F461236

General Info

Members Datasets Scaffolds Average Seq Length
540 308 530 150

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10570499|Ga0213876_105704991
Length 173
Sequence VFVRGRSSTTRRATAHRDHERVRQTHVRTYSPKPGDVQREWHVIDATDIVLGKLAVQAANLLRGKHKPTFAPHMDMGDFVIVVNAEKVALTGDKATSKLLYRHSGYPGGLTATPVGKQLEKDARKVIEGAVWGMLPKNKLGRQVLKKLKVYAGPTHPHQAQQAKPFEITQVSQ

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
4 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
5 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
6 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
7 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
72 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
88 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
131 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
132 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
165 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
270 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 649633069 Micromonospora sp. L5 Isolate Unclassified
307 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
308 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.3
Metatranscriptomes 26.85
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0
Rhizoplane 6.11
Rhizosphere 89.44
Stem 0
Stem Tuber 0
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10095261 3300003203 Bacteria 893
2 Ga0006777J48905_1036991 3300003308 Bacteria 594
3 Ga0007410J51695_1072619 3300003574 Bacteria 649
4 Ga0032354_1115994 3300003693 Bacteria 566
5 Ga0058859_10019153 3300004798 Bacteria 699
6 Ga0058861_11944092 3300004800 Bacteria 683
7 Ga0058861_12045397 3300004800 Bacteria 789
8 Ga0058860_10006825 3300004801 Bacteria 554
9 Ga0058862_12861556 3300004803 Bacteria 956
10 Ga0070683_100154117 3300005329 Bacteria 2179
11 Ga0070683_100225583 3300005329 Bacteria 1780
12 Ga0070683_100540742 3300005329 Bacteria 1114
13 Ga0070683_100818630 3300005329 Bacteria 893
14 Ga0070682_100125048 3300005337 Bacteria 1732
15 Ga0070682_101106624 3300005337 Bacteria 664
16 Ga0070675_100542834 3300005354 Bacteria 1051
17 Ga0070674_100623435 3300005356 Bacteria 914
18 Ga0070673_100904133 3300005364 Bacteria 819
19 Ga0070709_10001455 3300005434 Bacteria 12750
20 Ga0070714_100052022 3300005435 Bacteria 3493
21 Ga0070714_100156558 3300005435 Bacteria 2057
22 Ga0070714_100236242 3300005435 Bacteria 1685
23 Ga0070713_100011062 3300005436 Bacteria 6554
24 Ga0070713_100020440 3300005436 Bacteria 5076
25 Ga0070713_100161382 3300005436 Bacteria 2001
26 Ga0070710_10001125 3300005437 Bacteria 12648
27 Ga0070710_10007540 3300005437 Bacteria 5269
28 Ga0070701_10710556 3300005438 Bacteria 677
29 Ga0070711_100005971 3300005439 Bacteria 7313
30 Ga0070711_100028529 3300005439 Bacteria 3673
31 Ga0070700_100080477 3300005441 Bacteria 2102
32 Ga0070700_100118606 3300005441 Bacteria 1770
33 Ga0070708_100053481 3300005445 Bacteria 3582
34 Ga0070708_100079517 3300005445 Bacteria 2966
35 Ga0070678_100422092 3300005456 Bacteria 1163
36 Ga0070706_100006965 3300005467 Bacteria 10663
37 Ga0070706_100352591 3300005467 Bacteria 1371
38 Ga0070707_100002209 3300005468 Bacteria 18562
39 Ga0070707_100006776 3300005468 Bacteria 10608
40 Ga0070707_100112347 3300005468 Bacteria 2642
41 Ga0070698_100001064 3300005471 Bacteria 30146
42 Ga0070698_100001092 3300005471 Bacteria 29843
43 Ga0070699_100151677 3300005518 Bacteria 2050
44 Ga0070699_100708604 3300005518 Bacteria 920
45 Ga0070679_100284160 3300005530 Bacteria 1607
46 Ga0070679_100333778 3300005530 Bacteria 1464
47 Ga0070684_100264225 3300005535 Bacteria 1574
48 Ga0070684_100299370 3300005535 Bacteria 1476
49 Ga0070697_100045343 3300005536 Bacteria 3563
50 Ga0070697_100373844 3300005536 Bacteria 1233
51 Ga0070672_100343184 3300005543 Bacteria 1272
52 Ga0070665_100001255 3300005548 Bacteria 30600
53 Ga0068856_100320680 3300005614 Bacteria 1567
54 Ga0070702_100497200 3300005615 Bacteria 895
55 Ga0068852_100401355 3300005616 Bacteria 1348
56 Ga0068852_100439459 3300005616 Bacteria 1290
57 Ga0068864_100307428 3300005618 Bacteria 1486
58 Ga0068861_100326108 3300005719 Bacteria 1339
59 Ga0068858_100148884 3300005842 Bacteria 2200
60 Ga0081455_10219428 3300005937 Bacteria 1410
61 Ga0081539_10000109 3300005985 Bacteria 193696
62 Ga0081539_10001279 3300005985 Bacteria 44286
63 Ga0081539_10013009 3300005985 Bacteria 6319
64 Ga0081539_10110835 3300005985 Bacteria 1382
65 Ga0070717_10001284 3300006028 Bacteria 17163
66 Ga0070717_10064517 3300006028 Bacteria 3042
67 Ga0070717_10224132 3300006028 Bacteria 1653
68 Ga0070717_10475191 3300006028 Bacteria 1128
69 Ga0075365_10014105 3300006038 Bacteria 4800
70 Ga0075365_10082498 3300006038 Bacteria 2180
71 Ga0070715_10011755 3300006163 Bacteria 3162
72 Ga0070716_100001036 3300006173 Bacteria 12180
73 Ga0070716_100003067 3300006173 Bacteria 7797
74 Ga0070712_100003579 3300006175 Bacteria 9571
75 Ga0070712_100038079 3300006175 Bacteria 3283
76 Ga0097621_101216898 3300006237 Bacteria 710
77 Ga0097621_101319690 3300006237 Bacteria 682
78 Ga0097621_101347764 3300006237 Bacteria 675
79 Ga0075428_100000164 3300006844 Bacteria 61044
80 Ga0075428_100323190 3300006844 Bacteria 1658
81 Ga0075428_100872424 3300006844 Bacteria 955
82 Ga0075428_100895020 3300006844 Bacteria 941
83 Ga0075430_100017165 3300006846 Bacteria 6163
84 Ga0075431_100132615 3300006847 Bacteria 2569
85 Ga0075431_100236960 3300006847 Bacteria 1857
86 Ga0075433_10052435 3300006852 Bacteria 3554
87 Ga0075434_100037594 3300006871 Bacteria 4793
88 Ga0075429_100040914 3300006880 Bacteria 4035
89 Ga0075429_100119690 3300006880 Bacteria 2301
90 Ga0068865_100025829 3300006881 Bacteria 3867
91 Ga0075436_100066281 3300006914 Bacteria 2495
92 Ga0075436_100087700 3300006914 Bacteria 2161
93 Ga0075435_100097305 3300007076 Bacteria 2435
94 Ga0075435_100192125 3300007076 Bacteria 1728
95 Ga0111539_10086254 3300009094 Bacteria 3689
96 Ga0111539_10544147 3300009094 Bacteria 1353
97 Ga0114129_10003730 3300009147 Bacteria 21471
98 Ga0114129_10156346 3300009147 Bacteria 3117
99 Ga0105243_10090270 3300009148 Bacteria 2521
100 Ga0105243_10153159 3300009148 Bacteria 1980
101 Ga0105243_10243779 3300009148 Bacteria 1601
102 Ga0105241_10567665 3300009174 Bacteria 1021
103 Ga0105242_10215773 3300009176 Bacteria 1712
104 Ga0105238_10874906 3300009551 Bacteria 916
105 Ga0105238_11240680 3300009551 Bacteria 770
106 Ga0105249_10268781 3300009553 Bacteria 1698
107 Ga0105239_10002486 3300010375 Bacteria 23478
108 Ga0105239_10332976 3300010375 Bacteria 1713
109 Ga0105246_10000375 3300011119 Bacteria 23857
110 Ga0157317_1014206 3300012475 Bacteria 649
111 Ga0154016_142311 3300013045 Bacteria 581
112 Ga0157373_10110790 3300013100 Bacteria 1930
113 Ga0157369_10015392 3300013105 Bacteria 8623
114 Ga0157369_10142373 3300013105 Bacteria 2537
115 Ga0157369_10334496 3300013105 Bacteria 1573
116 Ga0157374_10656699 3300013296 Bacteria 1061
117 Ga0157374_11228528 3300013296 Bacteria 771
118 Ga0163162_10273040 3300013306 Bacteria 1823
119 Ga0163162_10772735 3300013306 Bacteria 1079
120 Ga0157372_10058284 3300013307 Bacteria 4316
121 Ga0157372_10213914 3300013307 Bacteria 2234
122 Ga0157372_11863323 3300013307 Bacteria 691
123 Ga0157375_10038724 3300013308 Bacteria 4580
124 Ga0157375_10965135 3300013308 Bacteria 993
125 Ga0163163_10081345 3300014325 Bacteria 3241
126 Ga0163163_10610100 3300014325 Bacteria 1154
127 Ga0163163_10639673 3300014325 Bacteria 1127
128 Ga0157380_10755521 3300014326 Bacteria 984
129 Ga0157379_10267367 3300014968 Bacteria 1554
130 Ga0157379_10353568 3300014968 Bacteria 1345
131 Ga0163161_10307386 3300017792 Bacteria 1250
132 Ga0184600_117791 3300019190 Bacteria 594
