854 Ga0207686_10216873
855 Ga0207686_10280881
856 Ga0207709_10094156
857 Ga0207670_10082174
858 Ga0207670_10114720
859 Ga0207669_10018712
860 Ga0207669_10392851
861 Ga0207669_11304317
862 Ga0207704_10012155
863 Ga0207704_10038715
864 Ga0207704_10044889
865 Ga0207691_10034338
866 Ga0207691_10092409
867 Ga0207691_10454545
868 Ga0207711_10011956
869 Ga0207711_10022524
870 Ga0207711_10155821
871 Ga0207711_10257350
872 Ga0207711_10330094
873 Ga0207711_10824263
874 Ga0207689_10023309
875 Ga0207661_10003626
876 Ga0207679_10002062
877 Ga0207679_10195916
878 Ga0207679_10241617
879 Ga0207651_10007617
880 Ga0207651_10787338
881 Ga0207651_10818305
882 Ga0207712_10000070
883 Ga0207712_10052530
884 Ga0207712_10312260
885 Ga0207712_10621956
886 Ga0207668_10001602
887 Ga0207668_10017756
888 Ga0207668_10109424
889 Ga0207640_10610059
890 Ga0207658_10004849
891 Ga0207658_10010672
892 Ga0207658_10256314
893 Ga0207658_10441773
894 Ga0207658_11091354
895 Ga0207677_10014351
896 Ga0207677_10201945
897 Ga0207703_10004279
898 Ga0207703_10269212
899 Ga0207703_11373762
900 Ga0207678_10033473
901 Ga0207678_10095485
902 Ga0207678_10127451
903 Ga0207708_10005767
904 Ga0207708_10315674
905 Ga0207708_10367360
906 Ga0207708_10382171
907 Ga0207641_10007662
908 Ga0207641_10395476
909 Ga0207648_10006806
910 Ga0207648_10149413
911 Ga0207648_10150031
912 Ga0207676_10042596
913 Ga0207676_10140509
914 Ga0207676_10217664
915 Ga0207676_10413796
916 Ga0207674_10148247
917 Ga0207674_10355797
918 Ga0207683_10010940
919 Ga0207683_10031318
920 Ga0207683_10092127
921 Ga0207683_10378349
922 Ga0207683_10733638
923 Ga0207698_11712239
924 Ga0209971_1006439
925 Ga0209974_10181432
926 Ga0207428_10090605
927 Ga0207428_10101655
928 Ga0268266_10102379
929 Ga0268265_10048049
930 Ga0268265_10069925
931 Ga0268265_10214887
932 Ga0268265_10892566
933 Ga0268264_10016472
934 Ga0268264_10232625
935 Ga0316576_10255420
936 Ga0316577_10428182
937 Ga0307406_10465650
938 Ga0307412_10498455
939 Ga0307412_10822737
940 Ga0307409_100214241
941 Ga0307416_100135829
942 Ga0307416_100436533
943 Ga0307414_10217361
944 Ga0307414_10317217
945 Ga0307411_10154841
946 Ga0307411_10249645
947 Ga0307415_100033497
948 Ga0373934_0032662
949 Ga0373951_0149507
950 Ga0373941_0055697
951 Ga0373953_0068201
952 Ga0373953_0134360
953 Ga0373956_0003329
954 Ga0373957_0048399
955 Ga0373955_0022247
956 Ga0373955_0302014
957 Ga0373937_0000017
958 Ga0373937_0020119
959 Ga0373937_0681389
960 Ga0316582_0035074
961 Ga0316584_0171255
962 Ga0373925_0554441
963 Ga0451807_0925784
964 Ga0451845_0215563
965 Ga0451853_2689388
966 Ga0439455_0090948
967 Ga0450923_041352
968 Ga0450894_002708
969 Ga0450896_028699
970 Ga0450889_012572
971 Ga0450908_012598
972 Ga0439464_0006265
973 Ga0439464_0023388
974 Ga0450918_013982
975 Ga0451577_0272056
976 Ga0451577_0536801
977 Ga0439440_0005604
978 Ga0453684_0244149
979 Ga0451576_0254803
980 Ga0451576_0630333
981 Ga0495591_042824
982 Ga0495629_0233743
983 Ga0495629_0600040
984 Ga0495651_0087750
985 Ga0495651_0356654
986 Ga0495653_0010602
987 Ga0495582_0057535
988 Ga0495639_0125089
989 Ga0495639_0306911
990 Ga0495628_0211518
991 Ga0495628_0333204
992 Ga0495630_0179365
993 Ga0495663_0088218
994 Ga0495642_0058966
995 Ga0495654_0166971
996 Ga0495640_0128167
997 Ga0495587_0123555
998 Ga0495598_0040846
999 Ga0495645_0007033
1000 Ga0495667_0079296
1001 Ga0495656_0156749
1002 Ga0495656_0212345
1003 Ga0495635_0042992
1004 Ga0495659_0350319
1005 Ga0495647_0049191
1006 Ga0495658_0042226
1007 Ga0495658_0050996
1008 Ga0495658_0262800
1009 Ga0495669_0163347
1010 Ga0495613_0138481
1011 Ga0495600_0032483
1012 Ga0495600_0333614
1013 Ga0495581_0215784
1014 Ga0495672_0123273
1015 Ga0495680_0086098
1016 Ga0496101_0100907
1017 Ga0496101_0735115
1018 Ga0496102_0252777
1019 Ga0496102_0754053
1020 Ga0496104_0014156
1021 Ga0496104_0023496
1022 Ga0496105_0069156
1023 Ga0496105_0225741
1024 Ga0496106_0012824
1025 Ga0496106_0558932
1026 Ga0496106_0993949
1027 Ga0496108_0002862
1028 Ga0496108_0008851
1029 Ga0496108_0040301
1030 Ga0496108_0049448
1031 Ga0496108_0287756
1032 Ga0496109_0003519
1033 Ga0496109_0023101
1034 Ga0496109_0356721
1035 Ga0496110_0007456
1036 Ga0496110_0132611
1037 Ga0496110_0170694
1038 Ga0496110_0308132
1039 Ga0496111_0016324
1040 Ga0496111_0573782
1041 Ga0496112_0012272
1042 Ga0496112_0026438
1043 Ga0496112_0289431
1044 Ga0496113_0151498
1045 Ga0496113_0176778
1046 Ga0496113_0264844
1047 Ga0496114_0001411
1048 Ga0496114_0281110
1049 Ga0496114_0936859
1050 Ga0501039_0220773
1051 Ga0501043_0488640
1052 Ga0501068_0393726
1053 Ga0501072_0106931
1054 Ga0501209_000607
1055 Ga0501080_0307871
1056 Ga0501081_0111089
1057 Ga0501045_0725652
1058 nmdc:mga05p37_11_c1
1059 nmdc:mga05p37_1459_c1
1060 nmdc:mga09592_630481_c1
1061 nmdc:mga0qj67_9344_c1
1062 nmdc:mga06r32_2279_c1
1063 nmdc:mga08y16_147312_c1
1064 nmdc:mga08y16_525700_c1
1065 nmdc:mga08y16_797197_c1
1066 nmdc:mga08y16_8492_c1
1067 nmdc:mga08y16_987393_c1
1068 nmdc:mga0n895_645463_c1
1069 nmdc:mga0rr50_279128_c1
1070 nmdc:mga0a205_505856_c1
1071 nmdc:mga0a205_65744_c1
1072 Ga0495601_0013879
1073 Ga0495601_0016459
1074 Ga0495601_0155604
1075 Ga0495601_0455084
1076 Ga0495595_0007004
1077 Ga0495619_0023250
1078 Ga0495619_0044524
1079 Ga0500628_057397
1080 Ga0500568_0009841
1081 Ga0501084_0078969
1082 Ga0501082_0183552
1083 Ga0501082_0305268
1084 Ga0530510_0050508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04366

