F461123

General Info

Members Datasets Scaffolds Average Seq Length
539 276 1078 97

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_101150704|Ga0068871_1011507041
Length 119
Sequence LSCAGRRNIQGAPASNYGSYIDMAKAYWVNAFRTVRDQEALMAYAKLAGPAMQAAGGRFLARGMPAQVYEHGVDQRLVVIEFDSVEQAKAAYDSPAYQQALRVLGDAAERDLRIVPGVV

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0.56
Rhizoplane 4.27
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 17.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_101150704 3300006358 Unclassified 727
2 rootL2_10268457 3300003322 Unclassified 1425
3 rootL2_10273880 3300003322 Bacteria 1877
4 rootH1_10040432 3300003323 Bacteria 5836
5 JGI25407J50210_10006718 3300003373 Bacteria 2871
6 JGI25407J50210_10146554 3300003373 Unclassified 581
7 Ga0065712_10502428 3300005290 Bacteria 648
8 Ga0070676_11542431 3300005328 Bacteria 512
9 Ga0070677_10351908 3300005333 Bacteria 763
10 Ga0068869_101914872 3300005334 Unclassified 531
11 Ga0070689_100000781 3300005340 Bacteria 19535
12 Ga0070689_101925670 3300005340 Bacteria 540
13 Ga0070687_100455108 3300005343 Bacteria 852
14 Ga0070661_100218153 3300005344 Bacteria 1462
15 Ga0070661_100905235 3300005344 Bacteria 728
16 Ga0070671_101447377 3300005355 Bacteria 607
17 Ga0070671_101521651 3300005355 Bacteria 592
18 Ga0070674_101475099 3300005356 Unclassified 611
19 Ga0070673_100282859 3300005364 Unclassified 1455
20 Ga0070673_101209249 3300005364 Bacteria 708
21 Ga0070667_100341175 3300005367 Bacteria 1355
22 Ga0070709_10023824 3300005434 Bacteria 3600
23 Ga0070709_10179193 3300005434 Unclassified 1487
24 Ga0070709_10458675 3300005434 Bacteria 961
25 Ga0070709_10474824 3300005434 Bacteria 946
26 Ga0070714_100022831 3300005435 Bacteria 5134
27 Ga0070714_100058461 3300005435 Bacteria 3303
28 Ga0070714_100187146 3300005435 Bacteria 1887
29 Ga0070713_100006618 3300005436 Bacteria 8056
30 Ga0070713_100008140 3300005436 Bacteria 7420
31 Ga0070713_100008468 3300005436 Bacteria 7294
32 Ga0070713_100613696 3300005436 Bacteria 1034
33 Ga0070713_101584236 3300005436 Bacteria 636
34 Ga0070710_10054030 3300005437 Bacteria 2265
35 Ga0070710_10209581 3300005437 Bacteria 1235
36 Ga0070710_10680627 3300005437 Bacteria 724
37 Ga0070701_10070915 3300005438 Unclassified 1863
38 Ga0070711_100186411 3300005439 Bacteria 1591
39 Ga0070711_101301187 3300005439 Bacteria 631
40 Ga0070711_101665095 3300005439 Unclassified 559
41 Ga0070705_100025004 3300005440 Bacteria 3231
42 Ga0070705_100310465 3300005440 Bacteria 1134
43 Ga0070694_100039201 3300005444 Bacteria 3153
44 Ga0070663_101129447 3300005455 Bacteria 686
45 Ga0070663_101343288 3300005455 Bacteria 632
46 Ga0070662_101161167 3300005457 Bacteria 663
47 Ga0070685_10167319 3300005466 Unclassified 1406
48 Ga0070685_10214851 3300005466 Bacteria 1257
49 Ga0070706_100284987 3300005467 Bacteria 1542
50 Ga0070707_100264299 3300005468 Bacteria 1674
51 Ga0070684_100207944 3300005535 Bacteria 1783
52 Ga0070684_100842012 3300005535 Bacteria 858
53 Ga0070697_100685466 3300005536 Unclassified 904
54 Ga0068853_100738768 3300005539 Bacteria 940
55 Ga0070672_100003748 3300005543 Bacteria 9896
56 Ga0070686_100021117 3300005544 Unclassified 3864
57 Ga0070686_100323464 3300005544 Bacteria 1151
58 Ga0070695_100170527 3300005545 Bacteria 1535
59 Ga0070695_100273721 3300005545 Bacteria 1238
60 Ga0070665_100000561 3300005548 Bacteria 51782
61 Ga0070704_101890555 3300005549 Unclassified 553
62 Ga0068855_100865479 3300005563 Bacteria 957
63 Ga0068855_101975426 3300005563 Bacteria 590
64 Ga0070664_100017514 3300005564 Bacteria 5886
65 Ga0070664_100395805 3300005564 Bacteria 1263
66 Ga0068857_100278863 3300005577 Bacteria 1537
67 Ga0068857_100764673 3300005577 Bacteria 921
68 Ga0068854_100846521 3300005578 Unclassified 800
69 Ga0068856_100058381 3300005614 Bacteria 3810
70 Ga0068856_100267725 3300005614 Bacteria 1724
71 Ga0068856_101028012 3300005614 Unclassified 842
72 Ga0068856_102200019 3300005614 Bacteria 560
73 Ga0068856_102222457 3300005614 Bacteria 557
74 Ga0070702_100072930 3300005615 Bacteria 2032
75 Ga0070702_100178345 3300005615 Bacteria 1388
76 Ga0068852_100636227 3300005616 Bacteria 1073
77 Ga0068852_100708355 3300005616 Bacteria 1017
78 Ga0068859_100011333 3300005617 Bacteria 8970
79 Ga0068859_103044778 3300005617 Bacteria 512
80 Ga0068864_100052176 3300005618 Bacteria 3525
81 Ga0068861_100005833 3300005719 Bacteria 8361
82 Ga0068861_100971168 3300005719 Bacteria 809
83 Ga0068870_10564670 3300005840 Bacteria 768
84 Ga0068863_100260379 3300005841 Bacteria 1677
85 Ga0068858_100848969 3300005842 Unclassified 892
86 Ga0068860_100190767 3300005843 Unclassified 1983
87 Ga0068862_100244201 3300005844 Bacteria 1634
88 Ga0081455_10015318 3300005937 Bacteria 7456
89 Ga0081455_10523740 3300005937 Bacteria 790
90 Ga0081538_10000076 3300005981 Bacteria 94022
91 Ga0081538_10001638 3300005981 Bacteria 22962
92 Ga0081538_10028855 3300005981 Bacteria 3805
93 Ga0081538_10059513 3300005981 Bacteria 2205
94 Ga0081538_10064196 3300005981 Bacteria 2079