133 Ga0197907_10290678 3300020069 Bacteria 1853
134 Ga0197907_10662353 3300020069 Bacteria 611
135 Ga0197907_11132255 3300020069 Bacteria 635
136 Ga0197907_11210708 3300020069 Bacteria 629
137 Ga0206356_10202265 3300020070 Bacteria 570
138 Ga0206356_10205106 3300020070 Bacteria 2555
139 Ga0206356_10809232 3300020070 Bacteria 623
140 Ga0206349_1054364 3300020075 Bacteria 1137
141 Ga0206349_1166079 3300020075 Bacteria 1351
142 Ga0206349_1491499 3300020075 Bacteria 882
143 Ga0206349_1652759 3300020075 Bacteria 964
144 Ga0206355_1162727 3300020076 Bacteria 1016
145 Ga0206355_1407193 3300020076 Bacteria 943
146 Ga0206351_10545088 3300020077 Bacteria 1294
147 Ga0206351_10895652 3300020077 Bacteria 645
148 Ga0206352_10079568 3300020078 Bacteria 850
149 Ga0206352_10108346 3300020078 Bacteria 1112
150 Ga0206352_10225768 3300020078 Bacteria 953
151 Ga0206350_10330016 3300020080 Bacteria 898
152 Ga0206354_10007464 3300020081 Bacteria 823
153 Ga0206354_11039646 3300020081 Bacteria 601
154 Ga0206354_11448685 3300020081 Bacteria 1796
155 Ga0206354_11695497 3300020081 Bacteria 671
156 Ga0206353_11556168 3300020082 Bacteria 2007
157 Ga0154015_1233679 3300020610 Bacteria 667
158 Ga0154015_1552073 3300020610 Bacteria 990
159 Ga0213876_10570499 3300021384 Bacteria 602
160 Ga0213875_10002764 3300021388 Bacteria 10358
161 Ga0224712_10109006 3300022467 Bacteria 1185
162 Ga0207692_10000557 3300025898 Bacteria 13254
163 Ga0207692_10002027 3300025898 Bacteria 7731
164 Ga0207688_10021140 3300025901 Bacteria 3554
165 Ga0207685_10010246 3300025905 Bacteria 2758
166 Ga0207699_10000106 3300025906 Bacteria 58842
167 Ga0207699_10005750 3300025906 Bacteria 5966
168 Ga0207684_10001153 3300025910 Bacteria 29491
169 Ga0207684_10002031 3300025910 Bacteria 20859
170 Ga0207684_10194672 3300025910 Bacteria 1749
171 Ga0207684_10393451 3300025910 Bacteria 1191
172 Ga0207693_10001488 3300025915 Bacteria 20694
173 Ga0207693_10071464 3300025915 Bacteria 2716
174 Ga0207663_10003956 3300025916 Bacteria 7330
175 Ga0207663_10006837 3300025916 Bacteria 5872
176 Ga0207663_10525783 3300025916 Bacteria 922
177 Ga0207660_11324508 3300025917 Bacteria 584
178 Ga0207657_10066977 3300025919 Bacteria 3055
179 Ga0207652_10205613 3300025921 Bacteria 1772
180 Ga0207646_10001638 3300025922 Bacteria 27351
181 Ga0207646_10008339 3300025922 Bacteria 10397
182 Ga0207646_10012907 3300025922 Bacteria 8007
183 Ga0207646_10104990 3300025922 Bacteria 2533
184 Ga0207694_11626759 3300025924 Bacteria 544
185 Ga0207687_10013387 3300025927 Bacteria 5356
186 Ga0207700_10002205 3300025928 Bacteria 11178
187 Ga0207700_10002355 3300025928 Bacteria 10850
188 Ga0207700_10007455 3300025928 Bacteria 6685
189 Ga0207700_10146857 3300025928 Bacteria 1944
190 Ga0207700_10818224 3300025928 Bacteria 833
191 Ga0207664_10004846 3300025929 Bacteria 9151
192 Ga0207664_10011089 3300025929 Bacteria 6387
193 Ga0207664_10012295 3300025929 Bacteria 6115
194 Ga0207664_10340641 3300025929 Bacteria 1326
195 Ga0207709_10211059 3300025935 Bacteria 1393
196 Ga0207670_10394924 3300025936 Bacteria 1105
197 Ga0207669_10733269 3300025937 Bacteria 815
198 Ga0207704_11025787 3300025938 Bacteria 699
199 Ga0207665_10000812 3300025939 Bacteria 21111
200 Ga0207665_10002563 3300025939 Bacteria 12203
201 Ga0207691_10289076 3300025940 Bacteria 1410
202 Ga0207661_10030791 3300025944 Bacteria 4137
203 Ga0207661_10039725 3300025944 Bacteria 3695
204 Ga0207651_10228281 3300025960 Bacteria 1510
205 Ga0207658_10512494 3300025986 Bacteria 1070
206 Ga0207703_11666711 3300026035 Bacteria 613
207 Ga0207708_10202673 3300026075 Bacteria 1583
208 Ga0207675_100973958 3300026118 Bacteria 866
209 Ga0207683_10196077 3300026121 Bacteria 1835
210 Ga0207683_10549034 3300026121 Bacteria 1068
211 Ga0207698_10328466 3300026142 Bacteria 1436
212 Ga0207698_10721099 3300026142 Bacteria 994
213 Ga0207428_10255197 3300027907 Bacteria 1307
214 Ga0268266_10008784 3300028379 Bacteria 8956
215 Ga0265760_10021225 3300031090 Bacteria 1878
216 Ga0307508_10049690 3300031616 Bacteria 3735
217 Ga0310113_121820 3300031636 Bacteria 655
218 Ga0307514_10290350 3300031649 Bacteria 926
219 Ga0310111_122074 3300031667 Bacteria 770
220 Ga0307405_10502973 3300031731 Bacteria 972
221 Ga0307413_10465162 3300031824 Bacteria 1007
222 Ga0307406_10017188 3300031901 Bacteria 4211
223 Ga0307416_100200474 3300032002 Bacteria 1893
224 Ga0307416_101221898 3300032002 Bacteria 857
225 Ga0373926_0007881 3300035083 Bacteria 3548
226 Ga0373926_0227368 3300035083 Bacteria 721
227 Ga0373934_0011736 3300035086 Bacteria 3300
228 Ga0373951_0209917 3300035091 Bacteria 571
229 Ga0373923_0077706 3300035111 Bacteria 1435
230 Ga0373936_0045129 3300035113 Bacteria 1774
231 Ga0373945_0148143 3300035116 Bacteria 950
232 Ga0373945_0154399 3300035116 Bacteria 932
233 Ga0373953_0100873 3300035117 Bacteria 1214
234 Ga0373954_0056344 3300035118 Bacteria 1849
235 Ga0373956_0022380 3300035119 Bacteria 2704
236 Ga0373957_0023880 3300035120 Bacteria 2190
237 Ga0373957_0090705 3300035120 Bacteria 1214
238 Ga0373943_0064053 3300035170 Bacteria 1845
239 Ga0373943_0103053 3300035170 Bacteria 1495
240 Ga0373943_0445793 3300035170 Bacteria 752
241 Ga0373946_0092426 3300035171 Bacteria 1343
242 Ga0373955_0005831 3300035172 Bacteria 5562
243 Ga0373955_0127980 3300035172 Bacteria 1481
244 Ga0373955_0262230 3300035172 Bacteria 1037
245 Ga0373924_0505734 3300035410 Bacteria 543
246 Ga0373935_0001997 3300035692 Bacteria 11496
247 Ga0373935_0081531 3300035692 Bacteria 2103
248 Ga0373935_0160004 3300035692 Bacteria 1534
249 Ga0373935_0670900 3300035692 Bacteria 761
250 Ga0373927_0350383 3300035695 Bacteria 973
251 Ga0373933_0140149 3300035724 Bacteria 1526
252 Ga0373933_0190478 3300035724 Bacteria 1310
253 Ga0373933_0201506 3300035724 Bacteria 1273
254 Ga0373947_0000004 3300035725 Bacteria 248228
255 Ga0373947_0124526 3300035725 Bacteria 1640
256 Ga0373937_0017771 3300036401 Bacteria 6344
257 Ga0373925_0003782 3300037068 Bacteria 11638
258 Ga0373925_0049135 3300037068 Bacteria 3144
259 Ga0373925_0119304 3300037068 Bacteria 2046
260 Ga0395899_0056163 3300037312 Bacteria 2910
261 Ga0395900_0147607 3300037418 Bacteria 2404
262 Ga0395900_0772275 3300037418 Bacteria 890
263 Ga0395898_0030030 3300037466 Bacteria 5441
264 Ga0436364_0385416 3300037853 Bacteria 26442
265 Ga0436364_0409793 3300037853 Bacteria 2978
266 Ga0395901_0054733 3300038443 Bacteria 4147
267 Ga0436365_1816359 3300039437 Bacteria 891
268 Ga0436363_1458574 3300039450 Bacteria 614
269 Ga0451790_33454 3300041444 Bacteria 794
270 Ga0451792_20358 3300041445 Bacteria 620
271 Ga0451793_1537465 3300041452 Bacteria 643
272 Ga0451853_3672276 3300041512 Bacteria 1561
273 Ga0466969_0074639 3300044656 Bacteria 1626
274 Ga0466969_0201771 3300044656 Bacteria 907
275 Ga0466966_0007159 3300044684 Bacteria 7393
276 Ga0466966_0429874 3300044684 Bacteria 794
277 Ga0466961_0122139 3300044693 Bacteria 1634
278 Ga0466961_0474089 3300044693 Bacteria 757
279 Ga0466963_0013682 3300044694 Bacteria 4989
280 Ga0466963_0231822 3300044694 Bacteria 1294
281 Ga0466971_0018447 3300044719 Bacteria 3090
282 Ga0466970_0093046 3300044765 Bacteria 1637
283 Ga0466970_0195330 3300044765 Bacteria 1125
284 Ga0466970_0588276 3300044765 Bacteria 645
285 Ga0466957_0223574 3300044842 Bacteria 1244
286 Ga0466957_0642505 3300044842 Bacteria 745
287 Ga0466960_0024128 3300044901 Bacteria 2740
288 Ga0466960_0317345 3300044901 Bacteria 882
289 Ga0466967_0029836 3300045976 Bacteria 4570
290 Ga0495629_0089546 3300046459 Bacteria 2146
291 Ga0495629_0169963 3300046459 Bacteria 1513
292 Ga0495641_0082391 3300046461 Bacteria 1440
293 Ga0495651_0009348 3300046462 Bacteria 7523
