F461236
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 540 | 308 | 530 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10570499|Ga0213876_105704991 |
| Length | 173 |
| Sequence | VFVRGRSSTTRRATAHRDHERVRQTHVRTYSPKPGDVQREWHVIDATDIVLGKLAVQAANLLRGKHKPTFAPHMDMGDFVIVVNAEKVALTGDKATSKLLYRHSGYPGGLTATPVGKQLEKDARKVIEGAVWGMLPKNKLGRQVLKKLKVYAGPTHPHQAQQAKPFEITQVSQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 4 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 5 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 6 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 7 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 72 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 88 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 130 | 3300031636 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 131 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 132 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 138 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 142 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 143 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 147 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 164 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 165 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 166 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 251 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 254 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 270 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 306 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 307 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 308 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.3 |
| Metatranscriptomes | 26.85 |
| Isolates | 1.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.11 |
| Nodule | 0 |
| Rhizoplane | 6.11 |
| Rhizosphere | 89.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10095261 | 3300003203 | Bacteria | 893 |
| 2 | Ga0006777J48905_1036991 | 3300003308 | Bacteria | 594 |
| 3 | Ga0007410J51695_1072619 | 3300003574 | Bacteria | 649 |
| 4 | Ga0032354_1115994 | 3300003693 | Bacteria | 566 |
| 5 | Ga0058859_10019153 | 3300004798 | Bacteria | 699 |
| 6 | Ga0058861_11944092 | 3300004800 | Bacteria | 683 |
| 7 | Ga0058861_12045397 | 3300004800 | Bacteria | 789 |
| 8 | Ga0058860_10006825 | 3300004801 | Bacteria | 554 |
| 9 | Ga0058862_12861556 | 3300004803 | Bacteria | 956 |
| 10 | Ga0070683_100154117 | 3300005329 | Bacteria | 2179 |
| 11 | Ga0070683_100225583 | 3300005329 | Bacteria | 1780 |
| 12 | Ga0070683_100540742 | 3300005329 | Bacteria | 1114 |
| 13 | Ga0070683_100818630 | 3300005329 | Bacteria | 893 |
| 14 | Ga0070682_100125048 | 3300005337 | Bacteria | 1732 |
| 15 | Ga0070682_101106624 | 3300005337 | Bacteria | 664 |
| 16 | Ga0070675_100542834 | 3300005354 | Bacteria | 1051 |
| 17 | Ga0070674_100623435 | 3300005356 | Bacteria | 914 |
| 18 | Ga0070673_100904133 | 3300005364 | Bacteria | 819 |
| 19 | Ga0070709_10001455 | 3300005434 | Bacteria | 12750 |
| 20 | Ga0070714_100052022 | 3300005435 | Bacteria | 3493 |
| 21 | Ga0070714_100156558 | 3300005435 | Bacteria | 2057 |
| 22 | Ga0070714_100236242 | 3300005435 | Bacteria | 1685 |
| 23 | Ga0070713_100011062 | 3300005436 | Bacteria | 6554 |
| 24 | Ga0070713_100020440 | 3300005436 | Bacteria | 5076 |
| 25 | Ga0070713_100161382 | 3300005436 | Bacteria | 2001 |
| 26 | Ga0070710_10001125 | 3300005437 | Bacteria | 12648 |
| 27 | Ga0070710_10007540 | 3300005437 | Bacteria | 5269 |
| 28 | Ga0070701_10710556 | 3300005438 | Bacteria | 677 |
| 29 | Ga0070711_100005971 | 3300005439 | Bacteria | 7313 |
| 30 | Ga0070711_100028529 | 3300005439 | Bacteria | 3673 |
| 31 | Ga0070700_100080477 | 3300005441 | Bacteria | 2102 |
| 32 | Ga0070700_100118606 | 3300005441 | Bacteria | 1770 |
| 33 | Ga0070708_100053481 | 3300005445 | Bacteria | 3582 |
| 34 | Ga0070708_100079517 | 3300005445 | Bacteria | 2966 |
| 35 | Ga0070678_100422092 | 3300005456 | Bacteria | 1163 |
| 36 | Ga0070706_100006965 | 3300005467 | Bacteria | 10663 |
| 37 | Ga0070706_100352591 | 3300005467 | Bacteria | 1371 |
| 38 | Ga0070707_100002209 | 3300005468 | Bacteria | 18562 |
| 39 | Ga0070707_100006776 | 3300005468 | Bacteria | 10608 |
| 40 | Ga0070707_100112347 | 3300005468 | Bacteria | 2642 |
| 41 | Ga0070698_100001064 | 3300005471 | Bacteria | 30146 |
| 42 | Ga0070698_100001092 | 3300005471 | Bacteria | 29843 |
| 43 | Ga0070699_100151677 | 3300005518 | Bacteria | 2050 |
| 44 | Ga0070699_100708604 | 3300005518 | Bacteria | 920 |
| 45 | Ga0070679_100284160 | 3300005530 | Bacteria | 1607 |
| 46 | Ga0070679_100333778 | 3300005530 | Bacteria | 1464 |
| 47 | Ga0070684_100264225 | 3300005535 | Bacteria | 1574 |
| 48 | Ga0070684_100299370 | 3300005535 | Bacteria | 1476 |
| 49 | Ga0070697_100045343 | 3300005536 | Bacteria | 3563 |
| 50 | Ga0070697_100373844 | 3300005536 | Bacteria | 1233 |
| 51 | Ga0070672_100343184 | 3300005543 | Bacteria | 1272 |
| 52 | Ga0070665_100001255 | 3300005548 | Bacteria | 30600 |
| 53 | Ga0068856_100320680 | 3300005614 | Bacteria | 1567 |
| 54 | Ga0070702_100497200 | 3300005615 | Bacteria | 895 |
| 55 | Ga0068852_100401355 | 3300005616 | Bacteria | 1348 |
| 56 | Ga0068852_100439459 | 3300005616 | Bacteria | 1290 |
| 57 | Ga0068864_100307428 | 3300005618 | Bacteria | 1486 |
| 58 | Ga0068861_100326108 | 3300005719 | Bacteria | 1339 |
| 59 | Ga0068858_100148884 | 3300005842 | Bacteria | 2200 |
| 60 | Ga0081455_10219428 | 3300005937 | Bacteria | 1410 |
| 61 | Ga0081539_10000109 | 3300005985 | Bacteria | 193696 |
| 62 | Ga0081539_10001279 | 3300005985 | Bacteria | 44286 |
| 63 | Ga0081539_10013009 | 3300005985 | Bacteria | 6319 |
| 64 | Ga0081539_10110835 | 3300005985 | Bacteria | 1382 |
| 65 | Ga0070717_10001284 | 3300006028 | Bacteria | 17163 |
| 66 | Ga0070717_10064517 | 3300006028 | Bacteria | 3042 |
| 67 | Ga0070717_10224132 | 3300006028 | Bacteria | 1653 |
| 68 | Ga0070717_10475191 | 3300006028 | Bacteria | 1128 |
| 69 | Ga0075365_10014105 | 3300006038 | Bacteria | 4800 |
| 70 | Ga0075365_10082498 | 3300006038 | Bacteria | 2180 |
| 71 | Ga0070715_10011755 | 3300006163 | Bacteria | 3162 |
| 72 | Ga0070716_100001036 | 3300006173 | Bacteria | 12180 |
| 73 | Ga0070716_100003067 | 3300006173 | Bacteria | 7797 |
| 74 | Ga0070712_100003579 | 3300006175 | Bacteria | 9571 |
| 75 | Ga0070712_100038079 | 3300006175 | Bacteria | 3283 |
| 76 | Ga0097621_101216898 | 3300006237 | Bacteria | 710 |
| 77 | Ga0097621_101319690 | 3300006237 | Bacteria | 682 |
| 78 | Ga0097621_101347764 | 3300006237 | Bacteria | 675 |
| 79 | Ga0075428_100000164 | 3300006844 | Bacteria | 61044 |
| 80 | Ga0075428_100323190 | 3300006844 | Bacteria | 1658 |
| 81 | Ga0075428_100872424 | 3300006844 | Bacteria | 955 |
| 82 | Ga0075428_100895020 | 3300006844 | Bacteria | 941 |
| 83 | Ga0075430_100017165 | 3300006846 | Bacteria | 6163 |
| 84 | Ga0075431_100132615 | 3300006847 | Bacteria | 2569 |
| 85 | Ga0075431_100236960 | 3300006847 | Bacteria | 1857 |
| 86 | Ga0075433_10052435 | 3300006852 | Bacteria | 3554 |
| 87 | Ga0075434_100037594 | 3300006871 | Bacteria | 4793 |
| 88 | Ga0075429_100040914 | 3300006880 | Bacteria | 4035 |
| 89 | Ga0075429_100119690 | 3300006880 | Bacteria | 2301 |
| 90 | Ga0068865_100025829 | 3300006881 | Bacteria | 3867 |
| 91 | Ga0075436_100066281 | 3300006914 | Bacteria | 2495 |
| 92 | Ga0075436_100087700 | 3300006914 | Bacteria | 2161 |
| 93 | Ga0075435_100097305 | 3300007076 | Bacteria | 2435 |
| 94 | Ga0075435_100192125 | 3300007076 | Bacteria | 1728 |
| 95 | Ga0111539_10086254 | 3300009094 | Bacteria | 3689 |
| 96 | Ga0111539_10544147 | 3300009094 | Bacteria | 1353 |
| 97 | Ga0114129_10003730 | 3300009147 | Bacteria | 21471 |
| 98 | Ga0114129_10156346 | 3300009147 | Bacteria | 3117 |
| 99 | Ga0105243_10090270 | 3300009148 | Bacteria | 2521 |
| 100 | Ga0105243_10153159 | 3300009148 | Bacteria | 1980 |
| 101 | Ga0105243_10243779 | 3300009148 | Bacteria | 1601 |
| 102 | Ga0105241_10567665 | 3300009174 | Bacteria | 1021 |
| 103 | Ga0105242_10215773 | 3300009176 | Bacteria | 1712 |
| 104 | Ga0105238_10874906 | 3300009551 | Bacteria | 916 |
| 105 | Ga0105238_11240680 | 3300009551 | Bacteria | 770 |
| 106 | Ga0105249_10268781 | 3300009553 | Bacteria | 1698 |
| 107 | Ga0105239_10002486 | 3300010375 | Bacteria | 23478 |
| 108 | Ga0105239_10332976 | 3300010375 | Bacteria | 1713 |
| 109 | Ga0105246_10000375 | 3300011119 | Bacteria | 23857 |
| 110 | Ga0157317_1014206 | 3300012475 | Bacteria | 649 |
| 111 | Ga0154016_142311 | 3300013045 | Bacteria | 581 |
| 112 | Ga0157373_10110790 | 3300013100 | Bacteria | 1930 |
| 113 | Ga0157369_10015392 | 3300013105 | Bacteria | 8623 |
| 114 | Ga0157369_10142373 | 3300013105 | Bacteria | 2537 |
| 115 | Ga0157369_10334496 | 3300013105 | Bacteria | 1573 |
| 116 | Ga0157374_10656699 | 3300013296 | Bacteria | 1061 |
| 117 | Ga0157374_11228528 | 3300013296 | Bacteria | 771 |
| 118 | Ga0163162_10273040 | 3300013306 | Bacteria | 1823 |
| 119 | Ga0163162_10772735 | 3300013306 | Bacteria | 1079 |
| 120 | Ga0157372_10058284 | 3300013307 | Bacteria | 4316 |
| 121 | Ga0157372_10213914 | 3300013307 | Bacteria | 2234 |
| 122 | Ga0157372_11863323 | 3300013307 | Bacteria | 691 |
| 123 | Ga0157375_10038724 | 3300013308 | Bacteria | 4580 |
| 124 | Ga0157375_10965135 | 3300013308 | Bacteria | 993 |