95 Ga0081538_10161948 3300005981 Bacteria 992
96 Ga0081539_10055059 3300005985 Bacteria 2216
97 Ga0070717_10022263 3300006028 Bacteria 5005
98 Ga0070717_10083539 3300006028 Unclassified 2686
99 Ga0070717_10684317 3300006028 Bacteria 932
100 Ga0070715_10036231 3300006163 Unclassified 2034
101 Ga0070715_10051119 3300006163 Bacteria 1777
102 Ga0070715_10703955 3300006163 Unclassified 604
103 Ga0070716_100232122 3300006173 Bacteria 1246
104 Ga0070716_101412968 3300006173 Unclassified 566
105 Ga0070712_100089833 3300006175 Bacteria 2248
106 Ga0070712_100127452 3300006175 Bacteria 1925
107 Ga0070712_100141299 3300006175 Bacteria 1838
108 Ga0070712_100160580 3300006175 Bacteria 1735
109 Ga0097621_100222615 3300006237 Bacteria 1645
110 Ga0097621_100764886 3300006237 Bacteria 893
111 Ga0097621_101225031 3300006237 Bacteria 707
112 Ga0068871_100003888 3300006358 Bacteria 10293
113 Ga0068871_100063717 3300006358 Bacteria 3016
114 Ga0068871_100075319 3300006358 Bacteria 2786
115 Ga0068871_100721385 3300006358 Bacteria 914
116 Ga0068871_100724163 3300006358 Bacteria 913
117 Ga0068871_102306682 3300006358 Unclassified 513
118 Ga0075428_100000250 3300006844 Bacteria 52704
119 Ga0075428_100013529 3300006844 Bacteria 9083
120 Ga0075428_101525529 3300006844 Unclassified 700
121 Ga0075430_100007194 3300006846 Bacteria 9388
122 Ga0075430_100035830 3300006846 Bacteria 4208
123 Ga0075431_100000573 3300006847 Bacteria 31102
124 Ga0075431_100002952 3300006847 Bacteria 16466
125 Ga0075431_100149819 3300006847 Bacteria 2403
126 Ga0075431_100371412 3300006847 Bacteria 1435
127 Ga0075431_101297637 3300006847 Unclassified 689
128 Ga0075433_10778824 3300006852 Bacteria 836
129 Ga0075434_100186295 3300006871 Bacteria 2096
130 Ga0075434_100265063 3300006871 Bacteria 1737
131 Ga0075434_100471752 3300006871 Bacteria 1276
132 Ga0075429_100010984 3300006880 Bacteria 7835
133 Ga0075429_100025129 3300006880 Bacteria 5170
134 Ga0068865_100608800 3300006881 Bacteria 924
135 Ga0068865_100852764 3300006881 Bacteria 789
136 Ga0075436_100240615 3300006914 Bacteria 1287
137 Ga0097620_100011333 3300006931 Bacteria 8970
138 Ga0097620_103044563 3300006931 Bacteria 512
139 Ga0079104_1013153 3300006946 Bacteria 2565
140 Ga0099826_10172436 3300006948 Bacteria 1213
141 Ga0075435_100340878 3300007076 Bacteria 1284
142 Ga0075435_100611401 3300007076 Unclassified 945
143 Ga0099795_10160794 3300007788 Bacteria 927
144 Ga0105240_10205868 3300009093 Bacteria 2303
145 Ga0105240_11003728 3300009093 Bacteria 892
146 Ga0105240_11968617 3300009093 Unclassified 607
147 Ga0111539_10000922 3300009094 Bacteria 38445
148 Ga0111539_10076304 3300009094 Bacteria 3946
149 Ga0105245_10074706 3300009098 Bacteria 3085
150 Ga0105245_10594723 3300009098 Bacteria 1132
151 Ga0114129_10000293 3300009147 Bacteria 57817
152 Ga0114129_10000529 3300009147 Bacteria 46728
153 Ga0114129_10323459 3300009147 Bacteria 2050
154 Ga0105243_10600482 3300009148 Bacteria 1059
155 Ga0105243_11281167 3300009148 Unclassified 749
156 Ga0105237_10361992 3300009545 Bacteria 1455
157 Ga0105238_12426950 3300009551 Unclassified 560
158 Ga0105249_11099698 3300009553 Bacteria 865
159 Ga0105249_11277204 3300009553 Unclassified 806
160 Ga0105249_12207270 3300009553 Bacteria 623
161 Ga0105239_10309181 3300010375 Bacteria 1781
162 Ga0105239_13365396 3300010375 Bacteria 520
163 Ga0157369_10728554 3300013105 Bacteria 1021
164 Ga0157378_12507299 3300013297 Unclassified 568
165 Ga0157375_10015634 3300013308 Bacteria 6799
166 Ga0157375_10023975 3300013308 Bacteria 5639
167 Ga0163163_10069708 3300014325 Bacteria 3501
168 Ga0163163_11019476 3300014325 Unclassified 891
169 Ga0163163_11080553 3300014325 Unclassified 865
170 Ga0163163_12942079 3300014325 Unclassified 531
171 Ga0157380_10932317 3300014326 Bacteria 897
172 Ga0157380_11748067 3300014326 Unclassified 680
173 Ga0157376_10282546 3300014969 Bacteria 1564
174 Ga0157376_11821557 3300014969 Unclassified 645
175 Ga0157376_12170689 3300014969 Bacteria 594
176 Ga0163161_10213801 3300017792 Bacteria 1490
177 Ga0163161_10399054 3300017792 Bacteria 1102
178 Ga0213872_10000017 3300021361 Bacteria 178787
179 Ga0213874_10012651 3300021377 Unclassified 2169
180 Ga0228598_1074762 3300024227 Bacteria 678
181 Ga0207692_10053747 3300025898 Bacteria 2053
182 Ga0207692_10166530 3300025898 Bacteria 1274
183 Ga0207692_10357186 3300025898 Bacteria 902
184 Ga0207685_10020676 3300025905 Bacteria 2192
185 Ga0207685_10084154 3300025905 Bacteria 1324
186 Ga0207685_10326221 3300025905 Unclassified 767
187 Ga0207699_10023359 3300025906 Unclassified 3364
188 Ga0207699_10027857 3300025906 Bacteria 3133
189 Ga0207699_10859261 3300025906 Unclassified 668
190 Ga0207684_10665060 3300025910 Bacteria 887
191 Ga0207695_10190015 3300025913 Bacteria 1971
192 Ga0207695_10449981 3300025913 Bacteria 1171
193 Ga0207695_11203841 3300025913 Unclassified 638
194 Ga0207671_10469165 3300025914 Bacteria 1003
195 Ga0207693_10156106 3300025915 Bacteria 1795
196 Ga0207693_10421046 3300025915 Bacteria 1044
197 Ga0207693_10827194 3300025915 Unclassified 713