294 Ga0495651_0197298 3300046462 Bacteria 1411
295 Ga0495653_0074168 3300046463 Bacteria 2536
296 Ga0495653_0199725 3300046463 Bacteria 1358
297 Ga0495653_0252246 3300046463 Bacteria 1170
298 Ga0495580_0136672 3300046472 Bacteria 1700
299 Ga0495582_0318642 3300046473 Bacteria 894
300 Ga0495662_0049388 3300046476 Bacteria 2030
301 Ga0495664_0013997 3300046477 Bacteria 4544
302 Ga0495664_0056528 3300046477 Bacteria 2334
303 Ga0495664_0084322 3300046477 Bacteria 1907
304 Ga0495664_0094473 3300046477 Bacteria 1799
305 Ga0495664_0350402 3300046477 Bacteria 889
306 Ga0495608_0039257 3300046511 Bacteria 3174
307 Ga0495608_0085273 3300046511 Bacteria 2047
308 Ga0495618_0404296 3300046514 Bacteria 834
309 Ga0495628_0098369 3300046516 Bacteria 2260
310 Ga0495628_0117967 3300046516 Bacteria 2037
311 Ga0495630_0153243 3300046517 Bacteria 1754
312 Ga0495630_0316593 3300046517 Bacteria 1193
313 Ga0495666_0132013 3300046526 Bacteria 1167
314 Ga0495652_0023588 3300046529 Bacteria 5454
315 Ga0495652_0248495 3300046529 Bacteria 1319
316 Ga0495652_0404635 3300046529 Bacteria 965
317 Ga0495665_0071907 3300046531 Bacteria 1821
318 Ga0495586_0067787 3300046535 Bacteria 1946
319 Ga0495586_0391505 3300046535 Bacteria 799
320 Ga0495645_0086892 3300046543 Bacteria 2237
321 Ga0495645_0109212 3300046543 Bacteria 1958
322 Ga0495645_0207619 3300046543 Bacteria 1324
323 Ga0495667_0003897 3300046559 Bacteria 10011
324 Ga0495667_0073522 3300046559 Bacteria 2226
325 Ga0495634_0068703 3300046642 Bacteria 2339
326 Ga0495635_0214659 3300046663 Bacteria 1302
327 Ga0495657_0002905 3300046675 Bacteria 14216
328 Ga0495657_0080391 3300046675 Bacteria 2110
329 Ga0495657_0198217 3300046675 Bacteria 1224
330 Ga0495599_0149766 3300046678 Bacteria 1445
331 Ga0495599_0156593 3300046678 Bacteria 1409
332 Ga0495599_0314480 3300046678 Bacteria 943
333 Ga0495599_0371764 3300046678 Bacteria 854
334 Ga0495623_0078419 3300046679 Bacteria 2047
335 Ga0495623_0175326 3300046679 Bacteria 1249
336 Ga0495646_0123300 3300046680 Bacteria 1464
337 Ga0495646_0151355 3300046680 Bacteria 1290
338 Ga0495658_0007574 3300046683 Bacteria 5382
339 Ga0495658_0154646 3300046683 Bacteria 1411
340 Ga0495624_0041470 3300046690 Bacteria 2943
341 Ga0495624_0566428 3300046690 Bacteria 678
342 Ga0495600_0001528 3300046809 Bacteria 12859
343 Ga0495600_0052964 3300046809 Bacteria 2650
344 Ga0495600_0112950 3300046809 Bacteria 1769
345 Ga0495581_0063337 3300047315 Bacteria 2137
346 Ga0495581_0120987 3300047315 Bacteria 1523
347 Ga0495604_0039494 3300047317 Bacteria 3709
348 Ga0495674_0033733 3300047319 Bacteria 4633
349 Ga0495674_0274138 3300047319 Bacteria 1383
350 Ga0495680_0012040 3300047322 Bacteria 7632
351 Ga0495680_0035576 3300047322 Bacteria 4009
352 Ga0495675_0054121 3300047444 Bacteria 2547
353 Ga0495675_0074293 3300047444 Bacteria 2142
354 Ga0495684_0151628 3300047471 Bacteria 1732
355 Ga0495684_0208268 3300047471 Bacteria 1439
356 Ga0495593_0022927 3300047673 Bacteria 3474
357 Ga0495602_0096402 3300048088 Bacteria 2439
358 Ga0496100_0543618 3300048903 Bacteria 898
359 Ga0496101_0857342 3300048904 Bacteria 716
360 Ga0496102_0444429 3300048905 Bacteria 1216
361 Ga0496102_1579399 3300048905 Bacteria 574
362 Ga0496104_1487660 3300048907 Bacteria 580
363 Ga0496105_0651893 3300048908 Bacteria 812
364 Ga0496106_0249673 3300048909 Bacteria 1418
365 Ga0496107_1270091 3300048910 Bacteria 527
366 Ga0496108_0815701 3300048911 Bacteria 804
367 Ga0496108_1295446 3300048911 Bacteria 613
368 Ga0496109_0006223 3300048912 Bacteria 10035
369 Ga0496109_0076819 3300048912 Bacteria 3072
370 Ga0496109_0977502 3300048912 Bacteria 784
371 Ga0496110_0102021 3300048913 Bacteria 2573
372 Ga0496110_0224581 3300048913 Bacteria 1708
373 Ga0496110_0842130 3300048913 Bacteria 822
374 Ga0496110_1011503 3300048913 Bacteria 739
375 Ga0496110_1073286 3300048913 Bacteria 713
376 Ga0496111_0401551 3300048914 Bacteria 1013
377 Ga0496111_0506838 3300048914 Bacteria 888
378 Ga0496111_1137974 3300048914 Bacteria 555
379 Ga0496112_0327797 3300048915 Bacteria 1475
380 Ga0496112_0614954 3300048915 Bacteria 1018
381 Ga0496113_0065187 3300048916 Bacteria 2756
382 Ga0496114_0046928 3300048917 Bacteria 3591
383 Ga0496114_0124765 3300048917 Bacteria 2218
384 Ga0496114_0280343 3300048917 Bacteria 1469
385 Ga0496115_0004812 3300048918 Bacteria 9796
386 Ga0496115_0733495 3300048918 Bacteria 774
387 Ga0496115_1204179 3300048918 Bacteria 569
388 Ga0501306_023572 3300049127 Bacteria 875
389 Ga0501306_058205 3300049127 Bacteria 632
390 Ga0501308_043850 3300049128 Bacteria 637
391 Ga0501308_054250 3300049128 Bacteria 593
392 Ga0501308_077514 3300049128 Bacteria 525
393 Ga0501309_072407 3300049129 Bacteria 568
394 Ga0501310_044852 3300049130 Bacteria 625
395 Ga0501305_023625 3300049161 Bacteria 922
396 Ga0501307_001336 3300049162 Bacteria 2053
397 Ga0501307_054604 3300049162 Bacteria 607
398 Ga0501311_019745 3300049527 Bacteria 906
399 Ga0501311_047787 3300049527 Bacteria 664
400 Ga0501311_055699 3300049527 Bacteria 628
401 Ga0501311_063647 3300049527 Bacteria 600
402 Ga0501313_020247 3300049529 Bacteria 818
403 Ga0501313_025087 3300049529 Bacteria 753
404 Ga0501313_026295 3300049529 Bacteria 740
405 Ga0501315_055600 3300049531 Bacteria 631
406 Ga0501316_034830 3300049532 Bacteria 686
407 Ga0501317_012077 3300049533 Bacteria 1061
408 Ga0501317_027795 3300049533 Bacteria 805
409 Ga0501318_008937 3300049534 Bacteria 1082
410 Ga0501318_009493 3300049534 Bacteria 1063
411 Ga0501318_080983 3300049534 Bacteria 526
412 Ga0501319_020683 3300049535 Bacteria 588
413 Ga0501320_014836 3300049536 Bacteria 846
414 Ga0501321_010891 3300049537 Bacteria 1006
415 Ga0501321_014307 3300049537 Bacteria 922
416 Ga0501321_046387 3300049537 Bacteria 624
417 Ga0501322_017710 3300049538 Bacteria 605
418 Ga0501325_038262 3300049541 Bacteria 575
419 Ga0501325_050940 3300049541 Bacteria 527
420 Ga0501040_0413671 3300049576 Bacteria 969
421 Ga0501041_0405131 3300049577 Bacteria 864
422 Ga0501067_0289343 3300049583 Bacteria 912
423 Ga0501069_0059364 3300049585 Bacteria 2134
424 Ga0501069_0335599 3300049585 Bacteria 890
425 Ga0501070_0010837 3300049586 Bacteria 7701
426 Ga0501073_0432901 3300049589 Bacteria 909
427 Ga0501209_214775 3300049656 Bacteria 595
428 Ga0501035_0420128 3300049822 Bacteria 1110
429 Ga0501045_0923279 3300049824 Bacteria 641
430 nmdc:mga03n38_589149_c1 3300050490 Bacteria 632
431 nmdc:mga0yw44_267835_c1 3300050492 Bacteria 1140
432 nmdc:mga0yw44_9555_c1 3300050492 Bacteria 4913
433 nmdc:mga05p37_67921_c1 3300050507 Bacteria 4385
434 nmdc:mga09592_435449_c1 3300050508 Bacteria 1132
435 nmdc:mga09592_46945_c1 3300050508 Bacteria 3639
436 nmdc:mga0qj67_29258_c1 3300050509 Bacteria 4279
437 nmdc:mga06r32_218905_c1 3300050510 Bacteria 1892
438 nmdc:mga06r32_44584_c1 3300050510 Bacteria 4224
439 nmdc:mga08y16_853149_c1 3300050511 Bacteria 900
440 nmdc:mga0n895_1419_c1 3300050512 Bacteria 17911
441 nmdc:mga0n895_525564_c1 3300050512 Bacteria 1191
442 nmdc:mga0n895_974406_c1 3300050512 Bacteria 830
443 nmdc:mga0rr50_140769_c1 3300050513 Bacteria 1941
444 nmdc:mga0rr50_714675_c1 3300050513 Bacteria 855
445 nmdc:mga08x19_209758_c1 3300050514 Bacteria 1337
446 nmdc:mga0a205_179782_c1 3300050515 Bacteria 2010
447 nmdc:mga0a205_48045_c1 3300050515 Bacteria 4118
448 Ga0495601_0034207 3300053077 Bacteria 3169
449 Ga0495601_0135030 3300053077 Bacteria 1608
450 Ga0495612_0026568 3300053078 Bacteria 2326
451 Ga0495612_0045916 3300053078 Bacteria 1788
452 Ga0495655_0052690 3300053083 Bacteria 1083
453 Ga0495595_0065258 3300053084 Bacteria 1712
454 Ga0495619_0041284 3300053085 Bacteria 3017