| 125 | Ga0163163_10081345 | 3300014325 | Bacteria | 3241 |
| 126 | Ga0163163_10610100 | 3300014325 | Bacteria | 1154 |
| 127 | Ga0163163_10639673 | 3300014325 | Bacteria | 1127 |
| 128 | Ga0157380_10755521 | 3300014326 | Bacteria | 984 |
| 129 | Ga0157379_10267367 | 3300014968 | Bacteria | 1554 |
| 130 | Ga0157379_10353568 | 3300014968 | Bacteria | 1345 |
| 131 | Ga0163161_10307386 | 3300017792 | Bacteria | 1250 |
| 132 | Ga0184600_117791 | 3300019190 | Bacteria | 594 |
| 133 | Ga0197907_10290678 | 3300020069 | Bacteria | 1853 |
| 134 | Ga0197907_10662353 | 3300020069 | Bacteria | 611 |
| 135 | Ga0197907_11132255 | 3300020069 | Bacteria | 635 |
| 136 | Ga0197907_11210708 | 3300020069 | Bacteria | 629 |
| 137 | Ga0206356_10202265 | 3300020070 | Bacteria | 570 |
| 138 | Ga0206356_10205106 | 3300020070 | Bacteria | 2555 |
| 139 | Ga0206356_10809232 | 3300020070 | Bacteria | 623 |
| 140 | Ga0206349_1054364 | 3300020075 | Bacteria | 1137 |
| 141 | Ga0206349_1166079 | 3300020075 | Bacteria | 1351 |
| 142 | Ga0206349_1491499 | 3300020075 | Bacteria | 882 |
| 143 | Ga0206349_1652759 | 3300020075 | Bacteria | 964 |
| 144 | Ga0206355_1162727 | 3300020076 | Bacteria | 1016 |
| 145 | Ga0206355_1407193 | 3300020076 | Bacteria | 943 |
| 146 | Ga0206351_10545088 | 3300020077 | Bacteria | 1294 |
| 147 | Ga0206351_10895652 | 3300020077 | Bacteria | 645 |
| 148 | Ga0206352_10079568 | 3300020078 | Bacteria | 850 |
| 149 | Ga0206352_10108346 | 3300020078 | Bacteria | 1112 |
| 150 | Ga0206352_10225768 | 3300020078 | Bacteria | 953 |
| 151 | Ga0206350_10330016 | 3300020080 | Bacteria | 898 |
| 152 | Ga0206354_10007464 | 3300020081 | Bacteria | 823 |
| 153 | Ga0206354_11039646 | 3300020081 | Bacteria | 601 |
| 154 | Ga0206354_11448685 | 3300020081 | Bacteria | 1796 |
| 155 | Ga0206354_11695497 | 3300020081 | Bacteria | 671 |
| 156 | Ga0206353_11556168 | 3300020082 | Bacteria | 2007 |
| 157 | Ga0154015_1233679 | 3300020610 | Bacteria | 667 |
| 158 | Ga0154015_1552073 | 3300020610 | Bacteria | 990 |
| 159 | Ga0213876_10570499 | 3300021384 | Bacteria | 602 |
| 160 | Ga0213875_10002764 | 3300021388 | Bacteria | 10358 |
| 161 | Ga0224712_10109006 | 3300022467 | Bacteria | 1185 |
| 162 | Ga0207692_10000557 | 3300025898 | Bacteria | 13254 |
| 163 | Ga0207692_10002027 | 3300025898 | Bacteria | 7731 |
| 164 | Ga0207688_10021140 | 3300025901 | Bacteria | 3554 |
| 165 | Ga0207685_10010246 | 3300025905 | Bacteria | 2758 |
| 166 | Ga0207699_10000106 | 3300025906 | Bacteria | 58842 |
| 167 | Ga0207699_10005750 | 3300025906 | Bacteria | 5966 |
| 168 | Ga0207684_10001153 | 3300025910 | Bacteria | 29491 |
| 169 | Ga0207684_10002031 | 3300025910 | Bacteria | 20859 |
| 170 | Ga0207684_10194672 | 3300025910 | Bacteria | 1749 |
| 171 | Ga0207684_10393451 | 3300025910 | Bacteria | 1191 |
| 172 | Ga0207693_10001488 | 3300025915 | Bacteria | 20694 |
| 173 | Ga0207693_10071464 | 3300025915 | Bacteria | 2716 |
| 174 | Ga0207663_10003956 | 3300025916 | Bacteria | 7330 |
| 175 | Ga0207663_10006837 | 3300025916 | Bacteria | 5872 |
| 176 | Ga0207663_10525783 | 3300025916 | Bacteria | 922 |
| 177 | Ga0207660_11324508 | 3300025917 | Bacteria | 584 |
| 178 | Ga0207657_10066977 | 3300025919 | Bacteria | 3055 |
| 179 | Ga0207652_10205613 | 3300025921 | Bacteria | 1772 |
| 180 | Ga0207646_10001638 | 3300025922 | Bacteria | 27351 |
| 181 | Ga0207646_10008339 | 3300025922 | Bacteria | 10397 |
| 182 | Ga0207646_10012907 | 3300025922 | Bacteria | 8007 |
| 183 | Ga0207646_10104990 | 3300025922 | Bacteria | 2533 |
| 184 | Ga0207694_11626759 | 3300025924 | Bacteria | 544 |
| 185 | Ga0207687_10013387 | 3300025927 | Bacteria | 5356 |
| 186 | Ga0207700_10002205 | 3300025928 | Bacteria | 11178 |
| 187 | Ga0207700_10002355 | 3300025928 | Bacteria | 10850 |
| 188 | Ga0207700_10007455 | 3300025928 | Bacteria | 6685 |
| 189 | Ga0207700_10146857 | 3300025928 | Bacteria | 1944 |
| 190 | Ga0207700_10818224 | 3300025928 | Bacteria | 833 |
| 191 | Ga0207664_10004846 | 3300025929 | Bacteria | 9151 |
| 192 | Ga0207664_10011089 | 3300025929 | Bacteria | 6387 |
| 193 | Ga0207664_10012295 | 3300025929 | Bacteria | 6115 |
| 194 | Ga0207664_10340641 | 3300025929 | Bacteria | 1326 |
| 195 | Ga0207709_10211059 | 3300025935 | Bacteria | 1393 |
| 196 | Ga0207670_10394924 | 3300025936 | Bacteria | 1105 |
| 197 | Ga0207669_10733269 | 3300025937 | Bacteria | 815 |
| 198 | Ga0207704_11025787 | 3300025938 | Bacteria | 699 |
| 199 | Ga0207665_10000812 | 3300025939 | Bacteria | 21111 |
| 200 | Ga0207665_10002563 | 3300025939 | Bacteria | 12203 |
| 201 | Ga0207691_10289076 | 3300025940 | Bacteria | 1410 |
| 202 | Ga0207661_10030791 | 3300025944 | Bacteria | 4137 |
| 203 | Ga0207661_10039725 | 3300025944 | Bacteria | 3695 |
| 204 | Ga0207651_10228281 | 3300025960 | Bacteria | 1510 |
| 205 | Ga0207658_10512494 | 3300025986 | Bacteria | 1070 |
| 206 | Ga0207703_11666711 | 3300026035 | Bacteria | 613 |
| 207 | Ga0207708_10202673 | 3300026075 | Bacteria | 1583 |
| 208 | Ga0207675_100973958 | 3300026118 | Bacteria | 866 |
| 209 | Ga0207683_10196077 | 3300026121 | Bacteria | 1835 |
| 210 | Ga0207683_10549034 | 3300026121 | Bacteria | 1068 |
| 211 | Ga0207698_10328466 | 3300026142 | Bacteria | 1436 |
| 212 | Ga0207698_10721099 | 3300026142 | Bacteria | 994 |
| 213 | Ga0207428_10255197 | 3300027907 | Bacteria | 1307 |
| 214 | Ga0268266_10008784 | 3300028379 | Bacteria | 8956 |
| 215 | Ga0265760_10021225 | 3300031090 | Bacteria | 1878 |
| 216 | Ga0307508_10049690 | 3300031616 | Bacteria | 3735 |
| 217 | Ga0310113_121820 | 3300031636 | Bacteria | 655 |
| 218 | Ga0307514_10290350 | 3300031649 | Bacteria | 926 |
| 219 | Ga0310111_122074 | 3300031667 | Bacteria | 770 |
| 220 | Ga0307405_10502973 | 3300031731 | Bacteria | 972 |
| 221 | Ga0307413_10465162 | 3300031824 | Bacteria | 1007 |
| 222 | Ga0307406_10017188 | 3300031901 | Bacteria | 4211 |
| 223 | Ga0307416_100200474 | 3300032002 | Bacteria | 1893 |
| 224 | Ga0307416_101221898 | 3300032002 | Bacteria | 857 |
| 225 | Ga0373926_0007881 | 3300035083 | Bacteria | 3548 |
| 226 | Ga0373926_0227368 | 3300035083 | Bacteria | 721 |
| 227 | Ga0373934_0011736 | 3300035086 | Bacteria | 3300 |
| 228 | Ga0373951_0209917 | 3300035091 | Bacteria | 571 |
| 229 | Ga0373923_0077706 | 3300035111 | Bacteria | 1435 |
| 230 | Ga0373936_0045129 | 3300035113 | Bacteria | 1774 |
| 231 | Ga0373945_0148143 | 3300035116 | Bacteria | 950 |
| 232 | Ga0373945_0154399 | 3300035116 | Bacteria | 932 |
| 233 | Ga0373953_0100873 | 3300035117 | Bacteria | 1214 |
| 234 | Ga0373954_0056344 | 3300035118 | Bacteria | 1849 |
| 235 | Ga0373956_0022380 | 3300035119 | Bacteria | 2704 |
| 236 | Ga0373957_0023880 | 3300035120 | Bacteria | 2190 |
| 237 | Ga0373957_0090705 | 3300035120 | Bacteria | 1214 |
| 238 | Ga0373943_0064053 | 3300035170 | Bacteria | 1845 |
| 239 | Ga0373943_0103053 | 3300035170 | Bacteria | 1495 |
| 240 | Ga0373943_0445793 | 3300035170 | Bacteria | 752 |
| 241 | Ga0373946_0092426 | 3300035171 | Bacteria | 1343 |
| 242 | Ga0373955_0005831 | 3300035172 | Bacteria | 5562 |
| 243 | Ga0373955_0127980 | 3300035172 | Bacteria | 1481 |
| 244 | Ga0373955_0262230 | 3300035172 | Bacteria | 1037 |
| 245 | Ga0373924_0505734 | 3300035410 | Bacteria | 543 |
| 246 | Ga0373935_0001997 | 3300035692 | Bacteria | 11496 |
| 247 | Ga0373935_0081531 | 3300035692 | Bacteria | 2103 |
| 248 | Ga0373935_0160004 | 3300035692 | Bacteria | 1534 |
| 249 | Ga0373935_0670900 | 3300035692 | Bacteria | 761 |
| 250 | Ga0373927_0350383 | 3300035695 | Bacteria | 973 |
| 251 | Ga0373933_0140149 | 3300035724 | Bacteria | 1526 |
| 252 | Ga0373933_0190478 | 3300035724 | Bacteria | 1310 |
| 253 | Ga0373933_0201506 | 3300035724 | Bacteria | 1273 |
| 254 | Ga0373947_0000004 | 3300035725 | Bacteria | 248228 |
| 255 | Ga0373947_0124526 | 3300035725 | Bacteria | 1640 |
| 256 | Ga0373937_0017771 | 3300036401 | Bacteria | 6344 |
| 257 | Ga0373925_0003782 | 3300037068 | Bacteria | 11638 |
| 258 | Ga0373925_0049135 | 3300037068 | Bacteria | 3144 |
| 259 | Ga0373925_0119304 | 3300037068 | Bacteria | 2046 |
| 260 | Ga0395899_0056163 | 3300037312 | Bacteria | 2910 |
| 261 | Ga0395900_0147607 | 3300037418 | Bacteria | 2404 |
| 262 | Ga0395900_0772275 | 3300037418 | Bacteria | 890 |
| 263 | Ga0395898_0030030 | 3300037466 | Bacteria | 5441 |
| 264 | Ga0436364_0385416 | 3300037853 | Bacteria | 26442 |
| 265 | Ga0436364_0409793 | 3300037853 | Bacteria | 2978 |
| 266 | Ga0395901_0054733 | 3300038443 | Bacteria | 4147 |
| 267 | Ga0436365_1816359 | 3300039437 | Bacteria | 891 |
| 268 | Ga0436363_1458574 | 3300039450 | Bacteria | 614 |
| 269 | Ga0451790_33454 | 3300041444 | Bacteria | 794 |
| 270 | Ga0451792_20358 | 3300041445 | Bacteria | 620 |
| 271 | Ga0451793_1537465 | 3300041452 | Bacteria | 643 |
| 272 | Ga0451853_3672276 | 3300041512 | Bacteria | 1561 |
| 273 | Ga0466969_0074639 | 3300044656 | Bacteria | 1626 |
| 274 | Ga0466969_0201771 | 3300044656 | Bacteria | 907 |
| 275 | Ga0466966_0007159 | 3300044684 | Bacteria | 7393 |
| 276 | Ga0466966_0429874 | 3300044684 | Bacteria | 794 |
| 277 | Ga0466961_0122139 | 3300044693 | Bacteria | 1634 |
| 278 | Ga0466961_0474089 | 3300044693 | Bacteria | 757 |
| 279 | Ga0466963_0013682 | 3300044694 | Bacteria | 4989 |
| 280 | Ga0466963_0231822 | 3300044694 | Bacteria | 1294 |
| 281 | Ga0466971_0018447 | 3300044719 | Bacteria | 3090 |