Ysc84

Las17-binding protein actin regulator

117

204

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.7906 30 179
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.7291 30 179
7rfq-assembly1.cif.gz_A structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) 0.6974 28 179
7rfq-assembly1.cif.gz_A structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) 0.5751 28 179
5sws-assembly1.cif.gz_A crystal structure of np2-b17 tcr-h2db-np complex 0.5566 57 112
ID Description Score Start End Superfamily
af_X1WH44_4_261_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6741 65 97 3.10.450.50
2a50D00 Mainly Beta;Beta Barrel;Green Fluorescent Protein;Green fluorescent protein 0.5347 50 115 2.40.155.10
af_A0A0P0Y7I2_39_194_2.170.150.80 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;NAC domain 0.5206 63 109 2.170.150.80
af_E7F2S5_974_1067_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4992 53 115 2.60.40.10
2rfrA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.4605 48 105 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A661DPN0-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9749 26 182
AF-A0A7T0NZ62-F1-model_v4 Lipid-binding SYLF domain-containing protein 0.942 27 181
AF-A0A2C8ZSC8-F1-model_v4 deleted 0.9402 29 122
AF-A0A840UPK2-F1-model_v4 Lipid-binding SYLF domain-containing protein 0.9328 26 182
AF-A0A1V0B3D6-F1-model_v4 Twin-arginine translocation pathway signal protein 0.9322 30 179

Map