455 Ga0495619_0084296 3300053085 Bacteria 2144
456 Ga0495619_0125319 3300053085 Bacteria 1763
457 Ga0500628_042839 3300053129 Bacteria 1042
458 Ga0587084_051027 3300059477 Bacteria 732
459 Ga0587084_069534 3300059477 Bacteria 662
460 Ga0587093_036556 3300059478 Bacteria 729
461 Ga0587093_057695 3300059478 Bacteria 627
462 Ga0587070_074348 3300059491 Bacteria 732
463 Ga0587070_091414 3300059491 Bacteria 685
464 Ga0587070_109411 3300059491 Bacteria 647
465 Ga0587070_138455 3300059491 Bacteria 599
466 Ga0587070_155549 3300059491 Bacteria 577
467 Ga0587073_0219509 3300059492 Bacteria 580
468 Ga0587077_124303 3300059493 Bacteria 647
469 Ga0587077_126608 3300059493 Bacteria 643
470 Ga0587077_143113 3300059493 Bacteria 618
471 Ga0587077_154535 3300059493 Bacteria 602
472 Ga0587080_076739 3300059503 Bacteria 678
473 Ga0587080_098313 3300059503 Bacteria 623
474 Ga0587080_117477 3300059503 Bacteria 586
475 Ga0587083_0099434 3300059505 Bacteria 722
476 Ga0587083_0104143 3300059505 Bacteria 711
477 Ga0587083_0142526 3300059505 Bacteria 640
478 Ga0587083_0156281 3300059505 Bacteria 620
479 Ga0587083_0189247 3300059505 Bacteria 581
480 Ga0587086_063251 3300059507 Bacteria 621
481 Ga0587088_027532 3300059508 Bacteria 994
482 Ga0587088_061047 3300059508 Bacteria 764
483 Ga0587088_090898 3300059508 Bacteria 668
484 Ga0587090_076169 3300059510 Bacteria 664
485 Ga0587090_082346 3300059510 Bacteria 647
486 Ga0587091_102777 3300059511 Bacteria 672
487 Ga0587092_112698 3300059512 Bacteria 573
488 Ga0587094_054115 3300059513 Bacteria 687
489 Ga0587094_066179 3300059513 Bacteria 642
490 Ga0587095_019857 3300059514 Bacteria 639
491 Ga0587098_034383 3300059604 Bacteria 712
492 Ga0587098_055902 3300059604 Bacteria 609
493 Ga0587106_071987 3300059605 Bacteria 657
494 Ga0587106_087125 3300059605 Bacteria 618
495 Ga0587106_102171 3300059605 Bacteria 587
496 Ga0587099_030169 3300059622 Bacteria 655
497 Ga0587113_022070 3300059625 Bacteria 676
498 Ga0587115_040752 3300059626 Bacteria 724
499 Ga0587115_080901 3300059626 Bacteria 576
500 Ga0587122_038111 3300059628 Bacteria 589
501 Ga0587122_056217 3300059628 Bacteria 520
502 Ga0587128_096340 3300059630 Bacteria 614
503 Ga0587062_058661 3300059639 Bacteria 670
504 Ga0587067_103463 3300059640 Bacteria 662
505 Ga0587068_076878 3300059641 Bacteria 668
506 Ga0587068_099003 3300059641 Bacteria 610
507 Ga0587069_076363 3300059642 Bacteria 646
508 Ga0587075_023131 3300059644 Bacteria 938
509 Ga0587075_099326 3300059644 Bacteria 579
510 Ga0587075_119553 3300059644 Bacteria 544
511 Ga0587076_126025 3300059645 Bacteria 598
512 Ga0587078_047306 3300059646 Bacteria 623
513 Ga0587079_056448 3300059647 Bacteria 839
514 Ga0587079_101398 3300059647 Bacteria 688
515 Ga0587079_126946 3300059647 Bacteria 637
516 Ga0587100_019393 3300059648 Bacteria 652
517 Ga0587102_032557 3300059649 Bacteria 643
518 Ga0587110_037474 3300059654 Bacteria 613
519 Ga0587114_010332 3300059655 Bacteria 1139
520 Ga0587114_056058 3300059655 Bacteria 679
521 Ga0587114_056309 3300059655 Bacteria 679
522 Ga0587071_054436 3300060344 Bacteria 836
523 Ga0587071_126532 3300060344 Bacteria 615
524 Ga0587071_172803 3300060344 Bacteria 550
525 Ga0587111_0035503 3300060346 Bacteria 1040
526 Ga0587111_0122550 3300060346 Bacteria 671
527 Ga0587111_0148043 3300060346 Bacteria 628
528 Ga0587111_0196092 3300060346 Bacteria 570
529 Ga0466962_0010205 3300061719 Bacteria 4511
530 Ga0466962_0066884 3300061719 Bacteria 1716

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100118606 Ga0070700_1001186062 138
2 3300044842 Ga0466957_0223574 Ga0466957_0223574_520_1182 139
3 3300049127 Ga0501306_023572 Ga0501306_023572_137_580 141
4 3300049130 Ga0501310_044852 Ga0501310_044852_51_494 141
5 3300049527 Ga0501311_047787 Ga0501311_047787_139_582 141
6 3300049541 Ga0501325_038262 Ga0501325_038262_63_506 141
7 3300006237 Ga0097621_101319690 Ga0097621_1013196901 143
8 iso_pu_bacteria 2501939600 2501943325 143
9 iso_pu_bacteria 2515154088 2515496639 143
10 iso_pu_bacteria 2515154137 2515756878 143
11 iso_pu_bacteria 2515154203 2516089416 143
12 iso_pu_bacteria 2799112218 2799184960 143
13 iso_pu_bacteria 2856858025 2856858807 143
14 iso_pu_bacteria 2857710386 2857712607 143
15 iso_pu_bacteria 649633069 649810717 143
16 iso_pu_bacteria 8056060235 8056066389 143
17 iso_pu_bacteria 8057568493 8057574246 143
18 3300039450 Ga0436363_1458574 Ga0436363_1458574_126_578 146
19 3300003203 JGI25406J46586_10095261 JGI25406J46586_100952612 147
20 3300003308 Ga0006777J48905_1036991 Ga0006777J48905_10369911 147
21 3300003574 Ga0007410J51695_1072619 Ga0007410J51695_10726191 147
22 3300003693 Ga0032354_1115994 Ga0032354_11159941 147
23 3300004798 Ga0058859_10019153 Ga0058859_100191531 147
24 3300004800 Ga0058861_11944092 Ga0058861_119440921 147
25 3300004800 Ga0058861_12045397 Ga0058861_120453972 147
26 3300004801 Ga0058860_10006825 Ga0058860_100068251 147
27 3300004803 Ga0058862_12861556 Ga0058862_128615562 147
28 3300005329 Ga0070683_100154117 Ga0070683_1001541173 147
29 3300005329 Ga0070683_100225583 Ga0070683_1002255832 147
30 3300005329 Ga0070683_100540742 Ga0070683_1005407422 147
31 3300005329 Ga0070683_100818630 Ga0070683_1008186301 147
32 3300005337 Ga0070682_100125048 Ga0070682_1001250482 147
33 3300005337 Ga0070682_101106624 Ga0070682_1011066241 147
34 3300005354 Ga0070675_100542834 Ga0070675_1005428341 147
35 3300005356 Ga0070674_100623435 Ga0070674_1006234352 147
36 3300005364 Ga0070673_100904133 Ga0070673_1009041332 147
37 3300005434 Ga0070709_10001455 Ga0070709_100014553 147
38 3300005435 Ga0070714_100052022 Ga0070714_1000520223 147
39 3300005435 Ga0070714_100156558 Ga0070714_1001565583 147
40 3300005435 Ga0070714_100236242 Ga0070714_1002362422 147
41 3300005436 Ga0070713_100011062 Ga0070713_1000110624 147
42 3300005436 Ga0070713_100020440 Ga0070713_1000204402 147
43 3300005436 Ga0070713_100161382 Ga0070713_1001613823 147
44 3300005437 Ga0070710_10001125 Ga0070710_1000112511 147
45 3300005437 Ga0070710_10007540 Ga0070710_100075404 147
46 3300005438 Ga0070701_10710556 Ga0070701_107105561 147
47 3300005439 Ga0070711_100005971 Ga0070711_1000059712 147
48 3300005439 Ga0070711_100028529 Ga0070711_1000285294 147
49 3300005441 Ga0070700_100080477 Ga0070700_1000804773 147
50 3300005445 Ga0070708_100053481 Ga0070708_1000534813 147
51 3300005445 Ga0070708_100079517 Ga0070708_1000795171 147
52 3300005456 Ga0070678_100422092 Ga0070678_1004220921 147
53 3300005467 Ga0070706_100006965 Ga0070706_1000069659 147
54 3300005467 Ga0070706_100352591 Ga0070706_1003525912 147
55 3300005468 Ga0070707_100002209 Ga0070707_1000022093 147
56 3300005468 Ga0070707_100006776 Ga0070707_1000067768 147
57 3300005468 Ga0070707_100112347 Ga0070707_1001123472 147
58 3300005471 Ga0070698_100001064 Ga0070698_10000106435 147
59 3300005471 Ga0070698_100001092 Ga0070698_10000109221 147
60 3300005518 Ga0070699_100151677 Ga0070699_1001516772 147
61 3300005518 Ga0070699_100708604 Ga0070699_1007086041 147
62 3300005530 Ga0070679_100284160 Ga0070679_1002841601 147
63 3300005530 Ga0070679_100333778 Ga0070679_1003337781 147
64 3300005535 Ga0070684_100264225 Ga0070684_1002642251 147
65 3300005535 Ga0070684_100299370 Ga0070684_1002993703 147
66 3300005536 Ga0070697_100045343 Ga0070697_1000453433 147
67 3300005536 Ga0070697_100373844 Ga0070697_1003738442 147
68 3300005543 Ga0070672_100343184 Ga0070672_1003431843 147
69 3300005548 Ga0070665_100001255 Ga0070665_1000012557 147
70 3300005614 Ga0068856_100320680 Ga0068856_1003206801 147
71 3300005615 Ga0070702_100497200 Ga0070702_1004972002 147
72 3300005616 Ga0068852_100401355 Ga0068852_1004013552 147
73 3300005616 Ga0068852_100439459 Ga0068852_1004394592 147