| 282 | Ga0466970_0093046 | 3300044765 | Bacteria | 1637 |
| 283 | Ga0466970_0195330 | 3300044765 | Bacteria | 1125 |
| 284 | Ga0466970_0588276 | 3300044765 | Bacteria | 645 |
| 285 | Ga0466957_0223574 | 3300044842 | Bacteria | 1244 |
| 286 | Ga0466957_0642505 | 3300044842 | Bacteria | 745 |
| 287 | Ga0466960_0024128 | 3300044901 | Bacteria | 2740 |
| 288 | Ga0466960_0317345 | 3300044901 | Bacteria | 882 |
| 289 | Ga0466967_0029836 | 3300045976 | Bacteria | 4570 |
| 290 | Ga0495629_0089546 | 3300046459 | Bacteria | 2146 |
| 291 | Ga0495629_0169963 | 3300046459 | Bacteria | 1513 |
| 292 | Ga0495641_0082391 | 3300046461 | Bacteria | 1440 |
| 293 | Ga0495651_0009348 | 3300046462 | Bacteria | 7523 |
| 294 | Ga0495651_0197298 | 3300046462 | Bacteria | 1411 |
| 295 | Ga0495653_0074168 | 3300046463 | Bacteria | 2536 |
| 296 | Ga0495653_0199725 | 3300046463 | Bacteria | 1358 |
| 297 | Ga0495653_0252246 | 3300046463 | Bacteria | 1170 |
| 298 | Ga0495580_0136672 | 3300046472 | Bacteria | 1700 |
| 299 | Ga0495582_0318642 | 3300046473 | Bacteria | 894 |
| 300 | Ga0495662_0049388 | 3300046476 | Bacteria | 2030 |
| 301 | Ga0495664_0013997 | 3300046477 | Bacteria | 4544 |
| 302 | Ga0495664_0056528 | 3300046477 | Bacteria | 2334 |
| 303 | Ga0495664_0084322 | 3300046477 | Bacteria | 1907 |
| 304 | Ga0495664_0094473 | 3300046477 | Bacteria | 1799 |
| 305 | Ga0495664_0350402 | 3300046477 | Bacteria | 889 |
| 306 | Ga0495608_0039257 | 3300046511 | Bacteria | 3174 |
| 307 | Ga0495608_0085273 | 3300046511 | Bacteria | 2047 |
| 308 | Ga0495618_0404296 | 3300046514 | Bacteria | 834 |
| 309 | Ga0495628_0098369 | 3300046516 | Bacteria | 2260 |
| 310 | Ga0495628_0117967 | 3300046516 | Bacteria | 2037 |
| 311 | Ga0495630_0153243 | 3300046517 | Bacteria | 1754 |
| 312 | Ga0495630_0316593 | 3300046517 | Bacteria | 1193 |
| 313 | Ga0495666_0132013 | 3300046526 | Bacteria | 1167 |
| 314 | Ga0495652_0023588 | 3300046529 | Bacteria | 5454 |
| 315 | Ga0495652_0248495 | 3300046529 | Bacteria | 1319 |
| 316 | Ga0495652_0404635 | 3300046529 | Bacteria | 965 |
| 317 | Ga0495665_0071907 | 3300046531 | Bacteria | 1821 |
| 318 | Ga0495586_0067787 | 3300046535 | Bacteria | 1946 |
| 319 | Ga0495586_0391505 | 3300046535 | Bacteria | 799 |
| 320 | Ga0495645_0086892 | 3300046543 | Bacteria | 2237 |
| 321 | Ga0495645_0109212 | 3300046543 | Bacteria | 1958 |
| 322 | Ga0495645_0207619 | 3300046543 | Bacteria | 1324 |
| 323 | Ga0495667_0003897 | 3300046559 | Bacteria | 10011 |
| 324 | Ga0495667_0073522 | 3300046559 | Bacteria | 2226 |
| 325 | Ga0495634_0068703 | 3300046642 | Bacteria | 2339 |
| 326 | Ga0495635_0214659 | 3300046663 | Bacteria | 1302 |
| 327 | Ga0495657_0002905 | 3300046675 | Bacteria | 14216 |
| 328 | Ga0495657_0080391 | 3300046675 | Bacteria | 2110 |
| 329 | Ga0495657_0198217 | 3300046675 | Bacteria | 1224 |
| 330 | Ga0495599_0149766 | 3300046678 | Bacteria | 1445 |
| 331 | Ga0495599_0156593 | 3300046678 | Bacteria | 1409 |
| 332 | Ga0495599_0314480 | 3300046678 | Bacteria | 943 |
| 333 | Ga0495599_0371764 | 3300046678 | Bacteria | 854 |
| 334 | Ga0495623_0078419 | 3300046679 | Bacteria | 2047 |
| 335 | Ga0495623_0175326 | 3300046679 | Bacteria | 1249 |
| 336 | Ga0495646_0123300 | 3300046680 | Bacteria | 1464 |
| 337 | Ga0495646_0151355 | 3300046680 | Bacteria | 1290 |
| 338 | Ga0495658_0007574 | 3300046683 | Bacteria | 5382 |
| 339 | Ga0495658_0154646 | 3300046683 | Bacteria | 1411 |
| 340 | Ga0495624_0041470 | 3300046690 | Bacteria | 2943 |
| 341 | Ga0495624_0566428 | 3300046690 | Bacteria | 678 |
| 342 | Ga0495600_0001528 | 3300046809 | Bacteria | 12859 |
| 343 | Ga0495600_0052964 | 3300046809 | Bacteria | 2650 |
| 344 | Ga0495600_0112950 | 3300046809 | Bacteria | 1769 |
| 345 | Ga0495581_0063337 | 3300047315 | Bacteria | 2137 |
| 346 | Ga0495581_0120987 | 3300047315 | Bacteria | 1523 |
| 347 | Ga0495604_0039494 | 3300047317 | Bacteria | 3709 |
| 348 | Ga0495674_0033733 | 3300047319 | Bacteria | 4633 |
| 349 | Ga0495674_0274138 | 3300047319 | Bacteria | 1383 |
| 350 | Ga0495680_0012040 | 3300047322 | Bacteria | 7632 |
| 351 | Ga0495680_0035576 | 3300047322 | Bacteria | 4009 |
| 352 | Ga0495675_0054121 | 3300047444 | Bacteria | 2547 |
| 353 | Ga0495675_0074293 | 3300047444 | Bacteria | 2142 |
| 354 | Ga0495684_0151628 | 3300047471 | Bacteria | 1732 |
| 355 | Ga0495684_0208268 | 3300047471 | Bacteria | 1439 |
| 356 | Ga0495593_0022927 | 3300047673 | Bacteria | 3474 |
| 357 | Ga0495602_0096402 | 3300048088 | Bacteria | 2439 |
| 358 | Ga0496100_0543618 | 3300048903 | Bacteria | 898 |
| 359 | Ga0496101_0857342 | 3300048904 | Bacteria | 716 |
| 360 | Ga0496102_0444429 | 3300048905 | Bacteria | 1216 |
| 361 | Ga0496102_1579399 | 3300048905 | Bacteria | 574 |
| 362 | Ga0496104_1487660 | 3300048907 | Bacteria | 580 |
| 363 | Ga0496105_0651893 | 3300048908 | Bacteria | 812 |
| 364 | Ga0496106_0249673 | 3300048909 | Bacteria | 1418 |
| 365 | Ga0496107_1270091 | 3300048910 | Bacteria | 527 |
| 366 | Ga0496108_0815701 | 3300048911 | Bacteria | 804 |
| 367 | Ga0496108_1295446 | 3300048911 | Bacteria | 613 |
| 368 | Ga0496109_0006223 | 3300048912 | Bacteria | 10035 |
| 369 | Ga0496109_0076819 | 3300048912 | Bacteria | 3072 |
| 370 | Ga0496109_0977502 | 3300048912 | Bacteria | 784 |
| 371 | Ga0496110_0102021 | 3300048913 | Bacteria | 2573 |
| 372 | Ga0496110_0224581 | 3300048913 | Bacteria | 1708 |
| 373 | Ga0496110_0842130 | 3300048913 | Bacteria | 822 |
| 374 | Ga0496110_1011503 | 3300048913 | Bacteria | 739 |
| 375 | Ga0496110_1073286 | 3300048913 | Bacteria | 713 |
| 376 | Ga0496111_0401551 | 3300048914 | Bacteria | 1013 |
| 377 | Ga0496111_0506838 | 3300048914 | Bacteria | 888 |
| 378 | Ga0496111_1137974 | 3300048914 | Bacteria | 555 |
| 379 | Ga0496112_0327797 | 3300048915 | Bacteria | 1475 |
| 380 | Ga0496112_0614954 | 3300048915 | Bacteria | 1018 |
| 381 | Ga0496113_0065187 | 3300048916 | Bacteria | 2756 |
| 382 | Ga0496114_0046928 | 3300048917 | Bacteria | 3591 |
| 383 | Ga0496114_0124765 | 3300048917 | Bacteria | 2218 |
| 384 | Ga0496114_0280343 | 3300048917 | Bacteria | 1469 |
| 385 | Ga0496115_0004812 | 3300048918 | Bacteria | 9796 |
| 386 | Ga0496115_0733495 | 3300048918 | Bacteria | 774 |
| 387 | Ga0496115_1204179 | 3300048918 | Bacteria | 569 |
| 388 | Ga0501306_023572 | 3300049127 | Bacteria | 875 |
| 389 | Ga0501306_058205 | 3300049127 | Bacteria | 632 |
| 390 | Ga0501308_043850 | 3300049128 | Bacteria | 637 |
| 391 | Ga0501308_054250 | 3300049128 | Bacteria | 593 |
| 392 | Ga0501308_077514 | 3300049128 | Bacteria | 525 |
| 393 | Ga0501309_072407 | 3300049129 | Bacteria | 568 |
| 394 | Ga0501310_044852 | 3300049130 | Bacteria | 625 |
| 395 | Ga0501305_023625 | 3300049161 | Bacteria | 922 |
| 396 | Ga0501307_001336 | 3300049162 | Bacteria | 2053 |
| 397 | Ga0501307_054604 | 3300049162 | Bacteria | 607 |
| 398 | Ga0501311_019745 | 3300049527 | Bacteria | 906 |
| 399 | Ga0501311_047787 | 3300049527 | Bacteria | 664 |
| 400 | Ga0501311_055699 | 3300049527 | Bacteria | 628 |
| 401 | Ga0501311_063647 | 3300049527 | Bacteria | 600 |
| 402 | Ga0501313_020247 | 3300049529 | Bacteria | 818 |
| 403 | Ga0501313_025087 | 3300049529 | Bacteria | 753 |
| 404 | Ga0501313_026295 | 3300049529 | Bacteria | 740 |
| 405 | Ga0501315_055600 | 3300049531 | Bacteria | 631 |
| 406 | Ga0501316_034830 | 3300049532 | Bacteria | 686 |
| 407 | Ga0501317_012077 | 3300049533 | Bacteria | 1061 |
| 408 | Ga0501317_027795 | 3300049533 | Bacteria | 805 |
| 409 | Ga0501318_008937 | 3300049534 | Bacteria | 1082 |
| 410 | Ga0501318_009493 | 3300049534 | Bacteria | 1063 |
| 411 | Ga0501318_080983 | 3300049534 | Bacteria | 526 |
| 412 | Ga0501319_020683 | 3300049535 | Bacteria | 588 |
| 413 | Ga0501320_014836 | 3300049536 | Bacteria | 846 |
| 414 | Ga0501321_010891 | 3300049537 | Bacteria | 1006 |
| 415 | Ga0501321_014307 | 3300049537 | Bacteria | 922 |
| 416 | Ga0501321_046387 | 3300049537 | Bacteria | 624 |
| 417 | Ga0501322_017710 | 3300049538 | Bacteria | 605 |
| 418 | Ga0501325_038262 | 3300049541 | Bacteria | 575 |
| 419 | Ga0501325_050940 | 3300049541 | Bacteria | 527 |
| 420 | Ga0501040_0413671 | 3300049576 | Bacteria | 969 |
| 421 | Ga0501041_0405131 | 3300049577 | Bacteria | 864 |
| 422 | Ga0501067_0289343 | 3300049583 | Bacteria | 912 |
| 423 | Ga0501069_0059364 | 3300049585 | Bacteria | 2134 |
| 424 | Ga0501069_0335599 | 3300049585 | Bacteria | 890 |
| 425 | Ga0501070_0010837 | 3300049586 | Bacteria | 7701 |
| 426 | Ga0501073_0432901 | 3300049589 | Bacteria | 909 |
| 427 | Ga0501209_214775 | 3300049656 | Bacteria | 595 |
| 428 | Ga0501035_0420128 | 3300049822 | Bacteria | 1110 |
| 429 | Ga0501045_0923279 | 3300049824 | Bacteria | 641 |
| 430 | nmdc:mga03n38_589149_c1 | 3300050490 | Bacteria | 632 |
| 431 | nmdc:mga0yw44_267835_c1 | 3300050492 | Bacteria | 1140 |
| 432 | nmdc:mga0yw44_9555_c1 | 3300050492 | Bacteria | 4913 |
| 433 | nmdc:mga05p37_67921_c1 | 3300050507 | Bacteria | 4385 |
| 434 | nmdc:mga09592_435449_c1 | 3300050508 | Bacteria | 1132 |
| 435 | nmdc:mga09592_46945_c1 | 3300050508 | Bacteria | 3639 |
| 436 | nmdc:mga0qj67_29258_c1 | 3300050509 | Bacteria | 4279 |
| 437 | nmdc:mga06r32_218905_c1 | 3300050510 | Bacteria | 1892 |
| 438 | nmdc:mga06r32_44584_c1 | 3300050510 | Bacteria | 4224 |
| 439 | nmdc:mga08y16_853149_c1 | 3300050511 | Bacteria | 900 |