198 Ga0207662_10325099 3300025918 Bacteria 1027
199 Ga0207649_10133988 3300025920 Bacteria 1687
200 Ga0207649_10657737 3300025920 Unclassified 810
201 Ga0207646_11257666 3300025922 Unclassified 647
202 Ga0207681_10631421 3300025923 Bacteria 887
203 Ga0207694_10002494 3300025924 Bacteria 14966
204 Ga0207659_10086419 3300025926 Bacteria 2332
205 Ga0207700_10094209 3300025928 Bacteria 2372
206 Ga0207700_10525028 3300025928 Unclassified 1049
207 Ga0207700_10690055 3300025928 Bacteria 911
208 Ga0207700_11643611 3300025928 Bacteria 568
209 Ga0207664_10033010 3300025929 Bacteria 3973
210 Ga0207664_10132402 3300025929 Unclassified 2100
211 Ga0207664_11804192 3300025929 Bacteria 534
212 Ga0207709_10902479 3300025935 Unclassified 718
213 Ga0207709_11603008 3300025935 Bacteria 541
214 Ga0207670_10001923 3300025936 Bacteria 10869
215 Ga0207670_10941220 3300025936 Bacteria 725
216 Ga0207669_10950932 3300025937 Bacteria 720
217 Ga0207704_10105307 3300025938 Bacteria 1892
218 Ga0207665_10003759 3300025939 Bacteria 10138
219 Ga0207665_10391299 3300025939 Bacteria 1057
220 Ga0207665_11189580 3300025939 Bacteria 608
221 Ga0207665_11219937 3300025939 Unclassified 600
222 Ga0207665_11368287 3300025939 Bacteria 564
223 Ga0207691_10118959 3300025940 Bacteria 2343
224 Ga0207691_11474163 3300025940 Unclassified 557
225 Ga0207689_11104968 3300025942 Bacteria 668
226 Ga0207689_11687062 3300025942 Unclassified 525
227 Ga0207679_10034124 3300025945 Bacteria 3587
228 Ga0207679_10355710 3300025945 Bacteria 1278
229 Ga0207667_11500038 3300025949 Bacteria 645
230 Ga0207651_10181543 3300025960 Unclassified 1670
231 Ga0207651_12010678 3300025960 Bacteria 519
232 Ga0207712_11836000 3300025961 Bacteria 543
233 Ga0207668_11954905 3300025972 Unclassified 529
234 Ga0207640_10445391 3300025981 Bacteria 1066
235 Ga0207703_10372469 3300026035 Unclassified 1319
236 Ga0207639_10404147 3300026041 Bacteria 1231
237 Ga0207678_11940388 3300026067 Bacteria 513
238 Ga0207702_10037266 3300026078 Bacteria 4069
239 Ga0207702_10237105 3300026078 Bacteria 1707
240 Ga0207702_10424238 3300026078 Bacteria 1287
241 Ga0207702_11586229 3300026078 Bacteria 648
242 Ga0207641_10264029 3300026088 Bacteria 1613
243 Ga0207676_10040468 3300026095 Bacteria 3572
244 Ga0207676_11954281 3300026095 Bacteria 585
245 Ga0207674_10098521 3300026116 Bacteria 2907
246 Ga0207675_100006094 3300026118 Bacteria 11473
247 Ga0207675_100855254 3300026118 Unclassified 925
248 Ga0207683_10288592 3300026121 Bacteria 1500
249 Ga0209281_1017654 3300027111 Bacteria 1443
250 Ga0209179_1040569 3300027512 Bacteria 979
251 Ga0207428_10084781 3300027907 Bacteria 2468
252 Ga0268266_10000110 3300028379 Bacteria 171840
253 Ga0268266_10100213 3300028379 Bacteria 2551
254 Ga0268266_10599982 3300028379 Bacteria 1058
255 Ga0265338_10061688 3300028800 Bacteria 3284
256 Ga0265338_11201289 3300028800 Unclassified 509
257 Ga0265325_10204358 3300031241 Bacteria 909
258 Ga0265339_10000289 3300031249 Bacteria 40750
259 Ga0265327_10033228 3300031251 Bacteria 2878
260 Ga0265327_10075454 3300031251 Unclassified 1677
261 Ga0307509_10038174 3300031507 Bacteria 5242
262 Ga0265313_10000091 3300031595 Bacteria 90050
263 Ga0265342_10362367 3300031712 Bacteria 753
264 Ga0307409_100092944 3300031995 Unclassified 2477
265 Ga0307414_10268352 3300032004 Bacteria 1428
266 Ga0373926_0054329 3300035083 Bacteria 1451
267 Ga0373929_0190042 3300035085 Bacteria 570
268 Ga0373934_0013435 3300035086 Bacteria 3097
269 Ga0373934_0394214 3300035086 Bacteria 578
270 Ga0373923_0001165 3300035111 Bacteria 7314
271 Ga0373923_0486834 3300035111 Bacteria 601
272 Ga0373936_0000103 3300035113 Bacteria 30865
273 Ga0373936_0369985 3300035113 Unclassified 655
274 Ga0373945_0002109 3300035116 Bacteria 6198
275 Ga0373945_0084186 3300035116 Bacteria 1223
276 Ga0373953_0001968 3300035117 Bacteria 6109
277 Ga0373953_0042639 3300035117 Bacteria 1809
278 Ga0373954_0000605 3300035118 Bacteria 13642
279 Ga0373954_0010384 3300035118 Bacteria 4109
280 Ga0373956_0047421 3300035119 Bacteria 1922
281 Ga0373956_0110433 3300035119 Bacteria 1280
282 Ga0373957_0011626 3300035120 Bacteria 2944
283 Ga0373957_0089686 3300035120 Unclassified 1221
284 Ga0373943_0000924 3300035170 Bacteria 12939
285 Ga0373946_0002388 3300035171 Bacteria 6639
286 Ga0373946_0122856 3300035171 Bacteria 1187
287 Ga0373955_0130352 3300035172 Bacteria 1467
288 Ga0373955_0192824 3300035172 Bacteria 1212
289 Ga0373955_0212641 3300035172 Bacteria 1153
290 Ga0373924_0009247 3300035410 Bacteria 3609
291 Ga0373924_0136840 3300035410 Bacteria 1067
292 Ga0373931_0560283 3300035691 Bacteria 743
293 Ga0373935_0000017 3300035692 Bacteria 70368
294 Ga0373935_0080832 3300035692 Bacteria 2112
295 Ga0373935_0359286 3300035692 Bacteria 1040
296 Ga0373935_0480560 3300035692 Bacteria 900
297 Ga0373927_0018458 3300035695 Bacteria 4585
298 Ga0373927_0070700 3300035695 Bacteria 2259
299 Ga0373927_0557606 3300035695 Bacteria 757
300 Ga0373927_0653903 3300035695 Unclassified 695
301 Ga0373933_0019964 3300035724 Bacteria 3793
302 Ga0373933_0108795 3300035724 Bacteria 1727
303 Ga0373933_0248006 3300035724 Bacteria 1146
304 Ga0373947_0000916 3300035725 Bacteria 17899
305 Ga0373947_0320601 3300035725 Bacteria 1036
306 Ga0373947_0393436 3300035725 Bacteria 934
307 Ga0373937_0000103 3300036401 Bacteria 80386
308 Ga0373937_0011730 3300036401 Bacteria 7686
309 Ga0373937_0224224 3300036401 Bacteria 1769
310 Ga0373937_0687793 3300036401 Bacteria 969
311 Ga0373925_0000058 3300037068 Bacteria 122682
312 Ga0373925_0013964 3300037068 Bacteria 5813
313 Ga0373925_0156512 3300037068 Bacteria 1793
314 Ga0395899_0141580 3300037312 Bacteria 1711
315 Ga0395899_0747952 3300037312 Bacteria 609
316 Ga0436361_0662860 3300039447 Bacteria 23952
317 Ga0436363_0187274 3300039450 Bacteria 587
318 Ga0436363_0568191 3300039450 Unclassified 757
319 Ga0451849_0673060 3300041505 Bacteria 588
320 Ga0439448_0365409 3300042005 Bacteria 515
321 Ga0439460_0029504 3300042461 Bacteria 1553
322 Ga0453683_0003717 3300044673 Bacteria 11149
323 Ga0453684_0283806 3300044712 Bacteria 1887
324 Ga0451576_0079301 3300045051 Bacteria 3416
325 Ga0451576_0401404 3300045051 Bacteria 1437
326 Ga0451576_2000123 3300045051 Bacteria 597
327 Ga0495592_0000343 3300046454 Bacteria 38047
328 Ga0495592_0240223 3300046454 Bacteria 1202
329 Ga0495592_0402580 3300046454 Unclassified 866
330 Ga0495603_0167220 3300046455 Bacteria 1274
331 Ga0495590_0202768 3300046457 Unclassified 729
332 Ga0495629_0002223 3300046459 Bacteria 14968
333 Ga0495629_0076888 3300046459 Unclassified 2330
334 Ga0495629_0914763 3300046459 Unclassified 574
335 Ga0495651_0002876 3300046462 Bacteria 13334
336 Ga0495651_0070464 3300046462 Bacteria 2660
337 Ga0495651_0124900 3300046462 Unclassified 1885
338 Ga0495653_0000072 3300046463 Bacteria 85266
339 Ga0495653_0132307 3300046463 Bacteria 1764
340 Ga0495653_0325029 3300046463 Unclassified 996
341 Ga0495653_0437643 3300046463 Bacteria 825
342 Ga0495582_0048289 3300046473 Bacteria 2344
343 Ga0495582_0196014 3300046473 Bacteria 1153
344 Ga0495605_0469179 3300046474 Unclassified 517
345 Ga0495662_0008685 3300046476 Bacteria 4993
346 Ga0495662_0240158 3300046476 Bacteria 893
347 Ga0495664_0000009 3300046477 Bacteria 289534
348 Ga0495664_0569633 3300046477 Bacteria 674
349 Ga0495664_0795848 3300046477 Unclassified 556
350 Ga0495608_0000608 3300046511 Bacteria 24628
351 Ga0495608_0206433 3300046511 Unclassified 1236
352 Ga0495618_0000061 3300046514 Bacteria 78337
353 Ga0495618_0575608 3300046514 Bacteria 672
354 Ga0495618_0825606 3300046514 Bacteria 538
355 Ga0495628_0000012 3300046516 Bacteria 224162
356 Ga0495628_0217881 3300046516 Bacteria 1434
357 Ga0495628_0242778 3300046516 Bacteria 1347
358 Ga0495628_0447454 3300046516 Unclassified 938
359 Ga0495630_0000945 3300046517 Bacteria 20329
360 Ga0495630_0704628 3300046517 Bacteria 772
361 Ga0495630_0789738 3300046517 Unclassified 725
362 Ga0495632_0021923 3300046519 Bacteria 3433
363 Ga0495652_0000021 3300046529 Bacteria 181454
364 Ga0495652_0472183 3300046529 Unclassified 874
365 Ga0495652_0688085 3300046529 Bacteria 689
366 Ga0495640_0000028 3300046533 Bacteria 79904
367 Ga0495640_0130585 3300046533 Bacteria 1626
368 Ga0495640_0206527 3300046533 Unclassified 1243
369 Ga0495640_0323488 3300046533 Bacteria 955
370 Ga0495640_0625116 3300046533 Bacteria 649
371 Ga0495587_0000033 3300046536 Bacteria 123885
372 Ga0495645_0000017 3300046543 Bacteria 156865
373 Ga0495645_0233489 3300046543 Bacteria 1231
374 Ga0495645_0751157 3300046543 Unclassified 588
375 Ga0495667_0000515 3300046559 Bacteria 24734
376 Ga0495667_0035332 3300046559 Bacteria 3340
377 Ga0495634_0001144 3300046642 Bacteria 24509
378 Ga0495634_0189645 3300046642 Bacteria 1283
379 Ga0495634_0294552 3300046642 Bacteria 982
380 Ga0495634_0675286 3300046642 Bacteria 595
381 Ga0495625_0027140 3300046660 Bacteria 4317
382 Ga0495635_0000019 3300046663 Bacteria 193402
383 Ga0495635_0154481 3300046663 Bacteria 1562
384 Ga0495635_0657207 3300046663 Bacteria 682
385 Ga0495635_1009609 3300046663 Bacteria 529
386 Ga0495657_0000982 3300046675 Bacteria 25117
387 Ga0495599_0000024 3300046678 Bacteria 121388
388 Ga0495599_0062364 3300046678 Bacteria 2329
389 Ga0495599_0112587 3300046678 Bacteria 1694
390 Ga0495599_0224204 3300046678 Bacteria 1149
391 Ga0495623_0000022 3300046679 Bacteria 98899
392 Ga0495623_0162876 3300046679 Unclassified 1309
393 Ga0495646_0000033 3300046680 Bacteria 83930
394 Ga0495646_0155970 3300046680 Bacteria 1267
395 Ga0495646_0691634 3300046680 Bacteria 513
396 Ga0495647_0157486 3300046681 Bacteria 977
397 Ga0495658_0193852 3300046683 Bacteria 1264
398 Ga0495658_0499689 3300046683 Unclassified 778
399 Ga0495613_0059138 3300046689 Bacteria 2810
400 Ga0495624_0058371 3300046690 Bacteria 2424
401 Ga0495649_0133550 3300046694 Bacteria 1309
402 Ga0495600_0000028 3300046809 Bacteria 90661
403 Ga0495600_0042667 3300046809 Bacteria 2957
404 Ga0495581_0013694 3300047315 Bacteria 4702
405 Ga0495604_0000011 3300047317 Bacteria 292024
406 Ga0495604_0076613 3300047317 Unclassified 2515
407 Ga0495674_0000015 3300047319 Bacteria 224071
408 Ga0495674_0258151 3300047319 Unclassified 1432
409 Ga0495674_0479545 3300047319 Bacteria 997
410 Ga0495676_0426967 3300047321 Bacteria 877
411 Ga0495680_0001545 3300047322 Bacteria 24639
412 Ga0495680_0083365 3300047322 Bacteria 2411
413 Ga0495680_0529382 3300047322 Unclassified 796
414 Ga0495675_0001637 3300047444 Bacteria 13445
415 Ga0495675_0549021 3300047444 Bacteria 659
416 Ga0495684_0000036 3300047471 Bacteria 107181
417 Ga0495684_0145934 3300047471 Bacteria 1772
418 Ga0495684_0234176 3300047471 Unclassified 1342
419 Ga0495593_0001316 3300047673 Bacteria 14553
420 Ga0495602_0000018 3300048088 Bacteria 183837
421 Ga0495602_0166142 3300048088 Bacteria 1717
422 Ga0495602_0859207 3300048088 Bacteria 606
423 Ga0496101_0278902 3300048904 Bacteria 1306
424 Ga0496101_0789058 3300048904 Bacteria 749
425 Ga0496102_0191891 3300048905 Bacteria 1925
426 Ga0496104_0075481 3300048907 Bacteria 3210
427 Ga0496104_0100226 3300048907 Bacteria 2773
428 Ga0496104_0274820 3300048907 Bacteria 1597
429 Ga0496105_0265853 3300048908 Bacteria 1386
430 Ga0496105_0615979 3300048908 Bacteria 841
431 Ga0496106_0266996 3300048909 Bacteria 1370
432 Ga0496107_0379920 3300048910 Unclassified 1051
433 Ga0496108_0779852 3300048911 Bacteria 825
434 Ga0496109_0284103 3300048912 Bacteria 1560
435 Ga0496109_0461213 3300048912 Unclassified 1200
436 Ga0496110_1436884 3300048913 Bacteria 599
437 Ga0496112_0373459 3300048915 Bacteria 1367
438 Ga0496112_0609903 3300048915 Unclassified 1023
439 Ga0496112_0709905 3300048915 Bacteria 933
440 Ga0496112_0886336 3300048915 Bacteria 815
441 Ga0496113_0085262 3300048916 Bacteria 2426
442 Ga0496113_0789392 3300048916 Bacteria 755
443 Ga0496114_0002415 3300048917 Bacteria 14245
444 Ga0496114_0311894 3300048917 Unclassified 1389
445 Ga0496115_0846708 3300048918 Unclassified 709
446 Ga0496126_0144107 3300048929 Bacteria 2048
447 Ga0501031_0028189 3300049568 Bacteria 3661
448 Ga0501033_0005435 3300049570 Bacteria 10096
449 Ga0501033_0912449 3300049570 Unclassified 590
450 Ga0501034_0028599 3300049571 Bacteria 5673
451 Ga0501036_0006501 3300049572 Bacteria 9496
452 Ga0501036_1240860 3300049572 Bacteria 607
453 Ga0501037_0006570 3300049573 Bacteria 8511
454 Ga0501037_1050289 3300049573 Bacteria 529
455 Ga0501038_0015042 3300049574 Bacteria 7048
456 Ga0501038_0329009 3300049574 Bacteria 1194
457 Ga0501039_0002541 3300049575 Bacteria 13622
458 Ga0501039_0085563 3300049575 Bacteria 2456
459 Ga0501040_0000148 3300049576 Bacteria 38445
460 Ga0501040_0189118 3300049576 Bacteria 1461
461 Ga0501040_0589684 3300049576 Bacteria 803
462 Ga0501040_1124112 3300049576 Bacteria 570
463 Ga0501041_0000617 3300049577 Bacteria 18603
464 Ga0501041_0236804 3300049577 Unclassified 1147
465 Ga0501042_0002676 3300049578 Bacteria 10962
466 Ga0501042_0286103 3300049578 Bacteria 1191
467 Ga0501043_0082702 3300049579 Bacteria 2524
468 Ga0501046_0002068 3300049580 Bacteria 19039
469 Ga0501047_0042185 3300049581 Bacteria 4410
470 Ga0501048_0359858 3300049582 Bacteria 1038
471 Ga0501048_0502278 3300049582 Bacteria 869
472 Ga0501048_0697637 3300049582 Bacteria 729
473 Ga0501068_0009698 3300049584 Bacteria 5392
474 Ga0501068_0636526 3300049584 Bacteria 696
475 Ga0501069_0497773 3300049585 Bacteria 727
476 Ga0501070_0156327 3300049586 Bacteria 1880
477 Ga0501071_0001007 3300049587 Bacteria 15490
478 Ga0501071_0124425 3300049587 Bacteria 1913
479 Ga0501071_1039299 3300049587 Bacteria 633
480 Ga0501072_0002453 3300049588 Bacteria 13885
481 Ga0501073_0042798 3300049589 Bacteria 3196
482 Ga0501074_0009287 3300049590 Bacteria 7141
483 Ga0501075_0001919 3300049591 Bacteria 13720
484 Ga0501075_0119897 3300049591 Bacteria 2002
485 Ga0501075_0493871 3300049591 Bacteria 934
486 Ga0501075_1266710 3300049591 Unclassified 559
487 Ga0501076_0002307 3300049592 Bacteria 13063
488 Ga0501076_0392557 3300049592 Bacteria 1141
489 Ga0501077_0000395 3300049593 Bacteria 26312
490 Ga0501077_0190508 3300049593 Bacteria 1303
491 Ga0501079_0002314 3300049741 Bacteria 13800
492 Ga0501079_0180315 3300049741 Bacteria 1648
493 Ga0501079_0499002 3300049741 Bacteria 957
494 Ga0501079_0594388 3300049741 Bacteria 871
495 Ga0501080_0015699 3300049742 Bacteria 6982
496 Ga0501081_0008133 3300049743 Bacteria 6808
497 Ga0501081_0297801 3300049743 Bacteria 1183
498 Ga0501081_0326938 3300049743 Unclassified 1128
499 Ga0501081_1518287 3300049743 Bacteria 509
500 Ga0501083_0266609 3300049744 Unclassified 1114
501 Ga0501035_0046475 3300049822 Bacteria 3905
502 Ga0501044_0000057 3300049823 Bacteria 136472
503 Ga0501044_0099176 3300049823 Bacteria 2932
504 Ga0501044_0747014 3300049823 Bacteria 861
505 Ga0501045_0000679 3300049824 Bacteria 21580
506 nmdc:mga05p37_227_c1 3300050507 Bacteria 57142
507 nmdc:mga09592_10474_c1 3300050508 Bacteria 7545
508 nmdc:mga0qj67_71058_c1 3300050509 Bacteria 2778
509 nmdc:mga06r32_1038132_c1 3300050510 Unclassified 771
510 nmdc:mga06r32_67177_c1 3300050510 Bacteria 3461
511 nmdc:mga06r32_724864_c1 3300050510 Bacteria 959
512 nmdc:mga08y16_172285_c1 3300050511 Bacteria 2248
513 nmdc:mga0n895_366340_c1 3300050512 Bacteria 1459
514 nmdc:mga0n895_440373_c1 3300050512 Bacteria 1316
515 nmdc:mga0n895_46143_c1 3300050512 Bacteria 4255
516 nmdc:mga0rr50_270510_c1 3300050513 Bacteria 1416
517 nmdc:mga0rr50_430478_c1 3300050513 Unclassified 1117
518 nmdc:mga08x19_273351_c1 3300050514 Bacteria 1170
519 nmdc:mga0a205_1015580_c1 3300050515 Unclassified 676
520 nmdc:mga0a205_482115_c1 3300050515 Bacteria 1098
521 Ga0495601_0000024 3300053077 Bacteria 133160
522 Ga0495601_0305079 3300053077 Bacteria 1037
523 Ga0495601_0745308 3300053077 Bacteria 623
524 Ga0495612_0000606 3300053078 Bacteria 14418
525 Ga0495612_0082317 3300053078 Bacteria 1353
526 Ga0495595_0000036 3300053084 Bacteria 79035
527 Ga0495619_0000034 3300053085 Bacteria 129851
528 Ga0495619_0072694 3300053085 Bacteria 2303
529 Ga0495619_1010320 3300053085 Bacteria 556
530 Ga0500595_003036 3300053119 Bacteria 7976
531 Ga0500559_0485770 3300053136 Unclassified 568
532 Ga0501084_0361027 3300054114 Bacteria 1227
533 Ga0501084_0381489 3300054114 Unclassified 1191
534 Ga0501082_0000632 3300060353 Bacteria 31032
535 Ga0530510_0000484 3300061734 Bacteria 25560
536 Ga0530510_0101556 3300061734 Bacteria 2103
537 Ga0530510_0114810 3300061734 Bacteria 1974
538 Ga0530510_0217009 3300061734 Bacteria 1421
539 Ga0530510_0757622 3300061734 Bacteria 740
540 Ga0068871_101150704
541 rootL2_10268457
542 rootL2_10273880
543 rootH1_10040432
544 JGI25407J50210_10006718
545 JGI25407J50210_10146554
546 Ga0065712_10502428
547 Ga0070676_11542431
548 Ga0070677_10351908
549 Ga0068869_101914872
550 Ga0070689_100000781
551 Ga0070689_101925670
552 Ga0070687_100455108
553 Ga0070661_100218153
554 Ga0070661_100905235
555 Ga0070671_101447377
556 Ga0070671_101521651
557 Ga0070674_101475099
558 Ga0070673_100282859
559 Ga0070673_101209249
560 Ga0070667_100341175
561 Ga0070709_10023824
562 Ga0070709_10179193
563 Ga0070709_10458675
564 Ga0070709_10474824
565 Ga0070714_100022831
566 Ga0070714_100058461
567 Ga0070714_100187146
568 Ga0070713_100006618
569 Ga0070713_100008140
570 Ga0070713_100008468
571 Ga0070713_100613696
572 Ga0070713_101584236
573 Ga0070710_10054030
574 Ga0070710_10209581
575 Ga0070710_10680627
576 Ga0070701_10070915
577 Ga0070711_100186411
578 Ga0070711_101301187
579 Ga0070711_101665095
580 Ga0070705_100025004
581 Ga0070705_100310465
582 Ga0070694_100039201
583 Ga0070663_101129447
584 Ga0070663_101343288
585 Ga0070662_101161167
586 Ga0070685_10167319
587 Ga0070685_10214851
588 Ga0070706_100284987
589 Ga0070707_100264299
590 Ga0070684_100207944
591 Ga0070684_100842012
592 Ga0070697_100685466
593 Ga0068853_100738768
594 Ga0070672_100003748
595 Ga0070686_100021117
596 Ga0070686_100323464
597 Ga0070695_100170527
598 Ga0070695_100273721
599 Ga0070665_100000561
600 Ga0070704_101890555
601 Ga0068855_100865479
602 Ga0068855_101975426
603 Ga0070664_100017514
604 Ga0070664_100395805
605 Ga0068857_100278863
606 Ga0068857_100764673
607 Ga0068854_100846521
608 Ga0068856_100058381
609 Ga0068856_100267725
610 Ga0068856_101028012
611 Ga0068856_102200019
612 Ga0068856_102222457
613 Ga0070702_100072930
614 Ga0070702_100178345
615 Ga0068852_100636227
616 Ga0068852_100708355
617 Ga0068859_100011333
618 Ga0068859_103044778
619 Ga0068864_100052176
620 Ga0068861_100005833
621 Ga0068861_100971168
622 Ga0068870_10564670
623 Ga0068863_100260379
624 Ga0068858_100848969
625 Ga0068860_100190767
626 Ga0068862_100244201
627 Ga0081455_10015318
628 Ga0081455_10523740
629 Ga0081538_10000076
630 Ga0081538_10001638
631 Ga0081538_10028855
632 Ga0081538_10059513
633 Ga0081538_10064196
634 Ga0081538_10161948
635 Ga0081539_10055059
636 Ga0070717_10022263
637 Ga0070717_10083539
638 Ga0070717_10684317
639 Ga0070715_10036231
640 Ga0070715_10051119
641 Ga0070715_10703955
642 Ga0070716_100232122
643 Ga0070716_101412968
644 Ga0070712_100089833
645 Ga0070712_100127452
646 Ga0070712_100141299
647 Ga0070712_100160580
648 Ga0097621_100222615
649 Ga0097621_100764886
650 Ga0097621_101225031
651 Ga0068871_100003888
652 Ga0068871_100063717
653 Ga0068871_100075319
654 Ga0068871_100721385
655 Ga0068871_100724163
656 Ga0068871_102306682
657 Ga0075428_100000250
658 Ga0075428_100013529
659 Ga0075428_101525529
660 Ga0075430_100007194
661 Ga0075430_100035830
662 Ga0075431_100000573
663 Ga0075431_100002952
664 Ga0075431_100149819
665 Ga0075431_100371412
666 Ga0075431_101297637
667 Ga0075433_10778824
668 Ga0075434_100186295
669 Ga0075434_100265063
670 Ga0075434_100471752
671 Ga0075429_100010984
672 Ga0075429_100025129
673 Ga0068865_100608800
674 Ga0068865_100852764
675 Ga0075436_100240615
676 Ga0097620_100011333
677 Ga0097620_103044563
678 Ga0079104_1013153
679 Ga0099826_10172436
680 Ga0075435_100340878
681 Ga0075435_100611401
682 Ga0099795_10160794
683 Ga0105240_10205868
684 Ga0105240_11003728
685 Ga0105240_11968617
686 Ga0111539_10000922
687 Ga0111539_10076304
688 Ga0105245_10074706
689 Ga0105245_10594723
690 Ga0114129_10000293
691 Ga0114129_10000529
692 Ga0114129_10323459
693 Ga0105243_10600482
694 Ga0105243_11281167
695 Ga0105237_10361992
696 Ga0105238_12426950
697 Ga0105249_11099698
698 Ga0105249_11277204
699 Ga0105249_12207270
700 Ga0105239_10309181
701 Ga0105239_13365396
702 Ga0157369_10728554
703 Ga0157378_12507299
704 Ga0157375_10015634
705 Ga0157375_10023975
706 Ga0163163_10069708
707 Ga0163163_11019476
708 Ga0163163_11080553
709 Ga0163163_12942079
710 Ga0157380_10932317
711 Ga0157380_11748067
712 Ga0157376_10282546
713 Ga0157376_11821557
714 Ga0157376_12170689
715 Ga0163161_10213801
716 Ga0163161_10399054
717 Ga0213872_10000017
718 Ga0213874_10012651
719 Ga0228598_1074762
720 Ga0207692_10053747
721 Ga0207692_10166530
722 Ga0207692_10357186
723 Ga0207685_10020676
724 Ga0207685_10084154
725 Ga0207685_10326221
726 Ga0207699_10023359
727 Ga0207699_10027857
728 Ga0207699_10859261
729 Ga0207684_10665060
730 Ga0207695_10190015
731 Ga0207695_10449981
732 Ga0207695_11203841
733 Ga0207671_10469165
734 Ga0207693_10156106
735 Ga0207693_10421046
736 Ga0207693_10827194
737 Ga0207662_10325099
738 Ga0207649_10133988
739 Ga0207649_10657737
740 Ga0207646_11257666
741 Ga0207681_10631421
742 Ga0207694_10002494
743 Ga0207659_10086419
744 Ga0207700_10094209
745 Ga0207700_10525028
746 Ga0207700_10690055
747 Ga0207700_11643611
748 Ga0207664_10033010
749 Ga0207664_10132402
750 Ga0207664_11804192
751 Ga0207709_10902479
752 Ga0207709_11603008
753 Ga0207670_10001923
754 Ga0207670_10941220
755 Ga0207669_10950932
756 Ga0207704_10105307
757 Ga0207665_10003759
758 Ga0207665_10391299
759 Ga0207665_11189580
760 Ga0207665_11219937
761 Ga0207665_11368287
762 Ga0207691_10118959
763 Ga0207691_11474163
764 Ga0207689_11104968
765 Ga0207689_11687062
766 Ga0207679_10034124
767 Ga0207679_10355710
768 Ga0207667_11500038
769 Ga0207651_10181543
770 Ga0207651_12010678
771 Ga0207712_11836000
772 Ga0207668_11954905
773 Ga0207640_10445391
774 Ga0207703_10372469
775 Ga0207639_10404147
776 Ga0207678_11940388
777 Ga0207702_10037266
778 Ga0207702_10237105
779 Ga0207702_10424238
780 Ga0207702_11586229
781 Ga0207641_10264029
782 Ga0207676_10040468
783 Ga0207676_11954281
784 Ga0207674_10098521
785 Ga0207675_100006094
786 Ga0207675_100855254
787 Ga0207683_10288592
788 Ga0209281_1017654
789 Ga0209179_1040569
790 Ga0207428_10084781
791 Ga0268266_10000110
792 Ga0268266_10100213
793 Ga0268266_10599982
794 Ga0265338_10061688
795 Ga0265338_11201289
796 Ga0265325_10204358
797 Ga0265339_10000289
798 Ga0265327_10033228
799 Ga0265327_10075454
800 Ga0307509_10038174
801 Ga0265313_10000091
802 Ga0265342_10362367
803 Ga0307409_100092944
804 Ga0307414_10268352
805 Ga0373926_0054329
806 Ga0373929_0190042
807 Ga0373934_0013435
808 Ga0373934_0394214
809 Ga0373923_0001165
810 Ga0373923_0486834
811 Ga0373936_0000103
812 Ga0373936_0369985
813 Ga0373945_0002109
814 Ga0373945_0084186
815 Ga0373953_0001968
816 Ga0373953_0042639
817 Ga0373954_0000605
818 Ga0373954_0010384
819 Ga0373956_0047421
820 Ga0373956_0110433
821 Ga0373957_0011626
822 Ga0373957_0089686
823 Ga0373943_0000924
824 Ga0373946_0002388
825 Ga0373946_0122856
826 Ga0373955_0130352
827 Ga0373955_0192824
828 Ga0373955_0212641
829 Ga0373924_0009247
830 Ga0373924_0136840
831 Ga0373931_0560283
832 Ga0373935_0000017
833 Ga0373935_0080832
834 Ga0373935_0359286
835 Ga0373935_0480560
836 Ga0373927_0018458
837 Ga0373927_0070700
838 Ga0373927_0557606
839 Ga0373927_0653903
840 Ga0373933_0019964
841 Ga0373933_0108795
842 Ga0373933_0248006
843 Ga0373947_0000916
844 Ga0373947_0320601
845 Ga0373947_0393436
846 Ga0373937_0000103
847 Ga0373937_0011730
848 Ga0373937_0224224
849 Ga0373937_0687793
850 Ga0373925_0000058
851 Ga0373925_0013964
852 Ga0373925_0156512
853 Ga0395899_0141580
854 Ga0395899_0747952
855 Ga0436361_0662860
856 Ga0436363_0187274
857 Ga0436363_0568191
858 Ga0451849_0673060
859 Ga0439448_0365409
860 Ga0439460_0029504
861 Ga0453683_0003717
862 Ga0453684_0283806
863 Ga0451576_0079301
864 Ga0451576_0401404
865 Ga0451576_2000123
866 Ga0495592_0000343
867 Ga0495592_0240223
868 Ga0495592_0402580
869 Ga0495603_0167220
870 Ga0495590_0202768
871 Ga0495629_0002223
872 Ga0495629_0076888
873 Ga0495629_0914763
874 Ga0495651_0002876
875 Ga0495651_0070464
876 Ga0495651_0124900
877 Ga0495653_0000072
878 Ga0495653_0132307
879 Ga0495653_0325029
880 Ga0495653_0437643
881 Ga0495582_0048289
882 Ga0495582_0196014
883 Ga0495605_0469179
884 Ga0495662_0008685
885 Ga0495662_0240158
886 Ga0495664_0000009
887 Ga0495664_0569633
888 Ga0495664_0795848
889 Ga0495608_0000608
890 Ga0495608_0206433
891 Ga0495618_0000061
892 Ga0495618_0575608
893 Ga0495618_0825606
894 Ga0495628_0000012
895 Ga0495628_0217881
896 Ga0495628_0242778
897 Ga0495628_0447454
898 Ga0495630_0000945
899 Ga0495630_0704628
900 Ga0495630_0789738
901 Ga0495632_0021923
902 Ga0495652_0000021
903 Ga0495652_0472183
904 Ga0495652_0688085
905 Ga0495640_0000028
906 Ga0495640_0130585
907 Ga0495640_0206527
908 Ga0495640_0323488
909 Ga0495640_0625116
910 Ga0495587_0000033
911 Ga0495645_0000017
912 Ga0495645_0233489
913 Ga0495645_0751157
914 Ga0495667_0000515
915 Ga0495667_0035332
916 Ga0495634_0001144
917 Ga0495634_0189645
918 Ga0495634_0294552
919 Ga0495634_0675286
920 Ga0495625_0027140
921 Ga0495635_0000019
922 Ga0495635_0154481
923 Ga0495635_0657207
924 Ga0495635_1009609
925 Ga0495657_0000982
926 Ga0495599_0000024
927 Ga0495599_0062364
928 Ga0495599_0112587
929 Ga0495599_0224204
930 Ga0495623_0000022
931 Ga0495623_0162876
932 Ga0495646_0000033
933 Ga0495646_0155970
934 Ga0495646_0691634
935 Ga0495647_0157486
936 Ga0495658_0193852
937 Ga0495658_0499689
938 Ga0495613_0059138
939 Ga0495624_0058371
940 Ga0495649_0133550
941 Ga0495600_0000028
942 Ga0495600_0042667
943 Ga0495581_0013694
944 Ga0495604_0000011
945 Ga0495604_0076613
946 Ga0495674_0000015
947 Ga0495674_0258151
948 Ga0495674_0479545
949 Ga0495676_0426967
950 Ga0495680_0001545
951 Ga0495680_0083365
952 Ga0495680_0529382
953 Ga0495675_0001637
954 Ga0495675_0549021
955 Ga0495684_0000036
956 Ga0495684_0145934
957 Ga0495684_0234176
958 Ga0495593_0001316
959 Ga0495602_0000018
960 Ga0495602_0166142
961 Ga0495602_0859207
962 Ga0496101_0278902
963 Ga0496101_0789058
964 Ga0496102_0191891
965 Ga0496104_0075481
966 Ga0496104_0100226
967 Ga0496104_0274820
968 Ga0496105_0265853
969 Ga0496105_0615979
970 Ga0496106_0266996
971 Ga0496107_0379920
972 Ga0496108_0779852
973 Ga0496109_0284103
974 Ga0496109_0461213
975 Ga0496110_1436884
976 Ga0496112_0373459
977 Ga0496112_0609903
978 Ga0496112_0709905
979 Ga0496112_0886336
980 Ga0496113_0085262
981 Ga0496113_0789392
982 Ga0496114_0002415
983 Ga0496114_0311894
984 Ga0496115_0846708
985 Ga0496126_0144107
986 Ga0501031_0028189
987 Ga0501033_0005435
988 Ga0501033_0912449
989 Ga0501034_0028599
990 Ga0501036_0006501
991 Ga0501036_1240860
992 Ga0501037_0006570
993 Ga0501037_1050289
994 Ga0501038_0015042
995 Ga0501038_0329009
996 Ga0501039_0002541
997 Ga0501039_0085563
998 Ga0501040_0000148
999 Ga0501040_0189118
1000 Ga0501040_0589684
1001 Ga0501040_1124112
1002 Ga0501041_0000617
1003 Ga0501041_0236804
1004 Ga0501042_0002676
1005 Ga0501042_0286103
1006 Ga0501043_0082702
1007 Ga0501046_0002068
1008 Ga0501047_0042185
1009 Ga0501048_0359858
1010 Ga0501048_0502278
1011 Ga0501048_0697637
1012 Ga0501068_0009698
1013 Ga0501068_0636526
1014 Ga0501069_0497773
1015 Ga0501070_0156327
1016 Ga0501071_0001007
1017 Ga0501071_0124425
1018 Ga0501071_1039299
1019 Ga0501072_0002453
1020 Ga0501073_0042798
1021 Ga0501074_0009287
1022 Ga0501075_0001919
1023 Ga0501075_0119897
1024 Ga0501075_0493871
1025 Ga0501075_1266710
1026 Ga0501076_0002307
1027 Ga0501076_0392557
1028 Ga0501077_0000395
1029 Ga0501077_0190508
1030 Ga0501079_0002314
1031 Ga0501079_0180315
1032 Ga0501079_0499002
1033 Ga0501079_0594388
1034 Ga0501080_0015699
1035 Ga0501081_0008133
1036 Ga0501081_0297801
1037 Ga0501081_0326938
1038 Ga0501081_1518287
1039 Ga0501083_0266609
1040 Ga0501035_0046475
1041 Ga0501044_0000057
1042 Ga0501044_0099176
1043 Ga0501044_0747014
1044 Ga0501045_0000679
1045 nmdc:mga05p37_227_c1
1046 nmdc:mga09592_10474_c1
1047 nmdc:mga0qj67_71058_c1
1048 nmdc:mga06r32_1038132_c1
1049 nmdc:mga06r32_67177_c1
1050 nmdc:mga06r32_724864_c1
1051 nmdc:mga08y16_172285_c1
1052 nmdc:mga0n895_366340_c1
1053 nmdc:mga0n895_440373_c1
1054 nmdc:mga0n895_46143_c1
1055 nmdc:mga0rr50_270510_c1
1056 nmdc:mga0rr50_430478_c1
1057 nmdc:mga08x19_273351_c1
1058 nmdc:mga0a205_1015580_c1
1059 nmdc:mga0a205_482115_c1
1060 Ga0495601_0000024
1061 Ga0495601_0305079
1062 Ga0495601_0745308
1063 Ga0495612_0000606
1064 Ga0495612_0082317
1065 Ga0495595_0000036
1066 Ga0495619_0000034
1067 Ga0495619_0072694
1068 Ga0495619_1010320
1069 Ga0500595_003036
1070 Ga0500559_0485770
1071 Ga0501084_0361027
1072 Ga0501084_0381489
1073 Ga0501082_0000632
1074 Ga0530510_0000484
1075 Ga0530510_0101556
1076 Ga0530510_0114810
1077 Ga0530510_0217009
1078 Ga0530510_0757622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

25

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9297 1 96
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9116 1 96
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8818 3 93
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8394 3 93
3bb5-assembly2.cif.gz_C crystal structure of a dimeric ferredoxin-like protein of unknown function (jann_3925) from jannaschia sp. ccs1 at 2.30 a resolution 0.7851 3 95
ID Description Score Start End Superfamily
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8963 2 96 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8785 2 96 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8723 2 93 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8386 2 93 3.30.70.100
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7848 2 94 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6J4NLL1-F1-model_v4 DUF1330 domain-containing protein 0.9998 3 96
AF-A0A0A1DNJ0-F1-model_v4 DUF1330 domain-containing protein 0.9968 13 96
AF-A0A7Y9J7Z7-F1-model_v4 Uncharacterized protein (DUF1330 family) 0.9961 3 96
AF-A0A4R1HEM0-F1-model_v4 Uncharacterized protein (DUF1330 family) 0.9866 1 97
AF-A0A0A1DNJ0-F1-model_v4 DUF1330 domain-containing protein 0.9852 13 96

Map