74 3300005618 Ga0068864_100307428 Ga0068864_1003074282 147
75 3300005719 Ga0068861_100326108 Ga0068861_1003261082 147
76 3300005842 Ga0068858_100148884 Ga0068858_1001488843 147
77 3300005937 Ga0081455_10219428 Ga0081455_102194282 147
78 3300005985 Ga0081539_10000109 Ga0081539_1000010951 147
79 3300005985 Ga0081539_10001279 Ga0081539_1000127912 147
80 3300005985 Ga0081539_10013009 Ga0081539_100130094 147
81 3300005985 Ga0081539_10110835 Ga0081539_101108351 147
82 3300006028 Ga0070717_10001284 Ga0070717_1000128419 147
83 3300006028 Ga0070717_10064517 Ga0070717_100645172 147
84 3300006028 Ga0070717_10224132 Ga0070717_102241323 147
85 3300006028 Ga0070717_10475191 Ga0070717_104751911 147
86 3300006038 Ga0075365_10014105 Ga0075365_100141052 147
87 3300006038 Ga0075365_10082498 Ga0075365_100824983 147
88 3300006163 Ga0070715_10011755 Ga0070715_100117553 147
89 3300006173 Ga0070716_100001036 Ga0070716_1000010369 147
90 3300006173 Ga0070716_100003067 Ga0070716_1000030677 147
91 3300006175 Ga0070712_100003579 Ga0070712_10000357910 147
92 3300006175 Ga0070712_100038079 Ga0070712_1000380793 147
93 3300006237 Ga0097621_101216898 Ga0097621_1012168981 147
94 3300006237 Ga0097621_101347764 Ga0097621_1013477642 147
95 3300006844 Ga0075428_100000164 Ga0075428_10000016427 147
96 3300006844 Ga0075428_100323190 Ga0075428_1003231902 147
97 3300006844 Ga0075428_100872424 Ga0075428_1008724241 147
98 3300006844 Ga0075428_100895020 Ga0075428_1008950202 147
99 3300006846 Ga0075430_100017165 Ga0075430_1000171657 147
100 3300006847 Ga0075431_100132615 Ga0075431_1001326152 147
101 3300006847 Ga0075431_100236960 Ga0075431_1002369602 147
102 3300006852 Ga0075433_10052435 Ga0075433_100524352 147
103 3300006871 Ga0075434_100037594 Ga0075434_1000375944 147
104 3300006880 Ga0075429_100040914 Ga0075429_1000409143 147
105 3300006880 Ga0075429_100119690 Ga0075429_1001196903 147
106 3300006881 Ga0068865_100025829 Ga0068865_1000258293 147
107 3300006914 Ga0075436_100066281 Ga0075436_1000662813 147
108 3300006914 Ga0075436_100087700 Ga0075436_1000877001 147
109 3300007076 Ga0075435_100097305 Ga0075435_1000973053 147
110 3300007076 Ga0075435_100192125 Ga0075435_1001921251 147
111 3300009094 Ga0111539_10086254 Ga0111539_100862545 147
112 3300009094 Ga0111539_10544147 Ga0111539_105441472 147
113 3300009147 Ga0114129_10003730 Ga0114129_100037307 147
114 3300009147 Ga0114129_10156346 Ga0114129_101563464 147
115 3300009148 Ga0105243_10090270 Ga0105243_100902702 147
116 3300009148 Ga0105243_10153159 Ga0105243_101531592 147
117 3300009148 Ga0105243_10243779 Ga0105243_102437792 147
118 3300009174 Ga0105241_10567665 Ga0105241_105676651 147
119 3300009176 Ga0105242_10215773 Ga0105242_102157733 147
120 3300009551 Ga0105238_10874906 Ga0105238_108749062 147
121 3300009551 Ga0105238_11240680 Ga0105238_112406802 147
122 3300009553 Ga0105249_10268781 Ga0105249_102687813 147
123 3300010375 Ga0105239_10002486 Ga0105239_100024867 147
124 3300010375 Ga0105239_10332976 Ga0105239_103329762 147
125 3300011119 Ga0105246_10000375 Ga0105246_100003757 147
126 3300012475 Ga0157317_1014206 Ga0157317_10142062 147
127 3300013045 Ga0154016_142311 Ga0154016_1423112 147
128 3300013100 Ga0157373_10110790 Ga0157373_101107902 147
129 3300013105 Ga0157369_10015392 Ga0157369_100153925 147
130 3300013105 Ga0157369_10142373 Ga0157369_101423733 147
131 3300013105 Ga0157369_10334496 Ga0157369_103344963 147
132 3300013296 Ga0157374_10656699 Ga0157374_106566992 147
133 3300013296 Ga0157374_11228528 Ga0157374_112285282 147
134 3300013306 Ga0163162_10273040 Ga0163162_102730402 147
135 3300013306 Ga0163162_10772735 Ga0163162_107727351 147
136 3300013307 Ga0157372_10058284 Ga0157372_100582843 147
137 3300013307 Ga0157372_10213914 Ga0157372_102139142 147
138 3300013307 Ga0157372_11863323 Ga0157372_118633231 147
139 3300013308 Ga0157375_10038724 Ga0157375_100387243 147
140 3300013308 Ga0157375_10965135 Ga0157375_109651352 147
141 3300014325 Ga0163163_10081345 Ga0163163_100813454 147
142 3300014325 Ga0163163_10610100 Ga0163163_106101002 147
143 3300014325 Ga0163163_10639673 Ga0163163_106396732 147
144 3300014326 Ga0157380_10755521 Ga0157380_107555212 147
145 3300014968 Ga0157379_10267367 Ga0157379_102673673 147
146 3300014968 Ga0157379_10353568 Ga0157379_103535681 147
147 3300017792 Ga0163161_10307386 Ga0163161_103073861 147
148 3300019190 Ga0184600_117791 Ga0184600_1177911 147
149 3300020069 Ga0197907_10290678 Ga0197907_102906781 147
150 3300020069 Ga0197907_10662353 Ga0197907_106623531 147
151 3300020069 Ga0197907_11132255 Ga0197907_111322551 147
152 3300020069 Ga0197907_11210708 Ga0197907_112107081 147
153 3300020070 Ga0206356_10202265 Ga0206356_102022652 147
154 3300020070 Ga0206356_10205106 Ga0206356_102051063 147
155 3300020070 Ga0206356_10809232 Ga0206356_108092321 147
156 3300020075 Ga0206349_1054364 Ga0206349_10543641 147
157 3300020075 Ga0206349_1166079 Ga0206349_11660791 147
158 3300020075 Ga0206349_1491499 Ga0206349_14914991 147
159 3300020075 Ga0206349_1652759 Ga0206349_16527592 147
160 3300020076 Ga0206355_1162727 Ga0206355_11627271 147
161 3300020076 Ga0206355_1407193 Ga0206355_14071932 147
162 3300020077 Ga0206351_10545088 Ga0206351_105450881 147
163 3300020077 Ga0206351_10895652 Ga0206351_108956521 147
164 3300020078 Ga0206352_10079568 Ga0206352_100795681 147
165 3300020078 Ga0206352_10108346 Ga0206352_101083461 147
166 3300020078 Ga0206352_10225768 Ga0206352_102257682 147
167 3300020080 Ga0206350_10330016 Ga0206350_103300161 147
168 3300020081 Ga0206354_10007464 Ga0206354_100074641 147
169 3300020081 Ga0206354_11039646 Ga0206354_110396461 147
170 3300020081 Ga0206354_11448685 Ga0206354_114486853 147
171 3300020081 Ga0206354_11695497 Ga0206354_116954972 147
172 3300020082 Ga0206353_11556168 Ga0206353_115561682 147
173 3300020610 Ga0154015_1233679 Ga0154015_12336791 147
174 3300020610 Ga0154015_1552073 Ga0154015_15520731 147
175 3300021384 Ga0213876_10570499 Ga0213876_105704991 147
176 3300021388 Ga0213875_10002764 Ga0213875_1000276410 147
177 3300022467 Ga0224712_10109006 Ga0224712_101090062 147
178 3300025898 Ga0207692_10000557 Ga0207692_1000055713 147
179 3300025898 Ga0207692_10002027 Ga0207692_100020273 147
180 3300025901 Ga0207688_10021140 Ga0207688_100211404 147
181 3300025905 Ga0207685_10010246 Ga0207685_100102462 147
182 3300025906 Ga0207699_10000106 Ga0207699_100001062 147
183 3300025906 Ga0207699_10005750 Ga0207699_100057505 147
184 3300025910 Ga0207684_10001153 Ga0207684_1000115340 147
185 3300025910 Ga0207684_10002031 Ga0207684_100020315 147
186 3300025910 Ga0207684_10194672 Ga0207684_101946721 147
187 3300025910 Ga0207684_10393451 Ga0207684_103934512 147
188 3300025915 Ga0207693_10001488 Ga0207693_100014882 147
189 3300025915 Ga0207693_10071464 Ga0207693_100714645 147
190 3300025916 Ga0207663_10003956 Ga0207663_100039562 147
191 3300025916 Ga0207663_10006837 Ga0207663_100068374 147
192 3300025916 Ga0207663_10525783 Ga0207663_105257832 147
193 3300025917 Ga0207660_11324508 Ga0207660_113245081 147
194 3300025919 Ga0207657_10066977 Ga0207657_100669772 147
195 3300025921 Ga0207652_10205613 Ga0207652_102056133 147
196 3300025922 Ga0207646_10001638 Ga0207646_100016387 147
197 3300025922 Ga0207646_10008339 Ga0207646_100083394 147
198 3300025922 Ga0207646_10012907 Ga0207646_100129073 147
199 3300025922 Ga0207646_10104990 Ga0207646_101049901 147
200 3300025924 Ga0207694_11626759 Ga0207694_116267591 147
201 3300025927 Ga0207687_10013387 Ga0207687_100133871 147
202 3300025928 Ga0207700_10002205 Ga0207700_1000220510 147
203 3300025928 Ga0207700_10002355 Ga0207700_100023557 147
204 3300025928 Ga0207700_10007455 Ga0207700_100074557 147