| 440 | nmdc:mga0n895_1419_c1 | 3300050512 | Bacteria | 17911 |
| 441 | nmdc:mga0n895_525564_c1 | 3300050512 | Bacteria | 1191 |
| 442 | nmdc:mga0n895_974406_c1 | 3300050512 | Bacteria | 830 |
| 443 | nmdc:mga0rr50_140769_c1 | 3300050513 | Bacteria | 1941 |
| 444 | nmdc:mga0rr50_714675_c1 | 3300050513 | Bacteria | 855 |
| 445 | nmdc:mga08x19_209758_c1 | 3300050514 | Bacteria | 1337 |
| 446 | nmdc:mga0a205_179782_c1 | 3300050515 | Bacteria | 2010 |
| 447 | nmdc:mga0a205_48045_c1 | 3300050515 | Bacteria | 4118 |
| 448 | Ga0495601_0034207 | 3300053077 | Bacteria | 3169 |
| 449 | Ga0495601_0135030 | 3300053077 | Bacteria | 1608 |
| 450 | Ga0495612_0026568 | 3300053078 | Bacteria | 2326 |
| 451 | Ga0495612_0045916 | 3300053078 | Bacteria | 1788 |
| 452 | Ga0495655_0052690 | 3300053083 | Bacteria | 1083 |
| 453 | Ga0495595_0065258 | 3300053084 | Bacteria | 1712 |
| 454 | Ga0495619_0041284 | 3300053085 | Bacteria | 3017 |
| 455 | Ga0495619_0084296 | 3300053085 | Bacteria | 2144 |
| 456 | Ga0495619_0125319 | 3300053085 | Bacteria | 1763 |
| 457 | Ga0500628_042839 | 3300053129 | Bacteria | 1042 |
| 458 | Ga0587084_051027 | 3300059477 | Bacteria | 732 |
| 459 | Ga0587084_069534 | 3300059477 | Bacteria | 662 |
| 460 | Ga0587093_036556 | 3300059478 | Bacteria | 729 |
| 461 | Ga0587093_057695 | 3300059478 | Bacteria | 627 |
| 462 | Ga0587070_074348 | 3300059491 | Bacteria | 732 |
| 463 | Ga0587070_091414 | 3300059491 | Bacteria | 685 |
| 464 | Ga0587070_109411 | 3300059491 | Bacteria | 647 |
| 465 | Ga0587070_138455 | 3300059491 | Bacteria | 599 |
| 466 | Ga0587070_155549 | 3300059491 | Bacteria | 577 |
| 467 | Ga0587073_0219509 | 3300059492 | Bacteria | 580 |
| 468 | Ga0587077_124303 | 3300059493 | Bacteria | 647 |
| 469 | Ga0587077_126608 | 3300059493 | Bacteria | 643 |
| 470 | Ga0587077_143113 | 3300059493 | Bacteria | 618 |
| 471 | Ga0587077_154535 | 3300059493 | Bacteria | 602 |
| 472 | Ga0587080_076739 | 3300059503 | Bacteria | 678 |
| 473 | Ga0587080_098313 | 3300059503 | Bacteria | 623 |
| 474 | Ga0587080_117477 | 3300059503 | Bacteria | 586 |
| 475 | Ga0587083_0099434 | 3300059505 | Bacteria | 722 |
| 476 | Ga0587083_0104143 | 3300059505 | Bacteria | 711 |
| 477 | Ga0587083_0142526 | 3300059505 | Bacteria | 640 |
| 478 | Ga0587083_0156281 | 3300059505 | Bacteria | 620 |
| 479 | Ga0587083_0189247 | 3300059505 | Bacteria | 581 |
| 480 | Ga0587086_063251 | 3300059507 | Bacteria | 621 |
| 481 | Ga0587088_027532 | 3300059508 | Bacteria | 994 |
| 482 | Ga0587088_061047 | 3300059508 | Bacteria | 764 |
| 483 | Ga0587088_090898 | 3300059508 | Bacteria | 668 |
| 484 | Ga0587090_076169 | 3300059510 | Bacteria | 664 |
| 485 | Ga0587090_082346 | 3300059510 | Bacteria | 647 |
| 486 | Ga0587091_102777 | 3300059511 | Bacteria | 672 |
| 487 | Ga0587092_112698 | 3300059512 | Bacteria | 573 |
| 488 | Ga0587094_054115 | 3300059513 | Bacteria | 687 |
| 489 | Ga0587094_066179 | 3300059513 | Bacteria | 642 |
| 490 | Ga0587095_019857 | 3300059514 | Bacteria | 639 |
| 491 | Ga0587098_034383 | 3300059604 | Bacteria | 712 |
| 492 | Ga0587098_055902 | 3300059604 | Bacteria | 609 |
| 493 | Ga0587106_071987 | 3300059605 | Bacteria | 657 |
| 494 | Ga0587106_087125 | 3300059605 | Bacteria | 618 |
| 495 | Ga0587106_102171 | 3300059605 | Bacteria | 587 |
| 496 | Ga0587099_030169 | 3300059622 | Bacteria | 655 |
| 497 | Ga0587113_022070 | 3300059625 | Bacteria | 676 |
| 498 | Ga0587115_040752 | 3300059626 | Bacteria | 724 |
| 499 | Ga0587115_080901 | 3300059626 | Bacteria | 576 |
| 500 | Ga0587122_038111 | 3300059628 | Bacteria | 589 |
| 501 | Ga0587122_056217 | 3300059628 | Bacteria | 520 |
| 502 | Ga0587128_096340 | 3300059630 | Bacteria | 614 |
| 503 | Ga0587062_058661 | 3300059639 | Bacteria | 670 |
| 504 | Ga0587067_103463 | 3300059640 | Bacteria | 662 |
| 505 | Ga0587068_076878 | 3300059641 | Bacteria | 668 |
| 506 | Ga0587068_099003 | 3300059641 | Bacteria | 610 |
| 507 | Ga0587069_076363 | 3300059642 | Bacteria | 646 |
| 508 | Ga0587075_023131 | 3300059644 | Bacteria | 938 |
| 509 | Ga0587075_099326 | 3300059644 | Bacteria | 579 |
| 510 | Ga0587075_119553 | 3300059644 | Bacteria | 544 |
| 511 | Ga0587076_126025 | 3300059645 | Bacteria | 598 |
| 512 | Ga0587078_047306 | 3300059646 | Bacteria | 623 |
| 513 | Ga0587079_056448 | 3300059647 | Bacteria | 839 |
| 514 | Ga0587079_101398 | 3300059647 | Bacteria | 688 |
| 515 | Ga0587079_126946 | 3300059647 | Bacteria | 637 |
| 516 | Ga0587100_019393 | 3300059648 | Bacteria | 652 |
| 517 | Ga0587102_032557 | 3300059649 | Bacteria | 643 |
| 518 | Ga0587110_037474 | 3300059654 | Bacteria | 613 |
| 519 | Ga0587114_010332 | 3300059655 | Bacteria | 1139 |
| 520 | Ga0587114_056058 | 3300059655 | Bacteria | 679 |
| 521 | Ga0587114_056309 | 3300059655 | Bacteria | 679 |
| 522 | Ga0587071_054436 | 3300060344 | Bacteria | 836 |
| 523 | Ga0587071_126532 | 3300060344 | Bacteria | 615 |
| 524 | Ga0587071_172803 | 3300060344 | Bacteria | 550 |
| 525 | Ga0587111_0035503 | 3300060346 | Bacteria | 1040 |
| 526 | Ga0587111_0122550 | 3300060346 | Bacteria | 671 |
| 527 | Ga0587111_0148043 | 3300060346 | Bacteria | 628 |
| 528 | Ga0587111_0196092 | 3300060346 | Bacteria | 570 |
| 529 | Ga0466962_0010205 | 3300061719 | Bacteria | 4511 |
| 530 | Ga0466962_0066884 | 3300061719 | Bacteria | 1716 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005441 | Ga0070700_100118606 | Ga0070700_1001186062 | 138 |
| 2 | 3300044842 | Ga0466957_0223574 | Ga0466957_0223574_520_1182 | 139 |
| 3 | 3300049127 | Ga0501306_023572 | Ga0501306_023572_137_580 | 141 |
| 4 | 3300049130 | Ga0501310_044852 | Ga0501310_044852_51_494 | 141 |
| 5 | 3300049527 | Ga0501311_047787 | Ga0501311_047787_139_582 | 141 |
| 6 | 3300049541 | Ga0501325_038262 | Ga0501325_038262_63_506 | 141 |
| 7 | 3300006237 | Ga0097621_101319690 | Ga0097621_1013196901 | 143 |
| 8 | iso_pu_bacteria | 2501939600 | 2501943325 | 143 |
| 9 | iso_pu_bacteria | 2515154088 | 2515496639 | 143 |
| 10 | iso_pu_bacteria | 2515154137 | 2515756878 | 143 |
| 11 | iso_pu_bacteria | 2515154203 | 2516089416 | 143 |
| 12 | iso_pu_bacteria | 2799112218 | 2799184960 | 143 |
| 13 | iso_pu_bacteria | 2856858025 | 2856858807 | 143 |
| 14 | iso_pu_bacteria | 2857710386 | 2857712607 | 143 |
| 15 | iso_pu_bacteria | 649633069 | 649810717 | 143 |
| 16 | iso_pu_bacteria | 8056060235 | 8056066389 | 143 |
| 17 | iso_pu_bacteria | 8057568493 | 8057574246 | 143 |
| 18 | 3300039450 | Ga0436363_1458574 | Ga0436363_1458574_126_578 | 146 |
| 19 | 3300003203 | JGI25406J46586_10095261 | JGI25406J46586_100952612 | 147 |
| 20 | 3300003308 | Ga0006777J48905_1036991 | Ga0006777J48905_10369911 | 147 |
| 21 | 3300003574 | Ga0007410J51695_1072619 | Ga0007410J51695_10726191 | 147 |
| 22 | 3300003693 | Ga0032354_1115994 | Ga0032354_11159941 | 147 |
| 23 | 3300004798 | Ga0058859_10019153 | Ga0058859_100191531 | 147 |
| 24 | 3300004800 | Ga0058861_11944092 | Ga0058861_119440921 | 147 |
| 25 | 3300004800 | Ga0058861_12045397 | Ga0058861_120453972 | 147 |
| 26 | 3300004801 | Ga0058860_10006825 | Ga0058860_100068251 | 147 |
| 27 | 3300004803 | Ga0058862_12861556 | Ga0058862_128615562 | 147 |
| 28 | 3300005329 | Ga0070683_100154117 | Ga0070683_1001541173 | 147 |
| 29 | 3300005329 | Ga0070683_100225583 | Ga0070683_1002255832 | 147 |
| 30 | 3300005329 | Ga0070683_100540742 | Ga0070683_1005407422 | 147 |
| 31 | 3300005329 | Ga0070683_100818630 | Ga0070683_1008186301 | 147 |
| 32 | 3300005337 | Ga0070682_100125048 | Ga0070682_1001250482 | 147 |
| 33 | 3300005337 | Ga0070682_101106624 | Ga0070682_1011066241 | 147 |
| 34 | 3300005354 | Ga0070675_100542834 | Ga0070675_1005428341 | 147 |
| 35 | 3300005356 | Ga0070674_100623435 | Ga0070674_1006234352 | 147 |
| 36 | 3300005364 | Ga0070673_100904133 | Ga0070673_1009041332 | 147 |
| 37 | 3300005434 | Ga0070709_10001455 | Ga0070709_100014553 | 147 |
| 38 | 3300005435 | Ga0070714_100052022 | Ga0070714_1000520223 | 147 |
| 39 | 3300005435 | Ga0070714_100156558 | Ga0070714_1001565583 | 147 |
| 40 | 3300005435 | Ga0070714_100236242 | Ga0070714_1002362422 | 147 |
| 41 | 3300005436 | Ga0070713_100011062 | Ga0070713_1000110624 | 147 |
| 42 | 3300005436 | Ga0070713_100020440 | Ga0070713_1000204402 | 147 |
| 43 | 3300005436 | Ga0070713_100161382 | Ga0070713_1001613823 | 147 |
| 44 | 3300005437 | Ga0070710_10001125 | Ga0070710_1000112511 | 147 |
| 45 | 3300005437 | Ga0070710_10007540 | Ga0070710_100075404 | 147 |
| 46 | 3300005438 | Ga0070701_10710556 | Ga0070701_107105561 | 147 |
| 47 | 3300005439 | Ga0070711_100005971 | Ga0070711_1000059712 | 147 |
| 48 | 3300005439 | Ga0070711_100028529 | Ga0070711_1000285294 | 147 |
| 49 | 3300005441 | Ga0070700_100080477 | Ga0070700_1000804773 | 147 |
| 50 | 3300005445 | Ga0070708_100053481 | Ga0070708_1000534813 | 147 |
| 51 | 3300005445 | Ga0070708_100079517 | Ga0070708_1000795171 | 147 |
| 52 | 3300005456 | Ga0070678_100422092 | Ga0070678_1004220921 | 147 |
| 53 | 3300005467 | Ga0070706_100006965 | Ga0070706_1000069659 | 147 |
| 54 | 3300005467 | Ga0070706_100352591 | Ga0070706_1003525912 | 147 |
| 55 | 3300005468 | Ga0070707_100002209 | Ga0070707_1000022093 | 147 |
| 56 | 3300005468 | Ga0070707_100006776 | Ga0070707_1000067768 | 147 |
| 57 | 3300005468 | Ga0070707_100112347 | Ga0070707_1001123472 | 147 |
| 58 | 3300005471 | Ga0070698_100001064 | Ga0070698_10000106435 | 147 |