205 3300025928 Ga0207700_10146857 Ga0207700_101468573 147
206 3300025928 Ga0207700_10818224 Ga0207700_108182242 147
207 3300025929 Ga0207664_10004846 Ga0207664_100048462 147
208 3300025929 Ga0207664_10011089 Ga0207664_100110893 147
209 3300025929 Ga0207664_10012295 Ga0207664_100122956 147
210 3300025929 Ga0207664_10340641 Ga0207664_103406411 147
211 3300025935 Ga0207709_10211059 Ga0207709_102110592 147
212 3300025936 Ga0207670_10394924 Ga0207670_103949242 147
213 3300025937 Ga0207669_10733269 Ga0207669_107332692 147
214 3300025938 Ga0207704_11025787 Ga0207704_110257871 147
215 3300025939 Ga0207665_10000812 Ga0207665_1000081219 147
216 3300025939 Ga0207665_10002563 Ga0207665_100025636 147
217 3300025940 Ga0207691_10289076 Ga0207691_102890762 147
218 3300025944 Ga0207661_10030791 Ga0207661_100307911 147
219 3300025944 Ga0207661_10039725 Ga0207661_100397254 147
220 3300025960 Ga0207651_10228281 Ga0207651_102282812 147
221 3300025986 Ga0207658_10512494 Ga0207658_105124941 147
222 3300026035 Ga0207703_11666711 Ga0207703_116667112 147
223 3300026075 Ga0207708_10202673 Ga0207708_102026732 147
224 3300026118 Ga0207675_100973958 Ga0207675_1009739582 147
225 3300026121 Ga0207683_10196077 Ga0207683_101960773 147
226 3300026121 Ga0207683_10549034 Ga0207683_105490342 147
227 3300026142 Ga0207698_10328466 Ga0207698_103284662 147
228 3300026142 Ga0207698_10721099 Ga0207698_107210991 147
229 3300027907 Ga0207428_10255197 Ga0207428_102551972 147
230 3300028379 Ga0268266_10008784 Ga0268266_100087845 147
231 3300031090 Ga0265760_10021225 Ga0265760_100212253 147
232 3300031616 Ga0307508_10049690 Ga0307508_100496902 147
233 3300031636 Ga0310113_121820 Ga0310113_1218201 147
234 3300031649 Ga0307514_10290350 Ga0307514_102903501 147
235 3300031667 Ga0310111_122074 Ga0310111_1220742 147
236 3300031731 Ga0307405_10502973 Ga0307405_105029731 147
237 3300031824 Ga0307413_10465162 Ga0307413_104651622 147
238 3300031901 Ga0307406_10017188 Ga0307406_100171886 147
239 3300032002 Ga0307416_100200474 Ga0307416_1002004743 147
240 3300032002 Ga0307416_101221898 Ga0307416_1012218981 147
241 3300035083 Ga0373926_0007881 Ga0373926_0007881_1769_2248 147
242 3300035083 Ga0373926_0227368 Ga0373926_0227368_190_663 147
243 3300035086 Ga0373934_0011736 Ga0373934_0011736_1667_2140 147
244 3300035091 Ga0373951_0209917 Ga0373951_0209917_15_488 147
245 3300035111 Ga0373923_0077706 Ga0373923_0077706_438_911 147
246 3300035113 Ga0373936_0045129 Ga0373936_0045129_329_802 147
247 3300035116 Ga0373945_0148143 Ga0373945_0148143_464_937 147
248 3300035116 Ga0373945_0154399 Ga0373945_0154399_406_879 147
249 3300035117 Ga0373953_0100873 Ga0373953_0100873_404_877 147
250 3300035118 Ga0373954_0056344 Ga0373954_0056344_406_879 147
251 3300035119 Ga0373956_0022380 Ga0373956_0022380_972_1445 147
252 3300035120 Ga0373957_0023880 Ga0373957_0023880_776_1249 147
253 3300035120 Ga0373957_0090705 Ga0373957_0090705_35_508 147
254 3300035170 Ga0373943_0064053 Ga0373943_0064053_1016_1489 147
255 3300035170 Ga0373943_0103053 Ga0373943_0103053_555_1028 147
256 3300035170 Ga0373943_0445793 Ga0373943_0445793_26_499 147
257 3300035171 Ga0373946_0092426 Ga0373946_0092426_228_701 147
258 3300035172 Ga0373955_0005831 Ga0373955_0005831_2131_2604 147
259 3300035172 Ga0373955_0127980 Ga0373955_0127980_701_1174 147
260 3300035172 Ga0373955_0262230 Ga0373955_0262230_404_877 147
261 3300035410 Ga0373924_0505734 Ga0373924_0505734_48_521 147
262 3300035692 Ga0373935_0001997 Ga0373935_0001997_10432_10911 147
263 3300035692 Ga0373935_0081531 Ga0373935_0081531_409_882 147
264 3300035692 Ga0373935_0160004 Ga0373935_0160004_680_1153 147
265 3300035692 Ga0373935_0670900 Ga0373935_0670900_53_526 147
266 3300035695 Ga0373927_0350383 Ga0373927_0350383_37_510 147
267 3300035724 Ga0373933_0140149 Ga0373933_0140149_859_1332 147
268 3300035724 Ga0373933_0190478 Ga0373933_0190478_818_1291 147
269 3300035724 Ga0373933_0201506 Ga0373933_0201506_404_877 147
270 3300035725 Ga0373947_0000004 Ga0373947_0000004_185511_185990 147
271 3300035725 Ga0373947_0124526 Ga0373947_0124526_35_508 147
272 3300036401 Ga0373937_0017771 Ga0373937_0017771_1704_2177 147
273 3300037068 Ga0373925_0003782 Ga0373925_0003782_10586_11059 147
274 3300037068 Ga0373925_0049135 Ga0373925_0049135_2226_2699 147
275 3300037068 Ga0373925_0119304 Ga0373925_0119304_994_1467 147
276 3300037312 Ga0395899_0056163 Ga0395899_0056163_1243_1686 147
277 3300037418 Ga0395900_0147607 Ga0395900_0147607_1248_1691 147
278 3300037418 Ga0395900_0772275 Ga0395900_0772275_83_526 147
279 3300037466 Ga0395898_0030030 Ga0395898_0030030_227_670 147
280 3300037853 Ga0436364_0385416 Ga0436364_0385416_16295_16738 147
281 3300037853 Ga0436364_0409793 Ga0436364_0409793_1619_2083 147
282 3300038443 Ga0395901_0054733 Ga0395901_0054733_129_572 147
283 3300039437 Ga0436365_1816359 Ga0436365_1816359_141_584 147
284 3300041444 Ga0451790_33454 Ga0451790_33454_110_553 147
285 3300041445 Ga0451792_20358 Ga0451792_20358_92_535 147
286 3300041452 Ga0451793_1537465 Ga0451793_1537465_89_532 147
287 3300041512 Ga0451853_3672276 Ga0451853_3672276_397_840 147
288 3300044656 Ga0466969_0074639 Ga0466969_0074639_683_1126 147
289 3300044656 Ga0466969_0201771 Ga0466969_0201771_317_790 147
290 3300044684 Ga0466966_0007159 Ga0466966_0007159_5749_6192 147
291 3300044684 Ga0466966_0429874 Ga0466966_0429874_38_481 147
292 3300044693 Ga0466961_0122139 Ga0466961_0122139_204_647 147
293 3300044693 Ga0466961_0474089 Ga0466961_0474089_130_603 147
294 3300044694 Ga0466963_0013682 Ga0466963_0013682_671_1114 147
295 3300044694 Ga0466963_0231822 Ga0466963_0231822_573_1046 147
296 3300044719 Ga0466971_0018447 Ga0466971_0018447_1854_2297 147
297 3300044765 Ga0466970_0093046 Ga0466970_0093046_808_1251 147
298 3300044765 Ga0466970_0195330 Ga0466970_0195330_252_695 147
299 3300044765 Ga0466970_0588276 Ga0466970_0588276_38_481 147
300 3300044842 Ga0466957_0642505 Ga0466957_0642505_168_611 147
301 3300044901 Ga0466960_0024128 Ga0466960_0024128_906_1349 147
302 3300044901 Ga0466960_0317345 Ga0466960_0317345_64_507 147
303 3300045976 Ga0466967_0029836 Ga0466967_0029836_1074_1517 147
304 3300046459 Ga0495629_0089546 Ga0495629_0089546_1326_1799 147
305 3300046459 Ga0495629_0169963 Ga0495629_0169963_515_958 147
306 3300046461 Ga0495641_0082391 Ga0495641_0082391_416_889 147
307 3300046462 Ga0495651_0009348 Ga0495651_0009348_1022_1495 147
308 3300046462 Ga0495651_0197298 Ga0495651_0197298_663_1136 147
309 3300046463 Ga0495653_0074168 Ga0495653_0074168_1245_1718 147
310 3300046463 Ga0495653_0199725 Ga0495653_0199725_414_887 147
311 3300046463 Ga0495653_0252246 Ga0495653_0252246_567_1040 147
312 3300046472 Ga0495580_0136672 Ga0495580_0136672_1132_1605 147
313 3300046473 Ga0495582_0318642 Ga0495582_0318642_400_873 147
314 3300046476 Ga0495662_0049388 Ga0495662_0049388_1237_1710 147
315 3300046477 Ga0495664_0013997 Ga0495664_0013997_3669_4142 147
316 3300046477 Ga0495664_0056528 Ga0495664_0056528_1295_1768 147
317 3300046477 Ga0495664_0084322 Ga0495664_0084322_251_724 147
318 3300046477 Ga0495664_0094473 Ga0495664_0094473_941_1414 147
319 3300046477 Ga0495664_0350402 Ga0495664_0350402_197_667 147
320 3300046511 Ga0495608_0039257 Ga0495608_0039257_380_853 147
321 3300046511 Ga0495608_0085273 Ga0495608_0085273_131_604 147
322 3300046514 Ga0495618_0404296 Ga0495618_0404296_231_704 147
323 3300046516 Ga0495628_0098369 Ga0495628_0098369_1004_1477 147
324 3300046516 Ga0495628_0117967 Ga0495628_0117967_97_570 147
325 3300046517 Ga0495630_0153243 Ga0495630_0153243_35_508 147
326 3300046517 Ga0495630_0316593 Ga0495630_0316593_231_674 147
327 3300046526 Ga0495666_0132013 Ga0495666_0132013_391_864 147
328 3300046529 Ga0495652_0023588 Ga0495652_0023588_581_1054 147
329 3300046529 Ga0495652_0248495 Ga0495652_0248495_606_1079 147
330 3300046529 Ga0495652_0404635 Ga0495652_0404635_13_486 147
331 3300046531 Ga0495665_0071907 Ga0495665_0071907_1188_1661 147
332 3300046535 Ga0495586_0067787 Ga0495586_0067787_384_857 147
333 3300046535 Ga0495586_0391505 Ga0495586_0391505_130_603 147
334 3300046543 Ga0495645_0086892 Ga0495645_0086892_279_749 147
335 3300046543 Ga0495645_0109212 Ga0495645_0109212_1138_1611 147
336 3300046543 Ga0495645_0207619 Ga0495645_0207619_668_1141 147
337 3300046559 Ga0495667_0003897 Ga0495667_0003897_9476_9949 147
338 3300046559 Ga0495667_0073522 Ga0495667_0073522_1468_1941 147
339 3300046642 Ga0495634_0068703 Ga0495634_0068703_1468_1941 147
340 3300046663 Ga0495635_0214659 Ga0495635_0214659_426_899 147
341 3300046675 Ga0495657_0002905 Ga0495657_0002905_9347_9820 147
342 3300046675 Ga0495657_0080391 Ga0495657_0080391_1526_1969 147
343 3300046675 Ga0495657_0198217 Ga0495657_0198217_476_949 147
344 3300046678 Ga0495599_0149766 Ga0495599_0149766_231_704 147
345 3300046678 Ga0495599_0156593 Ga0495599_0156593_606_1079 147
346 3300046678 Ga0495599_0314480 Ga0495599_0314480_99_572 147
347 3300046678 Ga0495599_0371764 Ga0495599_0371764_220_693 147
348 3300046679 Ga0495623_0078419 Ga0495623_0078419_1202_1675 147
349 3300046679 Ga0495623_0175326 Ga0495623_0175326_742_1215 147
350 3300046680 Ga0495646_0123300 Ga0495646_0123300_285_758 147
351 3300046680 Ga0495646_0151355 Ga0495646_0151355_358_831 147
352 3300046683 Ga0495658_0007574 Ga0495658_0007574_596_1069 147
353 3300046683 Ga0495658_0154646 Ga0495658_0154646_393_836 147
354 3300046690 Ga0495624_0041470 Ga0495624_0041470_296_769 147
355 3300046690 Ga0495624_0566428 Ga0495624_0566428_170_643 147
356 3300046809 Ga0495600_0001528 Ga0495600_0001528_3481_3954 147
357 3300046809 Ga0495600_0052964 Ga0495600_0052964_1095_1568 147
358 3300046809 Ga0495600_0112950 Ga0495600_0112950_1233_1676 147
359 3300047315 Ga0495581_0063337 Ga0495581_0063337_345_788 147
360 3300047315 Ga0495581_0120987 Ga0495581_0120987_404_877 147
361 3300047317 Ga0495604_0039494 Ga0495604_0039494_1173_1646 147
362 3300047319 Ga0495674_0033733 Ga0495674_0033733_2206_2679 147
363 3300047319 Ga0495674_0274138 Ga0495674_0274138_271_744 147
364 3300047322 Ga0495680_0012040 Ga0495680_0012040_1168_1641 147
365 3300047322 Ga0495680_0035576 Ga0495680_0035576_3374_3847 147
366 3300047444 Ga0495675_0054121 Ga0495675_0054121_213_686 147
367 3300047444 Ga0495675_0074293 Ga0495675_0074293_707_1180 147
368 3300047471 Ga0495684_0151628 Ga0495684_0151628_1099_1572 147
369 3300047471 Ga0495684_0208268 Ga0495684_0208268_227_700 147
370 3300047673 Ga0495593_0022927 Ga0495593_0022927_2487_2960 147
371 3300048088 Ga0495602_0096402 Ga0495602_0096402_1121_1594 147
372 3300048903 Ga0496100_0543618 Ga0496100_0543618_401_844 147
373 3300048904 Ga0496101_0857342 Ga0496101_0857342_91_534 147
374 3300048905 Ga0496102_0444429 Ga0496102_0444429_608_1051 147
375 3300048905 Ga0496102_1579399 Ga0496102_1579399_69_512 147
376 3300048907 Ga0496104_1487660 Ga0496104_1487660_66_539 147
377 3300048908 Ga0496105_0651893 Ga0496105_0651893_359_802 147
378 3300048909 Ga0496106_0249673 Ga0496106_0249673_79_522 147
379 3300048910 Ga0496107_1270091 Ga0496107_1270091_70_513 147
380 3300048911 Ga0496108_0815701 Ga0496108_0815701_24_467 147
381 3300048911 Ga0496108_1295446 Ga0496108_1295446_59_502 147
382 3300048912 Ga0496109_0006223 Ga0496109_0006223_224_667 147
383 3300048912 Ga0496109_0076819 Ga0496109_0076819_562_1005 147
384 3300048912 Ga0496109_0977502 Ga0496109_0977502_325_768 147
385 3300048913 Ga0496110_0102021 Ga0496110_0102021_352_795 147
386 3300048913 Ga0496110_0224581 Ga0496110_0224581_602_1045 147
387 3300048913 Ga0496110_0842130 Ga0496110_0842130_24_467 147
388 3300048913 Ga0496110_1011503 Ga0496110_1011503_60_503 147
389 3300048913 Ga0496110_1073286 Ga0496110_1073286_23_466 147
390 3300048914 Ga0496111_0401551 Ga0496111_0401551_355_798 147
391 3300048914 Ga0496111_0506838 Ga0496111_0506838_434_877 147
392 3300048914 Ga0496111_1137974 Ga0496111_1137974_55_498 147
393 3300048915 Ga0496112_0327797 Ga0496112_0327797_493_936 147
394 3300048915 Ga0496112_0614954 Ga0496112_0614954_69_512 147
395 3300048916 Ga0496113_0065187 Ga0496113_0065187_2025_2468 147
396 3300048917 Ga0496114_0046928 Ga0496114_0046928_2825_3268 147
397 3300048917 Ga0496114_0124765 Ga0496114_0124765_1341_1784 147
398 3300048917 Ga0496114_0280343 Ga0496114_0280343_396_839 147
399 3300048918 Ga0496115_0004812 Ga0496115_0004812_6115_6558 147
400 3300048918 Ga0496115_0733495 Ga0496115_0733495_113_556 147
401 3300048918 Ga0496115_1204179 Ga0496115_1204179_49_498 147
402 3300049127 Ga0501306_058205 Ga0501306_058205_176_619 147
403 3300049128 Ga0501308_043850 Ga0501308_043850_51_494 147
404 3300049128 Ga0501308_054250 Ga0501308_054250_84_527 147
405 3300049128 Ga0501308_077514 Ga0501308_077514_36_479 147
406 3300049129 Ga0501309_072407 Ga0501309_072407_109_552 147
407 3300049161 Ga0501305_023625 Ga0501305_023625_145_588 147
408 3300049162 Ga0501307_001336 Ga0501307_001336_1463_1906 147
409 3300049162 Ga0501307_054604 Ga0501307_054604_42_485 147
410 3300049527 Ga0501311_019745 Ga0501311_019745_420_863 147
411 3300049527 Ga0501311_055699 Ga0501311_055699_139_582 147
412 3300049527 Ga0501311_063647 Ga0501311_063647_114_557 147
413 3300049529 Ga0501313_020247 Ga0501313_020247_121_564 147
414 3300049529 Ga0501313_025087 Ga0501313_025087_283_726 147
415 3300049529 Ga0501313_026295 Ga0501313_026295_98_541 147
416 3300049531 Ga0501315_055600 Ga0501315_055600_114_563 147
417 3300049532 Ga0501316_034830 Ga0501316_034830_98_541 147
418 3300049533 Ga0501317_012077 Ga0501317_012077_140_583 147
419 3300049533 Ga0501317_027795 Ga0501317_027795_54_503 147
420 3300049534 Ga0501318_008937 Ga0501318_008937_148_591 147
421 3300049534 Ga0501318_009493 Ga0501318_009493_149_592 147
422 3300049534 Ga0501318_080983 Ga0501318_080983_30_479 147
423 3300049535 Ga0501319_020683 Ga0501319_020683_103_546 147
424 3300049536 Ga0501320_014836 Ga0501320_014836_147_590 147
425 3300049537 Ga0501321_010891 Ga0501321_010891_415_858 147
426 3300049537 Ga0501321_014307 Ga0501321_014307_144_587 147
427 3300049537 Ga0501321_046387 Ga0501321_046387_88_531 147
428 3300049538 Ga0501322_017710 Ga0501322_017710_151_594 147
429 3300049541 Ga0501325_050940 Ga0501325_050940_38_481 147
430 3300049576 Ga0501040_0413671 Ga0501040_0413671_457_906 147
431 3300049577 Ga0501041_0405131 Ga0501041_0405131_115_564 147
432 3300049583 Ga0501067_0289343 Ga0501067_0289343_155_598 147
433 3300049585 Ga0501069_0059364 Ga0501069_0059364_1668_2111 147
434 3300049585 Ga0501069_0335599 Ga0501069_0335599_420_863 147
435 3300049586 Ga0501070_0010837 Ga0501070_0010837_1986_2429 147
436 3300049589 Ga0501073_0432901 Ga0501073_0432901_32_475 147
437 3300049656 Ga0501209_214775 Ga0501209_214775_67_510 147
438 3300049822 Ga0501035_0420128 Ga0501035_0420128_214_657 147
439 3300049824 Ga0501045_0923279 Ga0501045_0923279_24_473 147
440 3300050490 nmdc:mga03n38_589149_c1 nmdc:mga03n38_589149_c1_71_532 147
441 3300050492 nmdc:mga0yw44_267835_c1 nmdc:mga0yw44_267835_c1_575_1018 147
442 3300050492 nmdc:mga0yw44_9555_c1 nmdc:mga0yw44_9555_c1_1193_1654 147
443 3300050507 nmdc:mga05p37_67921_c1 nmdc:mga05p37_67921_c1_1431_1874 147
444 3300050508 nmdc:mga09592_435449_c1 nmdc:mga09592_435449_c1_573_1016 147
445 3300050508 nmdc:mga09592_46945_c1 nmdc:mga09592_46945_c1_1472_1915 147
446 3300050509 nmdc:mga0qj67_29258_c1 nmdc:mga0qj67_29258_c1_3269_3712 147