| 59 | 3300005471 | Ga0070698_100001092 | Ga0070698_10000109221 | 147 |
| 60 | 3300005518 | Ga0070699_100151677 | Ga0070699_1001516772 | 147 |
| 61 | 3300005518 | Ga0070699_100708604 | Ga0070699_1007086041 | 147 |
| 62 | 3300005530 | Ga0070679_100284160 | Ga0070679_1002841601 | 147 |
| 63 | 3300005530 | Ga0070679_100333778 | Ga0070679_1003337781 | 147 |
| 64 | 3300005535 | Ga0070684_100264225 | Ga0070684_1002642251 | 147 |
| 65 | 3300005535 | Ga0070684_100299370 | Ga0070684_1002993703 | 147 |
| 66 | 3300005536 | Ga0070697_100045343 | Ga0070697_1000453433 | 147 |
| 67 | 3300005536 | Ga0070697_100373844 | Ga0070697_1003738442 | 147 |
| 68 | 3300005543 | Ga0070672_100343184 | Ga0070672_1003431843 | 147 |
| 69 | 3300005548 | Ga0070665_100001255 | Ga0070665_1000012557 | 147 |
| 70 | 3300005614 | Ga0068856_100320680 | Ga0068856_1003206801 | 147 |
| 71 | 3300005615 | Ga0070702_100497200 | Ga0070702_1004972002 | 147 |
| 72 | 3300005616 | Ga0068852_100401355 | Ga0068852_1004013552 | 147 |
| 73 | 3300005616 | Ga0068852_100439459 | Ga0068852_1004394592 | 147 |
| 74 | 3300005618 | Ga0068864_100307428 | Ga0068864_1003074282 | 147 |
| 75 | 3300005719 | Ga0068861_100326108 | Ga0068861_1003261082 | 147 |
| 76 | 3300005842 | Ga0068858_100148884 | Ga0068858_1001488843 | 147 |
| 77 | 3300005937 | Ga0081455_10219428 | Ga0081455_102194282 | 147 |
| 78 | 3300005985 | Ga0081539_10000109 | Ga0081539_1000010951 | 147 |
| 79 | 3300005985 | Ga0081539_10001279 | Ga0081539_1000127912 | 147 |
| 80 | 3300005985 | Ga0081539_10013009 | Ga0081539_100130094 | 147 |
| 81 | 3300005985 | Ga0081539_10110835 | Ga0081539_101108351 | 147 |
| 82 | 3300006028 | Ga0070717_10001284 | Ga0070717_1000128419 | 147 |
| 83 | 3300006028 | Ga0070717_10064517 | Ga0070717_100645172 | 147 |
| 84 | 3300006028 | Ga0070717_10224132 | Ga0070717_102241323 | 147 |
| 85 | 3300006028 | Ga0070717_10475191 | Ga0070717_104751911 | 147 |
| 86 | 3300006038 | Ga0075365_10014105 | Ga0075365_100141052 | 147 |
| 87 | 3300006038 | Ga0075365_10082498 | Ga0075365_100824983 | 147 |
| 88 | 3300006163 | Ga0070715_10011755 | Ga0070715_100117553 | 147 |
| 89 | 3300006173 | Ga0070716_100001036 | Ga0070716_1000010369 | 147 |
| 90 | 3300006173 | Ga0070716_100003067 | Ga0070716_1000030677 | 147 |
| 91 | 3300006175 | Ga0070712_100003579 | Ga0070712_10000357910 | 147 |
| 92 | 3300006175 | Ga0070712_100038079 | Ga0070712_1000380793 | 147 |
| 93 | 3300006237 | Ga0097621_101216898 | Ga0097621_1012168981 | 147 |
| 94 | 3300006237 | Ga0097621_101347764 | Ga0097621_1013477642 | 147 |
| 95 | 3300006844 | Ga0075428_100000164 | Ga0075428_10000016427 | 147 |
| 96 | 3300006844 | Ga0075428_100323190 | Ga0075428_1003231902 | 147 |
| 97 | 3300006844 | Ga0075428_100872424 | Ga0075428_1008724241 | 147 |
| 98 | 3300006844 | Ga0075428_100895020 | Ga0075428_1008950202 | 147 |
| 99 | 3300006846 | Ga0075430_100017165 | Ga0075430_1000171657 | 147 |
| 100 | 3300006847 | Ga0075431_100132615 | Ga0075431_1001326152 | 147 |
| 101 | 3300006847 | Ga0075431_100236960 | Ga0075431_1002369602 | 147 |
| 102 | 3300006852 | Ga0075433_10052435 | Ga0075433_100524352 | 147 |
| 103 | 3300006871 | Ga0075434_100037594 | Ga0075434_1000375944 | 147 |
| 104 | 3300006880 | Ga0075429_100040914 | Ga0075429_1000409143 | 147 |
| 105 | 3300006880 | Ga0075429_100119690 | Ga0075429_1001196903 | 147 |
| 106 | 3300006881 | Ga0068865_100025829 | Ga0068865_1000258293 | 147 |
| 107 | 3300006914 | Ga0075436_100066281 | Ga0075436_1000662813 | 147 |
| 108 | 3300006914 | Ga0075436_100087700 | Ga0075436_1000877001 | 147 |
| 109 | 3300007076 | Ga0075435_100097305 | Ga0075435_1000973053 | 147 |
| 110 | 3300007076 | Ga0075435_100192125 | Ga0075435_1001921251 | 147 |
| 111 | 3300009094 | Ga0111539_10086254 | Ga0111539_100862545 | 147 |
| 112 | 3300009094 | Ga0111539_10544147 | Ga0111539_105441472 | 147 |
| 113 | 3300009147 | Ga0114129_10003730 | Ga0114129_100037307 | 147 |
| 114 | 3300009147 | Ga0114129_10156346 | Ga0114129_101563464 | 147 |
| 115 | 3300009148 | Ga0105243_10090270 | Ga0105243_100902702 | 147 |
| 116 | 3300009148 | Ga0105243_10153159 | Ga0105243_101531592 | 147 |
| 117 | 3300009148 | Ga0105243_10243779 | Ga0105243_102437792 | 147 |
| 118 | 3300009174 | Ga0105241_10567665 | Ga0105241_105676651 | 147 |
| 119 | 3300009176 | Ga0105242_10215773 | Ga0105242_102157733 | 147 |
| 120 | 3300009551 | Ga0105238_10874906 | Ga0105238_108749062 | 147 |
| 121 | 3300009551 | Ga0105238_11240680 | Ga0105238_112406802 | 147 |
| 122 | 3300009553 | Ga0105249_10268781 | Ga0105249_102687813 | 147 |
| 123 | 3300010375 | Ga0105239_10002486 | Ga0105239_100024867 | 147 |
| 124 | 3300010375 | Ga0105239_10332976 | Ga0105239_103329762 | 147 |
| 125 | 3300011119 | Ga0105246_10000375 | Ga0105246_100003757 | 147 |
| 126 | 3300012475 | Ga0157317_1014206 | Ga0157317_10142062 | 147 |
| 127 | 3300013045 | Ga0154016_142311 | Ga0154016_1423112 | 147 |
| 128 | 3300013100 | Ga0157373_10110790 | Ga0157373_101107902 | 147 |
| 129 | 3300013105 | Ga0157369_10015392 | Ga0157369_100153925 | 147 |
| 130 | 3300013105 | Ga0157369_10142373 | Ga0157369_101423733 | 147 |
| 131 | 3300013105 | Ga0157369_10334496 | Ga0157369_103344963 | 147 |
| 132 | 3300013296 | Ga0157374_10656699 | Ga0157374_106566992 | 147 |
| 133 | 3300013296 | Ga0157374_11228528 | Ga0157374_112285282 | 147 |
| 134 | 3300013306 | Ga0163162_10273040 | Ga0163162_102730402 | 147 |
| 135 | 3300013306 | Ga0163162_10772735 | Ga0163162_107727351 | 147 |
| 136 | 3300013307 | Ga0157372_10058284 | Ga0157372_100582843 | 147 |
| 137 | 3300013307 | Ga0157372_10213914 | Ga0157372_102139142 | 147 |
| 138 | 3300013307 | Ga0157372_11863323 | Ga0157372_118633231 | 147 |
| 139 | 3300013308 | Ga0157375_10038724 | Ga0157375_100387243 | 147 |
| 140 | 3300013308 | Ga0157375_10965135 | Ga0157375_109651352 | 147 |
| 141 | 3300014325 | Ga0163163_10081345 | Ga0163163_100813454 | 147 |
| 142 | 3300014325 | Ga0163163_10610100 | Ga0163163_106101002 | 147 |
| 143 | 3300014325 | Ga0163163_10639673 | Ga0163163_106396732 | 147 |
| 144 | 3300014326 | Ga0157380_10755521 | Ga0157380_107555212 | 147 |
| 145 | 3300014968 | Ga0157379_10267367 | Ga0157379_102673673 | 147 |
| 146 | 3300014968 | Ga0157379_10353568 | Ga0157379_103535681 | 147 |
| 147 | 3300017792 | Ga0163161_10307386 | Ga0163161_103073861 | 147 |
| 148 | 3300019190 | Ga0184600_117791 | Ga0184600_1177911 | 147 |
| 149 | 3300020069 | Ga0197907_10290678 | Ga0197907_102906781 | 147 |
| 150 | 3300020069 | Ga0197907_10662353 | Ga0197907_106623531 | 147 |
| 151 | 3300020069 | Ga0197907_11132255 | Ga0197907_111322551 | 147 |
| 152 | 3300020069 | Ga0197907_11210708 | Ga0197907_112107081 | 147 |
| 153 | 3300020070 | Ga0206356_10202265 | Ga0206356_102022652 | 147 |
| 154 | 3300020070 | Ga0206356_10205106 | Ga0206356_102051063 | 147 |
| 155 | 3300020070 | Ga0206356_10809232 | Ga0206356_108092321 | 147 |
| 156 | 3300020075 | Ga0206349_1054364 | Ga0206349_10543641 | 147 |
| 157 | 3300020075 | Ga0206349_1166079 | Ga0206349_11660791 | 147 |
| 158 | 3300020075 | Ga0206349_1491499 | Ga0206349_14914991 | 147 |
| 159 | 3300020075 | Ga0206349_1652759 | Ga0206349_16527592 | 147 |
| 160 | 3300020076 | Ga0206355_1162727 | Ga0206355_11627271 | 147 |
| 161 | 3300020076 | Ga0206355_1407193 | Ga0206355_14071932 | 147 |
| 162 | 3300020077 | Ga0206351_10545088 | Ga0206351_105450881 | 147 |
| 163 | 3300020077 | Ga0206351_10895652 | Ga0206351_108956521 | 147 |
| 164 | 3300020078 | Ga0206352_10079568 | Ga0206352_100795681 | 147 |
| 165 | 3300020078 | Ga0206352_10108346 | Ga0206352_101083461 | 147 |
| 166 | 3300020078 | Ga0206352_10225768 | Ga0206352_102257682 | 147 |
| 167 | 3300020080 | Ga0206350_10330016 | Ga0206350_103300161 | 147 |
| 168 | 3300020081 | Ga0206354_10007464 | Ga0206354_100074641 | 147 |
| 169 | 3300020081 | Ga0206354_11039646 | Ga0206354_110396461 | 147 |
| 170 | 3300020081 | Ga0206354_11448685 | Ga0206354_114486853 | 147 |
| 171 | 3300020081 | Ga0206354_11695497 | Ga0206354_116954972 | 147 |
| 172 | 3300020082 | Ga0206353_11556168 | Ga0206353_115561682 | 147 |
| 173 | 3300020610 | Ga0154015_1233679 | Ga0154015_12336791 | 147 |
| 174 | 3300020610 | Ga0154015_1552073 | Ga0154015_15520731 | 147 |
| 175 | 3300021384 | Ga0213876_10570499 | Ga0213876_105704991 | 147 |
| 176 | 3300021388 | Ga0213875_10002764 | Ga0213875_1000276410 | 147 |
| 177 | 3300022467 | Ga0224712_10109006 | Ga0224712_101090062 | 147 |
| 178 | 3300025898 | Ga0207692_10000557 | Ga0207692_1000055713 | 147 |
| 179 | 3300025898 | Ga0207692_10002027 | Ga0207692_100020273 | 147 |
| 180 | 3300025901 | Ga0207688_10021140 | Ga0207688_100211404 | 147 |
| 181 | 3300025905 | Ga0207685_10010246 | Ga0207685_100102462 | 147 |
| 182 | 3300025906 | Ga0207699_10000106 | Ga0207699_100001062 | 147 |
| 183 | 3300025906 | Ga0207699_10005750 | Ga0207699_100057505 | 147 |
| 184 | 3300025910 | Ga0207684_10001153 | Ga0207684_1000115340 | 147 |
| 185 | 3300025910 | Ga0207684_10002031 | Ga0207684_100020315 | 147 |
| 186 | 3300025910 | Ga0207684_10194672 | Ga0207684_101946721 | 147 |
| 187 | 3300025910 | Ga0207684_10393451 | Ga0207684_103934512 | 147 |
| 188 | 3300025915 | Ga0207693_10001488 | Ga0207693_100014882 | 147 |
| 189 | 3300025915 | Ga0207693_10071464 | Ga0207693_100714645 | 147 |
| 190 | 3300025916 | Ga0207663_10003956 | Ga0207663_100039562 | 147 |
| 191 | 3300025916 | Ga0207663_10006837 | Ga0207663_100068374 | 147 |
| 192 | 3300025916 | Ga0207663_10525783 | Ga0207663_105257832 | 147 |
| 193 | 3300025917 | Ga0207660_11324508 | Ga0207660_113245081 | 147 |
| 194 | 3300025919 | Ga0207657_10066977 | Ga0207657_100669772 | 147 |
| 195 | 3300025921 | Ga0207652_10205613 | Ga0207652_102056133 | 147 |
| 196 | 3300025922 | Ga0207646_10001638 | Ga0207646_100016387 | 147 |
| 197 | 3300025922 | Ga0207646_10008339 | Ga0207646_100083394 | 147 |
| 198 | 3300025922 | Ga0207646_10012907 | Ga0207646_100129073 | 147 |
| 199 | 3300025922 | Ga0207646_10104990 | Ga0207646_101049901 | 147 |
| 200 | 3300025924 | Ga0207694_11626759 | Ga0207694_116267591 | 147 |
| 201 | 3300025927 | Ga0207687_10013387 | Ga0207687_100133871 | 147 |
| 202 | 3300025928 | Ga0207700_10002205 | Ga0207700_1000220510 | 147 |
| 203 | 3300025928 | Ga0207700_10002355 | Ga0207700_100023557 | 147 |
| 204 | 3300025928 | Ga0207700_10007455 | Ga0207700_100074557 | 147 |
| 205 | 3300025928 | Ga0207700_10146857 | Ga0207700_101468573 | 147 |
| 206 | 3300025928 | Ga0207700_10818224 | Ga0207700_108182242 | 147 |
| 207 | 3300025929 | Ga0207664_10004846 | Ga0207664_100048462 | 147 |
| 208 | 3300025929 | Ga0207664_10011089 | Ga0207664_100110893 | 147 |
| 209 | 3300025929 | Ga0207664_10012295 | Ga0207664_100122956 | 147 |
| 210 | 3300025929 | Ga0207664_10340641 | Ga0207664_103406411 | 147 |
| 211 | 3300025935 | Ga0207709_10211059 | Ga0207709_102110592 | 147 |
| 212 | 3300025936 | Ga0207670_10394924 | Ga0207670_103949242 | 147 |
| 213 | 3300025937 | Ga0207669_10733269 | Ga0207669_107332692 | 147 |
| 214 | 3300025938 | Ga0207704_11025787 | Ga0207704_110257871 | 147 |
| 215 | 3300025939 | Ga0207665_10000812 | Ga0207665_1000081219 | 147 |
| 216 | 3300025939 | Ga0207665_10002563 | Ga0207665_100025636 | 147 |
| 217 | 3300025940 | Ga0207691_10289076 | Ga0207691_102890762 | 147 |
| 218 | 3300025944 | Ga0207661_10030791 | Ga0207661_100307911 | 147 |
| 219 | 3300025944 | Ga0207661_10039725 | Ga0207661_100397254 | 147 |
| 220 | 3300025960 | Ga0207651_10228281 | Ga0207651_102282812 | 147 |
| 221 | 3300025986 | Ga0207658_10512494 | Ga0207658_105124941 | 147 |
| 222 | 3300026035 | Ga0207703_11666711 | Ga0207703_116667112 | 147 |
| 223 | 3300026075 | Ga0207708_10202673 | Ga0207708_102026732 | 147 |
| 224 | 3300026118 | Ga0207675_100973958 | Ga0207675_1009739582 | 147 |
| 225 | 3300026121 | Ga0207683_10196077 | Ga0207683_101960773 | 147 |
| 226 | 3300026121 | Ga0207683_10549034 | Ga0207683_105490342 | 147 |
| 227 | 3300026142 | Ga0207698_10328466 | Ga0207698_103284662 | 147 |
| 228 | 3300026142 | Ga0207698_10721099 | Ga0207698_107210991 | 147 |
| 229 | 3300027907 | Ga0207428_10255197 | Ga0207428_102551972 | 147 |
| 230 | 3300028379 | Ga0268266_10008784 | Ga0268266_100087845 | 147 |
| 231 | 3300031090 | Ga0265760_10021225 | Ga0265760_100212253 | 147 |
| 232 | 3300031616 | Ga0307508_10049690 | Ga0307508_100496902 | 147 |
| 233 | 3300031636 | Ga0310113_121820 | Ga0310113_1218201 | 147 |
| 234 | 3300031649 | Ga0307514_10290350 | Ga0307514_102903501 | 147 |
| 235 | 3300031667 | Ga0310111_122074 | Ga0310111_1220742 | 147 |
| 236 | 3300031731 | Ga0307405_10502973 | Ga0307405_105029731 | 147 |
| 237 | 3300031824 | Ga0307413_10465162 | Ga0307413_104651622 | 147 |
| 238 | 3300031901 | Ga0307406_10017188 | Ga0307406_100171886 | 147 |
| 239 | 3300032002 | Ga0307416_100200474 | Ga0307416_1002004743 | 147 |
| 240 | 3300032002 | Ga0307416_101221898 | Ga0307416_1012218981 | 147 |
| 241 | 3300035083 | Ga0373926_0007881 | Ga0373926_0007881_1769_2248 | 147 |
| 242 | 3300035083 | Ga0373926_0227368 | Ga0373926_0227368_190_663 | 147 |
| 243 | 3300035086 | Ga0373934_0011736 | Ga0373934_0011736_1667_2140 | 147 |
| 244 | 3300035091 | Ga0373951_0209917 | Ga0373951_0209917_15_488 | 147 |
| 245 | 3300035111 | Ga0373923_0077706 | Ga0373923_0077706_438_911 | 147 |
| 246 | 3300035113 | Ga0373936_0045129 | Ga0373936_0045129_329_802 | 147 |
| 247 | 3300035116 | Ga0373945_0148143 | Ga0373945_0148143_464_937 | 147 |
| 248 | 3300035116 | Ga0373945_0154399 | Ga0373945_0154399_406_879 | 147 |
| 249 | 3300035117 | Ga0373953_0100873 | Ga0373953_0100873_404_877 | 147 |
| 250 | 3300035118 | Ga0373954_0056344 | Ga0373954_0056344_406_879 | 147 |
| 251 | 3300035119 | Ga0373956_0022380 | Ga0373956_0022380_972_1445 | 147 |
| 252 | 3300035120 | Ga0373957_0023880 | Ga0373957_0023880_776_1249 | 147 |
| 253 | 3300035120 | Ga0373957_0090705 | Ga0373957_0090705_35_508 | 147 |
| 254 | 3300035170 | Ga0373943_0064053 | Ga0373943_0064053_1016_1489 | 147 |
| 255 | 3300035170 | Ga0373943_0103053 | Ga0373943_0103053_555_1028 | 147 |
| 256 | 3300035170 | Ga0373943_0445793 | Ga0373943_0445793_26_499 | 147 |
| 257 | 3300035171 | Ga0373946_0092426 | Ga0373946_0092426_228_701 | 147 |
| 258 | 3300035172 | Ga0373955_0005831 | Ga0373955_0005831_2131_2604 | 147 |
| 259 | 3300035172 | Ga0373955_0127980 | Ga0373955_0127980_701_1174 | 147 |
| 260 | 3300035172 | Ga0373955_0262230 | Ga0373955_0262230_404_877 | 147 |
| 261 | 3300035410 | Ga0373924_0505734 | Ga0373924_0505734_48_521 | 147 |
| 262 | 3300035692 | Ga0373935_0001997 | Ga0373935_0001997_10432_10911 | 147 |
| 263 | 3300035692 | Ga0373935_0081531 | Ga0373935_0081531_409_882 | 147 |
| 264 | 3300035692 | Ga0373935_0160004 | Ga0373935_0160004_680_1153 | 147 |
| 265 | 3300035692 | Ga0373935_0670900 | Ga0373935_0670900_53_526 | 147 |
| 266 | 3300035695 | Ga0373927_0350383 | Ga0373927_0350383_37_510 | 147 |
| 267 | 3300035724 | Ga0373933_0140149 | Ga0373933_0140149_859_1332 | 147 |
| 268 | 3300035724 | Ga0373933_0190478 | Ga0373933_0190478_818_1291 | 147 |
| 269 | 3300035724 | Ga0373933_0201506 | Ga0373933_0201506_404_877 | 147 |
| 270 | 3300035725 | Ga0373947_0000004 | Ga0373947_0000004_185511_185990 | 147 |
| 271 | 3300035725 | Ga0373947_0124526 | Ga0373947_0124526_35_508 | 147 |
| 272 | 3300036401 | Ga0373937_0017771 | Ga0373937_0017771_1704_2177 | 147 |
| 273 | 3300037068 | Ga0373925_0003782 | Ga0373925_0003782_10586_11059 | 147 |
| 274 | 3300037068 | Ga0373925_0049135 | Ga0373925_0049135_2226_2699 | 147 |
| 275 | 3300037068 | Ga0373925_0119304 | Ga0373925_0119304_994_1467 | 147 |
| 276 | 3300037312 | Ga0395899_0056163 | Ga0395899_0056163_1243_1686 | 147 |
| 277 | 3300037418 | Ga0395900_0147607 | Ga0395900_0147607_1248_1691 | 147 |
| 278 | 3300037418 | Ga0395900_0772275 | Ga0395900_0772275_83_526 | 147 |
| 279 | 3300037466 | Ga0395898_0030030 | Ga0395898_0030030_227_670 | 147 |
| 280 | 3300037853 | Ga0436364_0385416 | Ga0436364_0385416_16295_16738 | 147 |
| 281 | 3300037853 | Ga0436364_0409793 | Ga0436364_0409793_1619_2083 | 147 |
| 282 | 3300038443 | Ga0395901_0054733 | Ga0395901_0054733_129_572 | 147 |
| 283 | 3300039437 | Ga0436365_1816359 | Ga0436365_1816359_141_584 | 147 |
| 284 | 3300041444 | Ga0451790_33454 | Ga0451790_33454_110_553 | 147 |
| 285 | 3300041445 | Ga0451792_20358 | Ga0451792_20358_92_535 | 147 |
| 286 | 3300041452 | Ga0451793_1537465 | Ga0451793_1537465_89_532 | 147 |
| 287 | 3300041512 | Ga0451853_3672276 | Ga0451853_3672276_397_840 | 147 |
| 288 | 3300044656 | Ga0466969_0074639 | Ga0466969_0074639_683_1126 | 147 |
| 289 | 3300044656 | Ga0466969_0201771 | Ga0466969_0201771_317_790 | 147 |
| 290 | 3300044684 | Ga0466966_0007159 | Ga0466966_0007159_5749_6192 | 147 |
| 291 | 3300044684 | Ga0466966_0429874 | Ga0466966_0429874_38_481 | 147 |
| 292 | 3300044693 | Ga0466961_0122139 | Ga0466961_0122139_204_647 | 147 |
| 293 | 3300044693 | Ga0466961_0474089 | Ga0466961_0474089_130_603 | 147 |
| 294 | 3300044694 | Ga0466963_0013682 | Ga0466963_0013682_671_1114 | 147 |
| 295 | 3300044694 | Ga0466963_0231822 | Ga0466963_0231822_573_1046 | 147 |
| 296 | 3300044719 | Ga0466971_0018447 | Ga0466971_0018447_1854_2297 | 147 |
| 297 | 3300044765 | Ga0466970_0093046 | Ga0466970_0093046_808_1251 | 147 |
| 298 | 3300044765 | Ga0466970_0195330 | Ga0466970_0195330_252_695 | 147 |
| 299 | 3300044765 | Ga0466970_0588276 | Ga0466970_0588276_38_481 | 147 |
| 300 | 3300044842 | Ga0466957_0642505 | Ga0466957_0642505_168_611 | 147 |
| 301 | 3300044901 | Ga0466960_0024128 | Ga0466960_0024128_906_1349 | 147 |
| 302 | 3300044901 | Ga0466960_0317345 | Ga0466960_0317345_64_507 | 147 |
| 303 | 3300045976 | Ga0466967_0029836 | Ga0466967_0029836_1074_1517 | 147 |
| 304 | 3300046459 | Ga0495629_0089546 | Ga0495629_0089546_1326_1799 | 147 |
| 305 | 3300046459 | Ga0495629_0169963 | Ga0495629_0169963_515_958 | 147 |
| 306 | 3300046461 | Ga0495641_0082391 | Ga0495641_0082391_416_889 | 147 |
| 307 | 3300046462 | Ga0495651_0009348 | Ga0495651_0009348_1022_1495 | 147 |
| 308 | 3300046462 | Ga0495651_0197298 | Ga0495651_0197298_663_1136 | 147 |
| 309 | 3300046463 | Ga0495653_0074168 | Ga0495653_0074168_1245_1718 | 147 |
| 310 | 3300046463 | Ga0495653_0199725 | Ga0495653_0199725_414_887 | 147 |
| 311 | 3300046463 | Ga0495653_0252246 | Ga0495653_0252246_567_1040 | 147 |
| 312 | 3300046472 | Ga0495580_0136672 | Ga0495580_0136672_1132_1605 | 147 |
| 313 | 3300046473 | Ga0495582_0318642 | Ga0495582_0318642_400_873 | 147 |
| 314 | 3300046476 | Ga0495662_0049388 | Ga0495662_0049388_1237_1710 | 147 |
| 315 | 3300046477 | Ga0495664_0013997 | Ga0495664_0013997_3669_4142 | 147 |
| 316 | 3300046477 | Ga0495664_0056528 | Ga0495664_0056528_1295_1768 | 147 |
| 317 | 3300046477 | Ga0495664_0084322 | Ga0495664_0084322_251_724 | 147 |