447 3300050510 nmdc:mga06r32_218905_c1 nmdc:mga06r32_218905_c1_663_1106 147
448 3300050510 nmdc:mga06r32_44584_c1 nmdc:mga06r32_44584_c1_3049_3492 147
449 3300050511 nmdc:mga08y16_853149_c1 nmdc:mga08y16_853149_c1_404_847 147
450 3300050512 nmdc:mga0n895_1419_c1 nmdc:mga0n895_1419_c1_13398_13871 147
451 3300050512 nmdc:mga0n895_525564_c1 nmdc:mga0n895_525564_c1_540_1010 147
452 3300050512 nmdc:mga0n895_974406_c1 nmdc:mga0n895_974406_c1_115_558 147
453 3300050513 nmdc:mga0rr50_140769_c1 nmdc:mga0rr50_140769_c1_103_573 147
454 3300050513 nmdc:mga0rr50_714675_c1 nmdc:mga0rr50_714675_c1_338_811 147
455 3300050514 nmdc:mga08x19_209758_c1 nmdc:mga08x19_209758_c1_841_1314 147
456 3300050515 nmdc:mga0a205_179782_c1 nmdc:mga0a205_179782_c1_1342_1812 147
457 3300050515 nmdc:mga0a205_48045_c1 nmdc:mga0a205_48045_c1_2135_2608 147
458 3300053077 Ga0495601_0034207 Ga0495601_0034207_448_921 147
459 3300053077 Ga0495601_0135030 Ga0495601_0135030_464_937 147
460 3300053078 Ga0495612_0026568 Ga0495612_0026568_598_1071 147
461 3300053078 Ga0495612_0045916 Ga0495612_0045916_453_926 147
462 3300053083 Ga0495655_0052690 Ga0495655_0052690_135_578 147
463 3300053084 Ga0495595_0065258 Ga0495595_0065258_1166_1609 147
464 3300053085 Ga0495619_0041284 Ga0495619_0041284_1035_1478 147
465 3300053085 Ga0495619_0084296 Ga0495619_0084296_371_844 147
466 3300053085 Ga0495619_0125319 Ga0495619_0125319_859_1332 147
467 3300053129 Ga0500628_042839 Ga0500628_042839_225_668 147
468 3300059477 Ga0587084_051027 Ga0587084_051027_87_530 147
469 3300059477 Ga0587084_069534 Ga0587084_069534_109_552 147
470 3300059478 Ga0587093_036556 Ga0587093_036556_181_624 147
471 3300059478 Ga0587093_057695 Ga0587093_057695_58_501 147
472 3300059491 Ga0587070_074348 Ga0587070_074348_132_602 147
473 3300059491 Ga0587070_091414 Ga0587070_091414_95_538 147
474 3300059491 Ga0587070_109411 Ga0587070_109411_123_566 147
475 3300059491 Ga0587070_138455 Ga0587070_138455_95_538 147
476 3300059491 Ga0587070_155549 Ga0587070_155549_105_548 147
477 3300059492 Ga0587073_0219509 Ga0587073_0219509_18_461 147
478 3300059493 Ga0587077_124303 Ga0587077_124303_95_538 147
479 3300059493 Ga0587077_126608 Ga0587077_126608_126_569 147
480 3300059493 Ga0587077_143113 Ga0587077_143113_75_542 147
481 3300059493 Ga0587077_154535 Ga0587077_154535_92_535 147
482 3300059503 Ga0587080_076739 Ga0587080_076739_158_613 147
483 3300059503 Ga0587080_098313 Ga0587080_098313_80_523 147
484 3300059503 Ga0587080_117477 Ga0587080_117477_93_536 147
485 3300059505 Ga0587083_0099434 Ga0587083_0099434_155_598 147
486 3300059505 Ga0587083_0104143 Ga0587083_0104143_127_570 147
487 3300059505 Ga0587083_0142526 Ga0587083_0142526_116_559 147
488 3300059505 Ga0587083_0156281 Ga0587083_0156281_24_491 147
489 3300059505 Ga0587083_0189247 Ga0587083_0189247_104_547 147
490 3300059507 Ga0587086_063251 Ga0587086_063251_140_583 147
491 3300059508 Ga0587088_027532 Ga0587088_027532_453_896 147
492 3300059508 Ga0587088_061047 Ga0587088_061047_250_693 147
493 3300059508 Ga0587088_090898 Ga0587088_090898_104_547 147
494 3300059510 Ga0587090_076169 Ga0587090_076169_107_550 147
495 3300059510 Ga0587090_082346 Ga0587090_082346_54_497 147
496 3300059511 Ga0587091_102777 Ga0587091_102777_150_593 147
497 3300059512 Ga0587092_112698 Ga0587092_112698_39_482 147
498 3300059513 Ga0587094_054115 Ga0587094_054115_95_538 147
499 3300059513 Ga0587094_066179 Ga0587094_066179_123_566 147
500 3300059514 Ga0587095_019857 Ga0587095_019857_51_518 147
501 3300059604 Ga0587098_034383 Ga0587098_034383_227_670 147
502 3300059604 Ga0587098_055902 Ga0587098_055902_98_541 147
503 3300059605 Ga0587106_071987 Ga0587106_071987_67_510 147
504 3300059605 Ga0587106_087125 Ga0587106_087125_52_495 147
505 3300059605 Ga0587106_102171 Ga0587106_102171_31_474 147
506 3300059622 Ga0587099_030169 Ga0587099_030169_148_591 147
507 3300059625 Ga0587113_022070 Ga0587113_022070_83_550 147
508 3300059626 Ga0587115_040752 Ga0587115_040752_111_554 147
509 3300059626 Ga0587115_080901 Ga0587115_080901_96_539 147
510 3300059628 Ga0587122_038111 Ga0587122_038111_84_527 147
511 3300059628 Ga0587122_056217 Ga0587122_056217_33_476 147
512 3300059630 Ga0587128_096340 Ga0587128_096340_95_538 147
513 3300059639 Ga0587062_058661 Ga0587062_058661_112_555 147
514 3300059640 Ga0587067_103463 Ga0587067_103463_105_548 147
515 3300059641 Ga0587068_076878 Ga0587068_076878_108_551 147
516 3300059641 Ga0587068_099003 Ga0587068_099003_43_486 147
517 3300059642 Ga0587069_076363 Ga0587069_076363_56_499 147
518 3300059644 Ga0587075_023131 Ga0587075_023131_365_808 147
519 3300059644 Ga0587075_099326 Ga0587075_099326_108_551 147
520 3300059644 Ga0587075_119553 Ga0587075_119553_58_501 147
521 3300059645 Ga0587076_126025 Ga0587076_126025_128_571 147
522 3300059646 Ga0587078_047306 Ga0587078_047306_116_565 147
523 3300059647 Ga0587079_056448 Ga0587079_056448_133_576 147
524 3300059647 Ga0587079_101398 Ga0587079_101398_229_672 147
525 3300059647 Ga0587079_126946 Ga0587079_126946_72_515 147
526 3300059648 Ga0587100_019393 Ga0587100_019393_154_597 147
527 3300059649 Ga0587102_032557 Ga0587102_032557_48_491 147
528 3300059654 Ga0587110_037474 Ga0587110_037474_148_591 147
529 3300059655 Ga0587114_010332 Ga0587114_010332_125_592 147
530 3300059655 Ga0587114_056058 Ga0587114_056058_81_524 147
531 3300059655 Ga0587114_056309 Ga0587114_056309_165_608 147
532 3300060344 Ga0587071_054436 Ga0587071_054436_258_701 147
533 3300060344 Ga0587071_126532 Ga0587071_126532_50_493 147
534 3300060344 Ga0587071_172803 Ga0587071_172803_58_501 147
535 3300060346 Ga0587111_0035503 Ga0587111_0035503_502_945 147
536 3300060346 Ga0587111_0122550 Ga0587111_0122550_129_572 147
537 3300060346 Ga0587111_0148043 Ga0587111_0148043_113_556 147
538 3300060346 Ga0587111_0196092 Ga0587111_0196092_88_531 147
539 3300061719 Ga0466962_0010205 Ga0466962_0010205_2102_2545 147
540 3300061719 Ga0466962_0066884 Ga0466962_0066884_749_1192 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

39

157

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ppk-assembly1.cif.gz_J rbga+45srbga complex 0.9281 11 137
6spb-assembly1.cif.gz_J pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9263 2 137
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9193 1 138
7nhn-assembly1.cif.gz_M vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9183 1 142
8cvm-assembly1.cif.gz_i cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9145 3 147
ID Description Score Start End Superfamily
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9326 12 146 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.929 12 147 3.90.1180.10
af_Q4CZX3_36_177_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9151 13 143 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9102 1 142 3.90.1180.10
af_O96222_56_212_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9079 8 147 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A6P4ZYA6-F1-model_v4 39S ribosomal protein L13, mitochondrial-like 0.9601 11 131 GO:0003729
GO:0003735
GO:0005762
GO:0006412
GO:0017148
AF-A0A2H9TQC8-F1-model_v4 Ribosomal protein L13 0.9537 11 134 GO:0003729
GO:0003735
GO:0005762
GO:0006412
GO:0017148
AF-A0A2W1A4K2-F1-model_v4 Large ribosomal subunit protein uL13 0.9519 12 135 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A7K1DJB2-F1-model_v4 50S ribosomal protein L13 0.9511 15 142 GO:0003729
GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0017148
GO:1990904
AF-A0A6L7X5Y4-F1-model_v4 Large ribosomal subunit protein uL13 0.9504 12 135 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Feature Viewer

pLDDT pTM Quality
85.62 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map