| 318 | 3300046477 | Ga0495664_0094473 | Ga0495664_0094473_941_1414 | 147 |
| 319 | 3300046477 | Ga0495664_0350402 | Ga0495664_0350402_197_667 | 147 |
| 320 | 3300046511 | Ga0495608_0039257 | Ga0495608_0039257_380_853 | 147 |
| 321 | 3300046511 | Ga0495608_0085273 | Ga0495608_0085273_131_604 | 147 |
| 322 | 3300046514 | Ga0495618_0404296 | Ga0495618_0404296_231_704 | 147 |
| 323 | 3300046516 | Ga0495628_0098369 | Ga0495628_0098369_1004_1477 | 147 |
| 324 | 3300046516 | Ga0495628_0117967 | Ga0495628_0117967_97_570 | 147 |
| 325 | 3300046517 | Ga0495630_0153243 | Ga0495630_0153243_35_508 | 147 |
| 326 | 3300046517 | Ga0495630_0316593 | Ga0495630_0316593_231_674 | 147 |
| 327 | 3300046526 | Ga0495666_0132013 | Ga0495666_0132013_391_864 | 147 |
| 328 | 3300046529 | Ga0495652_0023588 | Ga0495652_0023588_581_1054 | 147 |
| 329 | 3300046529 | Ga0495652_0248495 | Ga0495652_0248495_606_1079 | 147 |
| 330 | 3300046529 | Ga0495652_0404635 | Ga0495652_0404635_13_486 | 147 |
| 331 | 3300046531 | Ga0495665_0071907 | Ga0495665_0071907_1188_1661 | 147 |
| 332 | 3300046535 | Ga0495586_0067787 | Ga0495586_0067787_384_857 | 147 |
| 333 | 3300046535 | Ga0495586_0391505 | Ga0495586_0391505_130_603 | 147 |
| 334 | 3300046543 | Ga0495645_0086892 | Ga0495645_0086892_279_749 | 147 |
| 335 | 3300046543 | Ga0495645_0109212 | Ga0495645_0109212_1138_1611 | 147 |
| 336 | 3300046543 | Ga0495645_0207619 | Ga0495645_0207619_668_1141 | 147 |
| 337 | 3300046559 | Ga0495667_0003897 | Ga0495667_0003897_9476_9949 | 147 |
| 338 | 3300046559 | Ga0495667_0073522 | Ga0495667_0073522_1468_1941 | 147 |
| 339 | 3300046642 | Ga0495634_0068703 | Ga0495634_0068703_1468_1941 | 147 |
| 340 | 3300046663 | Ga0495635_0214659 | Ga0495635_0214659_426_899 | 147 |
| 341 | 3300046675 | Ga0495657_0002905 | Ga0495657_0002905_9347_9820 | 147 |
| 342 | 3300046675 | Ga0495657_0080391 | Ga0495657_0080391_1526_1969 | 147 |
| 343 | 3300046675 | Ga0495657_0198217 | Ga0495657_0198217_476_949 | 147 |
| 344 | 3300046678 | Ga0495599_0149766 | Ga0495599_0149766_231_704 | 147 |
| 345 | 3300046678 | Ga0495599_0156593 | Ga0495599_0156593_606_1079 | 147 |
| 346 | 3300046678 | Ga0495599_0314480 | Ga0495599_0314480_99_572 | 147 |
| 347 | 3300046678 | Ga0495599_0371764 | Ga0495599_0371764_220_693 | 147 |
| 348 | 3300046679 | Ga0495623_0078419 | Ga0495623_0078419_1202_1675 | 147 |
| 349 | 3300046679 | Ga0495623_0175326 | Ga0495623_0175326_742_1215 | 147 |
| 350 | 3300046680 | Ga0495646_0123300 | Ga0495646_0123300_285_758 | 147 |
| 351 | 3300046680 | Ga0495646_0151355 | Ga0495646_0151355_358_831 | 147 |
| 352 | 3300046683 | Ga0495658_0007574 | Ga0495658_0007574_596_1069 | 147 |
| 353 | 3300046683 | Ga0495658_0154646 | Ga0495658_0154646_393_836 | 147 |
| 354 | 3300046690 | Ga0495624_0041470 | Ga0495624_0041470_296_769 | 147 |
| 355 | 3300046690 | Ga0495624_0566428 | Ga0495624_0566428_170_643 | 147 |
| 356 | 3300046809 | Ga0495600_0001528 | Ga0495600_0001528_3481_3954 | 147 |
| 357 | 3300046809 | Ga0495600_0052964 | Ga0495600_0052964_1095_1568 | 147 |
| 358 | 3300046809 | Ga0495600_0112950 | Ga0495600_0112950_1233_1676 | 147 |
| 359 | 3300047315 | Ga0495581_0063337 | Ga0495581_0063337_345_788 | 147 |
| 360 | 3300047315 | Ga0495581_0120987 | Ga0495581_0120987_404_877 | 147 |
| 361 | 3300047317 | Ga0495604_0039494 | Ga0495604_0039494_1173_1646 | 147 |
| 362 | 3300047319 | Ga0495674_0033733 | Ga0495674_0033733_2206_2679 | 147 |
| 363 | 3300047319 | Ga0495674_0274138 | Ga0495674_0274138_271_744 | 147 |
| 364 | 3300047322 | Ga0495680_0012040 | Ga0495680_0012040_1168_1641 | 147 |
| 365 | 3300047322 | Ga0495680_0035576 | Ga0495680_0035576_3374_3847 | 147 |
| 366 | 3300047444 | Ga0495675_0054121 | Ga0495675_0054121_213_686 | 147 |
| 367 | 3300047444 | Ga0495675_0074293 | Ga0495675_0074293_707_1180 | 147 |
| 368 | 3300047471 | Ga0495684_0151628 | Ga0495684_0151628_1099_1572 | 147 |
| 369 | 3300047471 | Ga0495684_0208268 | Ga0495684_0208268_227_700 | 147 |
| 370 | 3300047673 | Ga0495593_0022927 | Ga0495593_0022927_2487_2960 | 147 |
| 371 | 3300048088 | Ga0495602_0096402 | Ga0495602_0096402_1121_1594 | 147 |
| 372 | 3300048903 | Ga0496100_0543618 | Ga0496100_0543618_401_844 | 147 |
| 373 | 3300048904 | Ga0496101_0857342 | Ga0496101_0857342_91_534 | 147 |
| 374 | 3300048905 | Ga0496102_0444429 | Ga0496102_0444429_608_1051 | 147 |
| 375 | 3300048905 | Ga0496102_1579399 | Ga0496102_1579399_69_512 | 147 |
| 376 | 3300048907 | Ga0496104_1487660 | Ga0496104_1487660_66_539 | 147 |
| 377 | 3300048908 | Ga0496105_0651893 | Ga0496105_0651893_359_802 | 147 |
| 378 | 3300048909 | Ga0496106_0249673 | Ga0496106_0249673_79_522 | 147 |
| 379 | 3300048910 | Ga0496107_1270091 | Ga0496107_1270091_70_513 | 147 |
| 380 | 3300048911 | Ga0496108_0815701 | Ga0496108_0815701_24_467 | 147 |
| 381 | 3300048911 | Ga0496108_1295446 | Ga0496108_1295446_59_502 | 147 |
| 382 | 3300048912 | Ga0496109_0006223 | Ga0496109_0006223_224_667 | 147 |
| 383 | 3300048912 | Ga0496109_0076819 | Ga0496109_0076819_562_1005 | 147 |
| 384 | 3300048912 | Ga0496109_0977502 | Ga0496109_0977502_325_768 | 147 |
| 385 | 3300048913 | Ga0496110_0102021 | Ga0496110_0102021_352_795 | 147 |
| 386 | 3300048913 | Ga0496110_0224581 | Ga0496110_0224581_602_1045 | 147 |
| 387 | 3300048913 | Ga0496110_0842130 | Ga0496110_0842130_24_467 | 147 |
| 388 | 3300048913 | Ga0496110_1011503 | Ga0496110_1011503_60_503 | 147 |
| 389 | 3300048913 | Ga0496110_1073286 | Ga0496110_1073286_23_466 | 147 |
| 390 | 3300048914 | Ga0496111_0401551 | Ga0496111_0401551_355_798 | 147 |
| 391 | 3300048914 | Ga0496111_0506838 | Ga0496111_0506838_434_877 | 147 |
| 392 | 3300048914 | Ga0496111_1137974 | Ga0496111_1137974_55_498 | 147 |
| 393 | 3300048915 | Ga0496112_0327797 | Ga0496112_0327797_493_936 | 147 |
| 394 | 3300048915 | Ga0496112_0614954 | Ga0496112_0614954_69_512 | 147 |
| 395 | 3300048916 | Ga0496113_0065187 | Ga0496113_0065187_2025_2468 | 147 |
| 396 | 3300048917 | Ga0496114_0046928 | Ga0496114_0046928_2825_3268 | 147 |
| 397 | 3300048917 | Ga0496114_0124765 | Ga0496114_0124765_1341_1784 | 147 |
| 398 | 3300048917 | Ga0496114_0280343 | Ga0496114_0280343_396_839 | 147 |
| 399 | 3300048918 | Ga0496115_0004812 | Ga0496115_0004812_6115_6558 | 147 |
| 400 | 3300048918 | Ga0496115_0733495 | Ga0496115_0733495_113_556 | 147 |
| 401 | 3300048918 | Ga0496115_1204179 | Ga0496115_1204179_49_498 | 147 |
| 402 | 3300049127 | Ga0501306_058205 | Ga0501306_058205_176_619 | 147 |
| 403 | 3300049128 | Ga0501308_043850 | Ga0501308_043850_51_494 | 147 |
| 404 | 3300049128 | Ga0501308_054250 | Ga0501308_054250_84_527 | 147 |
| 405 | 3300049128 | Ga0501308_077514 | Ga0501308_077514_36_479 | 147 |
| 406 | 3300049129 | Ga0501309_072407 | Ga0501309_072407_109_552 | 147 |
| 407 | 3300049161 | Ga0501305_023625 | Ga0501305_023625_145_588 | 147 |
| 408 | 3300049162 | Ga0501307_001336 | Ga0501307_001336_1463_1906 | 147 |
| 409 | 3300049162 | Ga0501307_054604 | Ga0501307_054604_42_485 | 147 |
| 410 | 3300049527 | Ga0501311_019745 | Ga0501311_019745_420_863 | 147 |
| 411 | 3300049527 | Ga0501311_055699 | Ga0501311_055699_139_582 | 147 |
| 412 | 3300049527 | Ga0501311_063647 | Ga0501311_063647_114_557 | 147 |
| 413 | 3300049529 | Ga0501313_020247 | Ga0501313_020247_121_564 | 147 |
| 414 | 3300049529 | Ga0501313_025087 | Ga0501313_025087_283_726 | 147 |
| 415 | 3300049529 | Ga0501313_026295 | Ga0501313_026295_98_541 | 147 |
| 416 | 3300049531 | Ga0501315_055600 | Ga0501315_055600_114_563 | 147 |
| 417 | 3300049532 | Ga0501316_034830 | Ga0501316_034830_98_541 | 147 |
| 418 | 3300049533 | Ga0501317_012077 | Ga0501317_012077_140_583 | 147 |
| 419 | 3300049533 | Ga0501317_027795 | Ga0501317_027795_54_503 | 147 |
| 420 | 3300049534 | Ga0501318_008937 | Ga0501318_008937_148_591 | 147 |
| 421 | 3300049534 | Ga0501318_009493 | Ga0501318_009493_149_592 | 147 |
| 422 | 3300049534 | Ga0501318_080983 | Ga0501318_080983_30_479 | 147 |
| 423 | 3300049535 | Ga0501319_020683 | Ga0501319_020683_103_546 | 147 |
| 424 | 3300049536 | Ga0501320_014836 | Ga0501320_014836_147_590 | 147 |
| 425 | 3300049537 | Ga0501321_010891 | Ga0501321_010891_415_858 | 147 |
| 426 | 3300049537 | Ga0501321_014307 | Ga0501321_014307_144_587 | 147 |
| 427 | 3300049537 | Ga0501321_046387 | Ga0501321_046387_88_531 | 147 |
| 428 | 3300049538 | Ga0501322_017710 | Ga0501322_017710_151_594 | 147 |
| 429 | 3300049541 | Ga0501325_050940 | Ga0501325_050940_38_481 | 147 |
| 430 | 3300049576 | Ga0501040_0413671 | Ga0501040_0413671_457_906 | 147 |
| 431 | 3300049577 | Ga0501041_0405131 | Ga0501041_0405131_115_564 | 147 |
| 432 | 3300049583 | Ga0501067_0289343 | Ga0501067_0289343_155_598 | 147 |
| 433 | 3300049585 | Ga0501069_0059364 | Ga0501069_0059364_1668_2111 | 147 |
| 434 | 3300049585 | Ga0501069_0335599 | Ga0501069_0335599_420_863 | 147 |
| 435 | 3300049586 | Ga0501070_0010837 | Ga0501070_0010837_1986_2429 | 147 |
| 436 | 3300049589 | Ga0501073_0432901 | Ga0501073_0432901_32_475 | 147 |
| 437 | 3300049656 | Ga0501209_214775 | Ga0501209_214775_67_510 | 147 |
| 438 | 3300049822 | Ga0501035_0420128 | Ga0501035_0420128_214_657 | 147 |
| 439 | 3300049824 | Ga0501045_0923279 | Ga0501045_0923279_24_473 | 147 |
| 440 | 3300050490 | nmdc:mga03n38_589149_c1 | nmdc:mga03n38_589149_c1_71_532 | 147 |
| 441 | 3300050492 | nmdc:mga0yw44_267835_c1 | nmdc:mga0yw44_267835_c1_575_1018 | 147 |
| 442 | 3300050492 | nmdc:mga0yw44_9555_c1 | nmdc:mga0yw44_9555_c1_1193_1654 | 147 |
| 443 | 3300050507 | nmdc:mga05p37_67921_c1 | nmdc:mga05p37_67921_c1_1431_1874 | 147 |
| 444 | 3300050508 | nmdc:mga09592_435449_c1 | nmdc:mga09592_435449_c1_573_1016 | 147 |
| 445 | 3300050508 | nmdc:mga09592_46945_c1 | nmdc:mga09592_46945_c1_1472_1915 | 147 |
| 446 | 3300050509 | nmdc:mga0qj67_29258_c1 | nmdc:mga0qj67_29258_c1_3269_3712 | 147 |
| 447 | 3300050510 | nmdc:mga06r32_218905_c1 | nmdc:mga06r32_218905_c1_663_1106 | 147 |
| 448 | 3300050510 | nmdc:mga06r32_44584_c1 | nmdc:mga06r32_44584_c1_3049_3492 | 147 |
| 449 | 3300050511 | nmdc:mga08y16_853149_c1 | nmdc:mga08y16_853149_c1_404_847 | 147 |
| 450 | 3300050512 | nmdc:mga0n895_1419_c1 | nmdc:mga0n895_1419_c1_13398_13871 | 147 |
| 451 | 3300050512 | nmdc:mga0n895_525564_c1 | nmdc:mga0n895_525564_c1_540_1010 | 147 |
| 452 | 3300050512 | nmdc:mga0n895_974406_c1 | nmdc:mga0n895_974406_c1_115_558 | 147 |
| 453 | 3300050513 | nmdc:mga0rr50_140769_c1 | nmdc:mga0rr50_140769_c1_103_573 | 147 |
| 454 | 3300050513 | nmdc:mga0rr50_714675_c1 | nmdc:mga0rr50_714675_c1_338_811 | 147 |
| 455 | 3300050514 | nmdc:mga08x19_209758_c1 | nmdc:mga08x19_209758_c1_841_1314 | 147 |
| 456 | 3300050515 | nmdc:mga0a205_179782_c1 | nmdc:mga0a205_179782_c1_1342_1812 | 147 |
| 457 | 3300050515 | nmdc:mga0a205_48045_c1 | nmdc:mga0a205_48045_c1_2135_2608 | 147 |
| 458 | 3300053077 | Ga0495601_0034207 | Ga0495601_0034207_448_921 | 147 |
| 459 | 3300053077 | Ga0495601_0135030 | Ga0495601_0135030_464_937 | 147 |
| 460 | 3300053078 | Ga0495612_0026568 | Ga0495612_0026568_598_1071 | 147 |
| 461 | 3300053078 | Ga0495612_0045916 | Ga0495612_0045916_453_926 | 147 |
| 462 | 3300053083 | Ga0495655_0052690 | Ga0495655_0052690_135_578 | 147 |
| 463 | 3300053084 | Ga0495595_0065258 | Ga0495595_0065258_1166_1609 | 147 |
| 464 | 3300053085 | Ga0495619_0041284 | Ga0495619_0041284_1035_1478 | 147 |
| 465 | 3300053085 | Ga0495619_0084296 | Ga0495619_0084296_371_844 | 147 |
| 466 | 3300053085 | Ga0495619_0125319 | Ga0495619_0125319_859_1332 | 147 |
| 467 | 3300053129 | Ga0500628_042839 | Ga0500628_042839_225_668 | 147 |
| 468 | 3300059477 | Ga0587084_051027 | Ga0587084_051027_87_530 | 147 |
| 469 | 3300059477 | Ga0587084_069534 | Ga0587084_069534_109_552 | 147 |
| 470 | 3300059478 | Ga0587093_036556 | Ga0587093_036556_181_624 | 147 |
| 471 | 3300059478 | Ga0587093_057695 | Ga0587093_057695_58_501 | 147 |
| 472 | 3300059491 | Ga0587070_074348 | Ga0587070_074348_132_602 | 147 |
| 473 | 3300059491 | Ga0587070_091414 | Ga0587070_091414_95_538 | 147 |
| 474 | 3300059491 | Ga0587070_109411 | Ga0587070_109411_123_566 | 147 |
| 475 | 3300059491 | Ga0587070_138455 | Ga0587070_138455_95_538 | 147 |
| 476 | 3300059491 | Ga0587070_155549 | Ga0587070_155549_105_548 | 147 |
| 477 | 3300059492 | Ga0587073_0219509 | Ga0587073_0219509_18_461 | 147 |
| 478 | 3300059493 | Ga0587077_124303 | Ga0587077_124303_95_538 | 147 |
| 479 | 3300059493 | Ga0587077_126608 | Ga0587077_126608_126_569 | 147 |
| 480 | 3300059493 | Ga0587077_143113 | Ga0587077_143113_75_542 | 147 |
| 481 | 3300059493 | Ga0587077_154535 | Ga0587077_154535_92_535 | 147 |
| 482 | 3300059503 | Ga0587080_076739 | Ga0587080_076739_158_613 | 147 |
| 483 | 3300059503 | Ga0587080_098313 | Ga0587080_098313_80_523 | 147 |
| 484 | 3300059503 | Ga0587080_117477 | Ga0587080_117477_93_536 | 147 |
| 485 | 3300059505 | Ga0587083_0099434 | Ga0587083_0099434_155_598 | 147 |
| 486 | 3300059505 | Ga0587083_0104143 | Ga0587083_0104143_127_570 | 147 |
| 487 | 3300059505 | Ga0587083_0142526 | Ga0587083_0142526_116_559 | 147 |
| 488 | 3300059505 | Ga0587083_0156281 | Ga0587083_0156281_24_491 | 147 |
| 489 | 3300059505 | Ga0587083_0189247 | Ga0587083_0189247_104_547 | 147 |
| 490 | 3300059507 | Ga0587086_063251 | Ga0587086_063251_140_583 | 147 |
| 491 | 3300059508 | Ga0587088_027532 | Ga0587088_027532_453_896 | 147 |
| 492 | 3300059508 | Ga0587088_061047 | Ga0587088_061047_250_693 | 147 |
| 493 | 3300059508 | Ga0587088_090898 | Ga0587088_090898_104_547 | 147 |
| 494 | 3300059510 | Ga0587090_076169 | Ga0587090_076169_107_550 | 147 |
| 495 | 3300059510 | Ga0587090_082346 | Ga0587090_082346_54_497 | 147 |
| 496 | 3300059511 | Ga0587091_102777 | Ga0587091_102777_150_593 | 147 |
| 497 | 3300059512 | Ga0587092_112698 | Ga0587092_112698_39_482 | 147 |
| 498 | 3300059513 | Ga0587094_054115 | Ga0587094_054115_95_538 | 147 |
| 499 | 3300059513 | Ga0587094_066179 | Ga0587094_066179_123_566 | 147 |
| 500 | 3300059514 | Ga0587095_019857 | Ga0587095_019857_51_518 | 147 |
| 501 | 3300059604 | Ga0587098_034383 | Ga0587098_034383_227_670 | 147 |
| 502 | 3300059604 | Ga0587098_055902 | Ga0587098_055902_98_541 | 147 |
| 503 | 3300059605 | Ga0587106_071987 | Ga0587106_071987_67_510 | 147 |
| 504 | 3300059605 | Ga0587106_087125 | Ga0587106_087125_52_495 | 147 |
| 505 | 3300059605 | Ga0587106_102171 | Ga0587106_102171_31_474 | 147 |
| 506 | 3300059622 | Ga0587099_030169 | Ga0587099_030169_148_591 | 147 |
| 507 | 3300059625 | Ga0587113_022070 | Ga0587113_022070_83_550 | 147 |
| 508 | 3300059626 | Ga0587115_040752 | Ga0587115_040752_111_554 | 147 |
| 509 | 3300059626 | Ga0587115_080901 | Ga0587115_080901_96_539 | 147 |
| 510 | 3300059628 | Ga0587122_038111 | Ga0587122_038111_84_527 | 147 |
| 511 | 3300059628 | Ga0587122_056217 | Ga0587122_056217_33_476 | 147 |
| 512 | 3300059630 | Ga0587128_096340 | Ga0587128_096340_95_538 | 147 |
| 513 | 3300059639 | Ga0587062_058661 | Ga0587062_058661_112_555 | 147 |
| 514 | 3300059640 | Ga0587067_103463 | Ga0587067_103463_105_548 | 147 |
| 515 | 3300059641 | Ga0587068_076878 | Ga0587068_076878_108_551 | 147 |
| 516 | 3300059641 | Ga0587068_099003 | Ga0587068_099003_43_486 | 147 |
| 517 | 3300059642 | Ga0587069_076363 | Ga0587069_076363_56_499 | 147 |
| 518 | 3300059644 | Ga0587075_023131 | Ga0587075_023131_365_808 | 147 |
| 519 | 3300059644 | Ga0587075_099326 | Ga0587075_099326_108_551 | 147 |
| 520 | 3300059644 | Ga0587075_119553 | Ga0587075_119553_58_501 | 147 |
| 521 | 3300059645 | Ga0587076_126025 | Ga0587076_126025_128_571 | 147 |
| 522 | 3300059646 | Ga0587078_047306 | Ga0587078_047306_116_565 | 147 |
| 523 | 3300059647 | Ga0587079_056448 | Ga0587079_056448_133_576 | 147 |
| 524 | 3300059647 | Ga0587079_101398 | Ga0587079_101398_229_672 | 147 |
| 525 | 3300059647 | Ga0587079_126946 | Ga0587079_126946_72_515 | 147 |
| 526 | 3300059648 | Ga0587100_019393 | Ga0587100_019393_154_597 | 147 |
| 527 | 3300059649 | Ga0587102_032557 | Ga0587102_032557_48_491 | 147 |
| 528 | 3300059654 | Ga0587110_037474 | Ga0587110_037474_148_591 | 147 |
| 529 | 3300059655 | Ga0587114_010332 | Ga0587114_010332_125_592 | 147 |
| 530 | 3300059655 | Ga0587114_056058 | Ga0587114_056058_81_524 | 147 |
| 531 | 3300059655 | Ga0587114_056309 | Ga0587114_056309_165_608 | 147 |
| 532 | 3300060344 | Ga0587071_054436 | Ga0587071_054436_258_701 | 147 |
| 533 | 3300060344 | Ga0587071_126532 | Ga0587071_126532_50_493 | 147 |
| 534 | 3300060344 | Ga0587071_172803 | Ga0587071_172803_58_501 | 147 |
| 535 | 3300060346 | Ga0587111_0035503 | Ga0587111_0035503_502_945 | 147 |
| 536 | 3300060346 | Ga0587111_0122550 | Ga0587111_0122550_129_572 | 147 |
| 537 | 3300060346 | Ga0587111_0148043 | Ga0587111_0148043_113_556 | 147 |
| 538 | 3300060346 | Ga0587111_0196092 | Ga0587111_0196092_88_531 | 147 |
| 539 | 3300061719 | Ga0466962_0010205 | Ga0466962_0010205_2102_2545 | 147 |
| 540 | 3300061719 | Ga0466962_0066884 | Ga0466962_0066884_749_1192 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ppk-assembly1.cif.gz_J | rbga+45srbga complex | 0.9281 | 11 | 137 |
| 6spb-assembly1.cif.gz_J | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9263 | 2 | 137 |
| 6ysi-assembly1.cif.gz_F | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9193 | 1 | 138 |
| 7nhn-assembly1.cif.gz_M | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9183 | 1 | 142 |
| 8cvm-assembly1.cif.gz_i | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9145 | 3 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6SWN9_25_183_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9326 | 12 | 146 | 3.90.1180.10 |
| af_A0A0R0E7H3_25_163_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.929 | 12 | 147 | 3.90.1180.10 |
| af_Q4CZX3_36_177_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9151 | 13 | 143 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9102 | 1 | 142 | 3.90.1180.10 |
| af_O96222_56_212_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.9079 | 8 | 147 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P4ZYA6-F1-model_v4 | 39S ribosomal protein L13, mitochondrial-like | 0.9601 | 11 | 131 |
GO:0003729
GO:0003735 GO:0005762 GO:0006412 GO:0017148 |
| AF-A0A2H9TQC8-F1-model_v4 | Ribosomal protein L13 | 0.9537 | 11 | 134 |
GO:0003729
GO:0003735 GO:0005762 GO:0006412 GO:0017148 |
| AF-A0A2W1A4K2-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9519 | 12 | 135 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A7K1DJB2-F1-model_v4 | 50S ribosomal protein L13 | 0.9511 | 15 | 142 |
GO:0003729
GO:0003735 GO:0005737 GO:0005840 GO:0006412 GO:0017148 GO:1990904 |
| AF-A0A6L7X5Y4-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.9504 | 12 | 135 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar