F461028
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 538 | 326 | 528 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0012687|Ga0395905_0012687_5978_6688 |
| Length | 236 |
| Sequence | MSGFSPQYPFQDEPTLADKKHIMALASTLAPPASSRLDHLKAQPRKPGEASFFFYDAHFRNDAVKILPGEYFVYNEDILIMTTLGSCIAACLWDRTARVGGMNHFMLPDGAGDSGRYGSYAMELLINEMMKRGASRMNMEAKVFGGGQVVAGMNSLNVGERNTSFVIDYLKMERIPILSKDVLDIYPRKVCFLPASGKAMVKRLAPANAEALVAQDRAAQQRAVPASTGGGSVDLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 8 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 9 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 10 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 11 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 12 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 13 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 16 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 103 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 110 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 172 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 173 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 175 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 180 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 201 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 202 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 210 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 213 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 214 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 215 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 216 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 217 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 218 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 219 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 220 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 221 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 222 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 223 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 224 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 225 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 226 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 230 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 286 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 292 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 293 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 294 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 295 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 302 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 307 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 308 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 310 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 311 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 312 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 313 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 314 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 315 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 316 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 317 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 318 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 319 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 325 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.77 |
| Metatranscriptomes | 0.37 |
| Isolates | 1.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.14 |
| Nodule | 0.37 |
| Rhizoplane | 4.46 |
| Rhizosphere | 57.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1015859 | 3300002705 | Bacteria | 1489 |
| 2 | JGI25154J39366_1000722 | 3300002738 | Bacteria | 14934 |
| 3 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 4 | JGI25164J39214_1003494 | 3300002772 | Bacteria | 1982 |
| 5 | JGI25152J39213_1018532 | 3300002773 | Bacteria | 1284 |
| 6 | JGI25150J39212_1019541 | 3300002774 | Bacteria | 1059 |
| 7 | JGI25153J46596_10003113 | 3300003215 | Bacteria | 9354 |
| 8 | JGI25153J46596_10003765 | 3300003215 | Bacteria | 8374 |
| 9 | JGI25153J46596_10008735 | 3300003215 | Bacteria | 4801 |
| 10 | JGI25153J46596_10009276 | 3300003215 | Bacteria | 4598 |
| 11 | rootL2_10002966 | 3300003322 | Bacteria | 6484 |
| 12 | rootH1_10004484 | 3300003323 | Bacteria | 4093 |
| 13 | rootH1_10153801 | 3300003323 | Bacteria | 1202 |
| 14 | JGI26128J50194_1000079 | 3300003347 | Bacteria | 3603 |
| 15 | Ga0055539_1000283 | 3300003752 | Bacteria | 28988 |
| 16 | Ga0055539_1001803 | 3300003752 | Bacteria | 3664 |
| 17 | Ga0055533_1000103 | 3300003756 | Bacteria | 107860 |
| 18 | Ga0055525_1000249 | 3300003759 | Bacteria | 53433 |
| 19 | Ga0055525_1001205 | 3300003759 | Bacteria | 5755 |
| 20 | Ga0055535_1000822 | 3300003761 | Bacteria | 22272 |
| 21 | Ga0055529_1000198 | 3300003763 | Bacteria | 81554 |
| 22 | Ga0055526_1006445 | 3300003771 | Bacteria | 6364 |
| 23 | Ga0055524_1000013 | 3300003775 | Bacteria | 259850 |
| 24 | Ga0055530_10021452 | 3300003791 | Bacteria | 1903 |
| 25 | Ga0055540_1000001 | 3300003792 | Bacteria | 466834 |
| 26 | Ga0055540_1011583 | 3300003792 | Bacteria | 2831 |
| 27 | Ga0055531_10002731 | 3300003794 | Bacteria | 11607 |
| 28 | Ga0065165_1005447 | 3300005262 | Bacteria | 7148 |
| 29 | Ga0070658_10371771 | 3300005327 | Bacteria | 1225 |
| 30 | Ga0070676_10004911 | 3300005328 | Bacteria | 7086 |
| 31 | Ga0070683_100256908 | 3300005329 | Bacteria | 1662 |
| 32 | Ga0070690_100015896 | 3300005330 | Bacteria | 4497 |
| 33 | Ga0070670_100080568 | 3300005331 | Bacteria | 2798 |
| 34 | Ga0068869_100095411 | 3300005334 | Bacteria | 2244 |
| 35 | Ga0068869_100116098 | 3300005334 | Bacteria | 2042 |
| 36 | Ga0068869_100117689 | 3300005334 | Bacteria | 2029 |
| 37 | Ga0068868_100008861 | 3300005338 | Bacteria | 7208 |
| 38 | Ga0068868_100451100 | 3300005338 | Bacteria | 1119 |
| 39 | Ga0070660_100191878 | 3300005339 | Bacteria | 1655 |
| 40 | Ga0070660_100633595 | 3300005339 | Bacteria | 895 |
| 41 | Ga0070661_100000166 | 3300005344 | Bacteria | 53989 |
| 42 | Ga0070675_100188113 | 3300005354 | Bacteria | 1788 |
| 43 | Ga0070671_100004264 | 3300005355 | Bacteria | 11312 |
| 44 | Ga0070671_100052441 | 3300005355 | Bacteria | 3391 |
| 45 | Ga0070674_100247587 | 3300005356 | Bacteria | 1398 |
| 46 | Ga0070674_100579843 | 3300005356 | Bacteria | 945 |
| 47 | Ga0070659_100000596 | 3300005366 | Bacteria | 26453 |
| 48 | Ga0070659_100302881 | 3300005366 | Bacteria | 1333 |
| 49 | Ga0070659_100373310 | 3300005366 | Bacteria | 1200 |
| 50 | Ga0070708_100397363 | 3300005445 | Bacteria | 1300 |
| 51 | Ga0070708_100428296 | 3300005445 | Bacteria | 1248 |
| 52 | Ga0070663_100004564 | 3300005455 | Bacteria | 8157 |
| 53 | Ga0070678_100926475 | 3300005456 | Bacteria | 798 |
| 54 | Ga0070662_100072823 | 3300005457 | Bacteria | 2537 |
| 55 | Ga0070662_100081066 | 3300005457 | Bacteria | 2417 |
| 56 | Ga0068867_100001106 | 3300005459 | Bacteria | 18425 |
| 57 | Ga0068867_100254744 | 3300005459 | Bacteria | 1429 |
| 58 | Ga0068867_100360480 | 3300005459 | Bacteria | 1216 |
| 59 | Ga0070706_100004462 | 3300005467 | Bacteria | 13518 |
| 60 | Ga0070707_100034841 | 3300005468 | Bacteria | 4801 |
| 61 | Ga0070698_100361762 | 3300005471 | Bacteria | 1383 |
| 62 | Ga0070672_100163725 | 3300005543 | Bacteria | 1847 |
| 63 | Ga0070665_100055460 | 3300005548 | Bacteria | 3974 |
| 64 | Ga0068855_100003105 | 3300005563 | Bacteria | 20329 |
| 65 | Ga0068855_100008362 | 3300005563 | Bacteria | 12514 |
| 66 | Ga0068855_100043517 | 3300005563 | Bacteria | 5319 |
| 67 | Ga0068855_100247887 | 3300005563 | Bacteria | 1987 |
| 68 | Ga0068855_100709698 | 3300005563 | Bacteria | 1075 |
| 69 | Ga0070664_100001214 | 3300005564 | Bacteria | 20557 |
| 70 | Ga0070664_100130675 | 3300005564 | Bacteria | 2206 |
| 71 | Ga0068857_100003053 | 3300005577 | Bacteria | 13849 |
| 72 | Ga0068857_100699675 | 3300005577 | Bacteria | 963 |
| 73 | Ga0068854_100008624 | 3300005578 | Bacteria | 6562 |
| 74 | Ga0068856_100005614 | 3300005614 | Bacteria | 12341 |
| 75 | Ga0068852_100053853 | 3300005616 | Bacteria | 3465 |
| 76 | Ga0068852_100109476 | 3300005616 | Bacteria | 2509 |
| 77 | Ga0068852_100132911 | 3300005616 | Bacteria | 2294 |
| 78 | Ga0068859_100113536 | 3300005617 | Bacteria | 2773 |
| 79 | Ga0068859_100423920 | 3300005617 | Bacteria | 1427 |
| 80 | Ga0068864_100011328 | 3300005618 | Bacteria | 7369 |
| 81 | Ga0068864_100494558 | 3300005618 | Bacteria | 1176 |
| 82 | Ga0068863_100026987 | 3300005841 | Bacteria | 5477 |
| 83 | Ga0068863_100270213 | 3300005841 | Bacteria | 1646 |
| 84 | Ga0068858_100162479 | 3300005842 | Bacteria | 2103 |
| 85 | Ga0068860_100140069 | 3300005843 | Bacteria | 2325 |
| 86 | Ga0068860_100207591 | 3300005843 | Bacteria | 1900 |
| 87 | Ga0068862_100080540 | 3300005844 | Bacteria | 2824 |
| 88 | Ga0068862_101108849 | 3300005844 | Bacteria | 787 |
| 89 | Ga0075365_10033607 | 3300006038 | Bacteria | 3307 |
| 90 | Ga0075368_10008653 | 3300006042 | Bacteria | 3635 |
| 91 | Ga0075368_10067102 | 3300006042 | Bacteria | 1443 |
| 92 | Ga0075363_100000955 | 3300006048 | Bacteria | 10269 |
| 93 | Ga0075364_10012510 | 3300006051 | Bacteria | 5194 |
| 94 | Ga0075362_10002335 | 3300006177 | Bacteria | 6348 |
| 95 | Ga0075362_10019227 | 3300006177 | Bacteria | 2838 |
| 96 | Ga0075362_10020665 | 3300006177 | Bacteria | 2754 |
| 97 | Ga0075362_10024026 | 3300006177 | Bacteria | 2583 |
| 98 | Ga0075362_10043384 | 3300006177 | Bacteria | 1991 |
| 99 | Ga0075367_10000248 | 3300006178 | Bacteria | 18367 |
| 100 | Ga0075367_10002089 | 3300006178 | Bacteria | 8953 |
| 101 | Ga0075367_10010731 | 3300006178 | Bacteria | 4824 |
| 102 | Ga0075367_10075843 | 3300006178 | Bacteria | 2028 |
| 103 | Ga0075367_10121450 | 3300006178 | Bacteria | 1610 |
| 104 | Ga0075367_10237994 | 3300006178 | Bacteria | 1140 |
| 105 | Ga0075369_10175797 | 3300006186 | Bacteria | 984 |
| 106 | Ga0075369_10187655 | 3300006186 | Bacteria | 952 |
| 107 | Ga0075366_10000604 | 3300006195 | Bacteria | 16839 |
| 108 | Ga0075366_10001157 | 3300006195 | Bacteria | 13049 |
| 109 | Ga0075366_10005349 | 3300006195 | Bacteria | 6959 |
| 110 | Ga0075366_10029290 | 3300006195 | Bacteria | 3235 |
| 111 | Ga0075366_10033782 | 3300006195 | Bacteria | 3014 |
| 112 | Ga0075366_10156721 | 3300006195 | Bacteria | 1379 |
| 113 | Ga0075366_10188166 | 3300006195 | Bacteria | 1254 |
| 114 | Ga0075366_10191789 | 3300006195 | Bacteria | 1242 |
| 115 | Ga0075366_10322788 | 3300006195 | Bacteria | 946 |
| 116 | Ga0097621_100152530 | 3300006237 | Bacteria | 1982 |
| 117 | Ga0075370_10000766 | 3300006353 | Bacteria | 12858 |
| 118 | Ga0075370_10001525 | 3300006353 | Bacteria | 10127 |
| 119 | Ga0075370_10003099 | 3300006353 | Bacteria | 7848 |
| 120 | Ga0075370_10004128 | 3300006353 | Bacteria | 6999 |
| 121 | Ga0075370_10012132 | 3300006353 | Bacteria | 4547 |
| 122 | Ga0075370_10316352 | 3300006353 | Bacteria | 929 |
| 123 | Ga0068871_100708154 | 3300006358 | Bacteria | 923 |
| 124 | Ga0068865_100043017 | 3300006881 | Bacteria | 3084 |
| 125 | Ga0097620_100113539 | 3300006931 | Bacteria | 2773 |
| 126 | Ga0097620_100423880 | 3300006931 | Bacteria | 1427 |
| 127 | Ga0079104_1000070 | 3300006946 | Bacteria | 153879 |
| 128 | Ga0105240_10048445 | 3300009093 | Bacteria | 5370 |
| 129 | Ga0105240_10088123 | 3300009093 | Bacteria | 3799 |
| 130 | Ga0105245_10212485 | 3300009098 | Bacteria | 1863 |
| 131 | Ga0105247_10356288 | 3300009101 | Bacteria | 1030 |
| 132 | Ga0114129_10644397 | 3300009147 | Bacteria | 1368 |
| 133 | Ga0105243_10007836 | 3300009148 | Bacteria | 8211 |
| 134 | Ga0105243_10081584 | 3300009148 | Bacteria | 2641 |
| 135 | Ga0105242_10025488 | 3300009176 | Bacteria | 4681 |
| 136 | Ga0105248_10001199 | 3300009177 | Bacteria | 28958 |
| 137 | Ga0105248_10432476 | 3300009177 | Bacteria | 1482 |
| 138 | Ga0105237_10018364 | 3300009545 | Bacteria | 7237 |
| 139 | Ga0105237_10138343 | 3300009545 | Bacteria | 2430 |
| 140 | Ga0105238_10379483 | 3300009551 | Bacteria | 1405 |
| 141 | Ga0105238_10768369 | 3300009551 | Bacteria | 978 |
| 142 | Ga0105239_10039994 | 3300010375 | Bacteria | 5137 |
| 143 | Ga0105239_10074103 | 3300010375 | Bacteria | 3743 |
| 144 | Ga0105239_10702863 | 3300010375 | Bacteria | 1156 |
| 145 | Ga0105246_10117958 | 3300011119 | Bacteria | 1962 |
| 146 | Ga0105246_10212944 | 3300011119 | Bacteria | 1509 |
| 147 | Ga0157371_10207005 | 3300013102 | Bacteria | 1407 |
| 148 | Ga0157369_10008425 | 3300013105 | Bacteria | 11825 |
| 149 | Ga0157374_10295712 | 3300013296 | Bacteria | 1601 |
| 150 | Ga0157378_10134590 | 3300013297 | Bacteria | 2290 |
| 151 | Ga0157378_10237507 | 3300013297 | Bacteria | 1740 |
| 152 | Ga0163162_10348872 | 3300013306 | Bacteria | 1613 |
| 153 | Ga0163162_10623067 | 3300013306 | Bacteria | 1204 |
| 154 | Ga0157375_10014574 | 3300013308 | Bacteria | 7019 |
| 155 | Ga0157375_10672776 | 3300013308 | Bacteria | 1190 |
| 156 | Ga0163163_10245719 | 3300014325 | Bacteria | 1840 |
| 157 | Ga0163163_11185262 | 3300014325 | Bacteria | 826 |
| 158 | Ga0157377_10000091 | 3300014745 | Bacteria | 66087 |
| 159 | Ga0157379_10018297 | 3300014968 | Bacteria | 6175 |
| 160 | Ga0182007_10028861 | 3300015262 | Bacteria | 1903 |
| 161 | Ga0213872_10000008 | 3300021361 | Bacteria | 226283 |
| 162 | Ga0213872_10000044 | 3300021361 | Bacteria | 114843 |
| 163 | Ga0213872_10011647 | 3300021361 | Bacteria | 4159 |
| 164 | Ga0213872_10013889 | 3300021361 | Bacteria | 3765 |
| 165 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 166 | Ga0209674_110532 | 3300025226 | Bacteria | 980 |
| 167 | Ga0209563_100013 | 3300025230 | Bacteria | 941463 |
| 168 | Ga0209563_100141 | 3300025230 | Bacteria | 79513 |
| 169 | Ga0207427_100546 | 3300025231 | Bacteria | 19253 |
| 170 | Ga0209258_100044 | 3300025242 | Bacteria | 376336 |
| 171 | Ga0207425_1000581 | 3300025245 | Bacteria | 21349 |
| 172 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 173 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 174 | Ga0209677_100133 | 3300025253 | Bacteria | 69526 |
| 175 | Ga0209677_100196 | 3300025253 | Bacteria | 48682 |
| 176 | Ga0209677_102270 | 3300025253 | Bacteria | 7431 |
| 177 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 178 | Ga0209759_1004001 | 3300025256 | Bacteria | 5649 |
| 179 | Ga0209759_1005519 | 3300025256 | Bacteria | 4410 |
| 180 | Ga0209129_1000043 | 3300025258 | Bacteria | 298978 |
| 181 | Ga0209129_1018269 | 3300025258 | Bacteria | 1351 |
| 182 | Ga0209565_1011421 | 3300025263 | Bacteria | 2159 |
| 183 | Ga0209565_1024128 | 3300025263 | Bacteria | 1241 |
| 184 | Ga0209455_1000048 | 3300025272 | Bacteria | 376260 |
| 185 | Ga0209673_1044532 | 3300025273 | Bacteria | 1227 |
| 186 | Ga0209673_1061652 | 3300025273 | Bacteria | 934 |
| 187 | Ga0209675_1009681 | 3300025291 | Bacteria | 3379 |
| 188 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 189 | Ga0209758_1000093 | 3300025297 | Bacteria | 241169 |
| 190 | Ga0209758_1000204 | 3300025297 | Bacteria | 131754 |
| 191 | Ga0209050_1000730 | 3300025298 | Bacteria | 47896 |
| 192 | Ga0209050_1002169 | 3300025298 | Bacteria | 17761 |
| 193 | Ga0209256_1000061 | 3300025299 | Bacteria | 260890 |
| 194 | Ga0209051_1000018 | 3300025303 | Bacteria | 527061 |
| 195 | Ga0209051_1009498 | 3300025303 | Bacteria | 5008 |
| 196 | Ga0209051_1020564 | 3300025303 | Bacteria | 2837 |
| 197 | Ga0209257_1000461 | 3300025304 | Bacteria | 75360 |
| 198 | Ga0207710_10064937 | 3300025900 | Bacteria | 1663 |
| 199 | Ga0207645_10001536 | 3300025907 | Bacteria | 18872 |
| 200 | Ga0207645_10031817 | 3300025907 | Bacteria | 3392 |
| 201 | Ga0207643_10026228 | 3300025908 | Bacteria | 3225 |
| 202 | Ga0207684_10009321 | 3300025910 | Bacteria | 8674 |
| 203 | Ga0207671_10306167 | 3300025914 | Bacteria | 1256 |
| 204 | Ga0207671_10317904 | 3300025914 | Bacteria | 1232 |
| 205 | Ga0207671_10482629 | 3300025914 | Bacteria | 988 |
| 206 | Ga0207657_10044736 | 3300025919 | Bacteria | 3890 |
| 207 | Ga0207657_10046860 | 3300025919 | Bacteria | 3785 |
| 208 | Ga0207649_10245493 | 3300025920 | Bacteria | 1287 |
| 209 | Ga0207646_10162518 | 3300025922 | Bacteria | 2015 |
| 210 | Ga0207694_10006906 | 3300025924 | Bacteria | 8617 |
| 211 | Ga0207694_10362390 | 3300025924 | Bacteria | 1201 |
| 212 | Ga0207659_10401372 | 3300025926 | Bacteria | 1147 |
| 213 | Ga0207687_10177592 | 3300025927 | Bacteria | 1647 |
| 214 | Ga0207687_10368215 | 3300025927 | Bacteria | 1174 |
| 215 | Ga0207644_10011821 | 3300025931 | Bacteria | 5781 |
| 216 | Ga0207644_10388556 | 3300025931 | Bacteria | 1139 |
| 217 | Ga0207690_10007998 | 3300025932 | Bacteria | 6279 |
| 218 | Ga0207690_10358448 | 3300025932 | Bacteria | 1155 |
| 219 | Ga0207706_10000499 | 3300025933 | Bacteria | 41776 |
| 220 | Ga0207686_10041390 | 3300025934 | Bacteria | 2809 |
| 221 | Ga0207709_10006138 | 3300025935 | Bacteria | 6770 |
| 222 | Ga0207709_10030982 | 3300025935 | Bacteria | 3118 |
| 223 | Ga0207709_10073180 | 3300025935 | Bacteria | 2183 |
| 224 | Ga0207669_10138545 | 3300025937 | Bacteria | 1685 |
| 225 | Ga0207704_10003303 | 3300025938 | Bacteria | 7325 |
| 226 | Ga0207691_10011060 | 3300025940 | Bacteria | 8662 |
| 227 | Ga0207711_10099282 | 3300025941 | Bacteria | 2573 |
| 228 | Ga0207711_10646455 | 3300025941 | Bacteria | 987 |
| 229 | Ga0207689_10015550 | 3300025942 | Bacteria | 6445 |
| 230 | Ga0207689_10042634 | 3300025942 | Bacteria | 3752 |
| 231 | Ga0207689_10103112 | 3300025942 | Bacteria | 2344 |
| 232 | Ga0207689_10360606 | 3300025942 | Bacteria | 1209 |
| 233 | Ga0207661_10045411 | 3300025944 | Bacteria | 3478 |
| 234 | Ga0207679_10069410 | 3300025945 | Bacteria | 2652 |
| 235 | Ga0207679_10109017 | 3300025945 | Bacteria | 2181 |
| 236 | Ga0207679_10690624 | 3300025945 | Bacteria | 925 |
| 237 | Ga0207667_10015058 | 3300025949 | Bacteria | 8796 |
| 238 | Ga0207667_10021522 | 3300025949 | Bacteria | 7145 |
| 239 | Ga0207667_10241082 | 3300025949 | Bacteria | 1850 |
| 240 | Ga0207667_10436667 | 3300025949 | Bacteria | 1331 |
| 241 | Ga0207667_10953819 | 3300025949 | Bacteria | 847 |
| 242 | Ga0207651_10302511 | 3300025960 | Bacteria | 1330 |
| 243 | Ga0207651_10784067 | 3300025960 | Bacteria | 844 |
| 244 | Ga0207640_10009925 | 3300025981 | Bacteria | 5346 |
| 245 | Ga0207658_10306007 | 3300025986 | Bacteria | 1371 |
| 246 | Ga0207678_10003138 | 3300026067 | Bacteria | 14954 |
| 247 | Ga0207702_10001078 | 3300026078 | Bacteria | 27950 |
| 248 | Ga0207641_10025685 | 3300026088 | Bacteria | 4856 |
| 249 | Ga0207641_10156342 | 3300026088 | Bacteria | 2069 |
| 250 | Ga0207648_10002366 | 3300026089 | Bacteria | 20335 |
| 251 | Ga0207648_10034057 | 3300026089 | Bacteria | 4492 |
| 252 | Ga0207648_10082737 | 3300026089 | Bacteria | 2799 |
| 253 | Ga0207676_10353110 | 3300026095 | Bacteria | 1360 |
| 254 | Ga0207674_10005131 | 3300026116 | Bacteria | 15626 |
| 255 | Ga0207674_10056935 | 3300026116 | Bacteria | 3966 |
| 256 | Ga0207675_100198514 | 3300026118 | Bacteria | 1926 |
| 257 | Ga0207683_10601000 | 3300026121 | Bacteria | 1018 |
| 258 | Ga0207698_10259141 | 3300026142 | Bacteria | 1596 |
| 259 | Ga0209281_1000103 | 3300027111 | Bacteria | 221425 |
| 260 | Ga0209981_1004231 | 3300027378 | Bacteria | 1878 |
| 261 | Ga0209996_1007205 | 3300027395 | Bacteria | 1446 |
| 262 | Ga0209995_1002718 | 3300027471 | Bacteria | 2801 |
| 263 | Ga0209968_1004092 | 3300027526 | Bacteria | 2191 |
| 264 | Ga0209966_1000078 | 3300027695 | Bacteria | 42139 |
| 265 | Ga0209813_10001410 | 3300027866 | Bacteria | 5426 |
| 266 | Ga0209813_10047404 | 3300027866 | Bacteria | 1331 |
| 267 | Ga0209974_10000352 | 3300027876 | Bacteria | 15062 |
| 268 | Ga0268266_10018969 | 3300028379 | Bacteria | 5859 |
| 269 | Ga0268266_11132791 | 3300028379 | Bacteria | 757 |
| 270 | Ga0268265_10008545 | 3300028380 | Bacteria | 6921 |
| 271 | Ga0268264_10557547 | 3300028381 | Bacteria | 1124 |
| 272 | Ga0265336_10000053 | 3300028666 | Bacteria | 113034 |
| 273 | Ga0307517_10007352 | 3300028786 | Bacteria | 16079 |
| 274 | Ga0307517_10140984 | 3300028786 | Bacteria | 1692 |
| 275 | Ga0307515_10001658 | 3300028794 | Bacteria | 49584 |
| 276 | Ga0307515_10003085 | 3300028794 | Bacteria | 35271 |
| 277 | Ga0307515_10004515 | 3300028794 | Bacteria | 28764 |
| 278 | Ga0307515_10033134 | 3300028794 | Bacteria | 8519 |
| 279 | Ga0307515_10038935 | 3300028794 | Bacteria | 7582 |
| 280 | Ga0265324_10001024 | 3300029957 | Bacteria | 17194 |
| 281 | Ga0307511_10086935 | 3300030521 | Bacteria | 2149 |
| 282 | Ga0307512_10183486 | 3300030522 | Bacteria | 1170 |
| 283 | Ga0265327_10000374 | 3300031251 | Bacteria | 84337 |
| 284 | Ga0265327_10120131 | 3300031251 | Bacteria | 1246 |
| 285 | Ga0307513_10010543 | 3300031456 | Bacteria | 11566 |
| 286 | Ga0307513_10042402 | 3300031456 | Bacteria | 5011 |
| 287 | Ga0307513_10276802 | 3300031456 | Bacteria | 1458 |
| 288 | Ga0307509_10067221 | 3300031507 | Bacteria | 3756 |
| 289 | Ga0307509_10233213 | 3300031507 | Bacteria | 1641 |
| 290 | Ga0307508_10000082 | 3300031616 | Bacteria | 111720 |
| 291 | Ga0307508_10013038 | 3300031616 | Bacteria | 7601 |
| 292 | Ga0307508_10106602 | 3300031616 | Bacteria | 2401 |
| 293 | Ga0307514_10001022 | 3300031649 | Bacteria | 40547 |
| 294 | Ga0307514_10023730 | 3300031649 | Bacteria | 4973 |
| 295 | Ga0307514_10044689 | 3300031649 | Bacteria | 3469 |
| 296 | Ga0307516_10000286 | 3300031730 | Bacteria | 65447 |
| 297 | Ga0307516_10002190 | 3300031730 | Bacteria | 26468 |
| 298 | Ga0307516_10002898 | 3300031730 | Bacteria | 22490 |
| 299 | Ga0307516_10117316 | 3300031730 | Bacteria | 2456 |
| 300 | Ga0307516_10266339 | 3300031730 | Bacteria | 1402 |
| 301 | Ga0307516_10360097 | 3300031730 | Bacteria | 1119 |
| 302 | Ga0307516_10517599 | 3300031730 | Bacteria | 847 |
| 303 | Ga0307405_10039982 | 3300031731 | Bacteria | 2838 |
| 304 | Ga0307410_10034588 | 3300031852 | Bacteria | 3274 |
| 305 | Ga0307406_10111293 | 3300031901 | Bacteria | 1886 |
| 306 | Ga0307407_10010312 | 3300031903 | Bacteria | 4400 |
| 307 | Ga0307407_10218264 | 3300031903 | Bacteria | 1288 |
| 308 | Ga0307412_10107337 | 3300031911 | Bacteria | 1987 |
| 309 | Ga0307412_10507324 | 3300031911 | Bacteria | 1005 |
| 310 | Ga0307409_100477828 | 3300031995 | Bacteria | 1209 |
| 311 | Ga0307409_101021267 | 3300031995 | Bacteria | 846 |
| 312 | Ga0307411_10020463 | 3300032005 | Bacteria | 3849 |
| 313 | Ga0307411_10204241 | 3300032005 | Bacteria | 1520 |
| 314 | Ga0307411_10430268 | 3300032005 | Bacteria | 1099 |
| 315 | Ga0307415_100051981 | 3300032126 | Bacteria | 2784 |
| 316 | Ga0307507_10018450 | 3300033179 | Bacteria | 7930 |
| 317 | Ga0307510_10264326 | 3300033180 | Bacteria | 1200 |
| 318 | Ga0373931_0007609 | 3300035691 | Bacteria | 5105 |
| 319 | Ga0373931_0155635 | 3300035691 | Bacteria | 1336 |
| 320 | Ga0373947_0294130 | 3300035725 | Bacteria | 1082 |
| 321 | Ga0395900_0000025 | 3300037418 | Bacteria | 321217 |
| 322 | Ga0395898_0000811 | 3300037466 | Bacteria | 52404 |
| 323 | Ga0395905_0012243 | 3300037471 | Bacteria | 8261 |
| 324 | Ga0395905_0012687 | 3300037471 | Bacteria | 8107 |
| 325 | Ga0395905_0138667 | 3300037471 | Bacteria | 2288 |
| 326 | Ga0395905_0326151 | 3300037471 | Bacteria | 1425 |
| 327 | Ga0395901_0013605 | 3300038443 | Bacteria | 8273 |
| 328 | Ga0436365_1861796 | 3300039437 | Bacteria | 873 |
| 329 | Ga0436361_0155039 | 3300039447 | Bacteria | 5127 |
| 330 | Ga0436361_0609590 | 3300039447 | Bacteria | 21697 |
| 331 | Ga0436361_0757401 | 3300039447 | Bacteria | 49858 |
| 332 | Ga0436361_0886712 | 3300039447 | Bacteria | 114879 |
| 333 | Ga0436361_0971257 | 3300039447 | Bacteria | 2214 |
| 334 | Ga0439461_0016736 | 3300041410 | Bacteria | 1419 |
| 335 | Ga0439465_0066443 | 3300041413 | Bacteria | 1202 |
| 336 | Ga0451787_391274 | 3300041441 | Bacteria | 806 |
| 337 | Ga0451789_1298857 | 3300041443 | Bacteria | 792 |
| 338 | Ga0451791_0628982 | 3300041451 | Bacteria | 1232 |
| 339 | Ga0451793_1596311 | 3300041452 | Bacteria | 2956 |
| 340 | Ga0451800_1303403 | 3300041459 | Bacteria | 4146 |
| 341 | Ga0451804_0735751 | 3300041463 | Bacteria | 2920 |
| 342 | Ga0451807_0789257 | 3300041486 | Bacteria | 907 |
| 343 | Ga0451807_0881130 | 3300041486 | Bacteria | 1142 |
| 344 | Ga0451841_1256041 | 3300041498 | Bacteria | 848 |
| 345 | Ga0451849_1186840 | 3300041505 | Bacteria | 2032 |
| 346 | Ga0451853_1713310 | 3300041512 | Bacteria | 869 |
| 347 | Ga0451853_1731200 | 3300041512 | Bacteria | 2553 |
| 348 | Ga0439431_0004245 | 3300041997 | Bacteria | 3146 |
| 349 | Ga0439449_0024846 | 3300042007 | Bacteria | 2240 |
| 350 | Ga0439454_007535 | 3300042011 | Bacteria | 1367 |
| 351 | Ga0439455_0011499 | 3300042012 | Bacteria | 1968 |
| 352 | Ga0439457_018178 | 3300042014 | Bacteria | 1561 |
| 353 | Ga0450919_000357 | 3300042121 | Bacteria | 5521 |
| 354 | Ga0450920_013737 | 3300042122 | Bacteria | 1526 |
| 355 | Ga0450897_005991 | 3300042128 | Bacteria | 1073 |
| 356 | Ga0450894_026219 | 3300042131 | Bacteria | 800 |
| 357 | Ga0450898_001232 | 3300042134 | Bacteria | 3318 |
| 358 | Ga0450899_004259 | 3300042135 | Bacteria | 1533 |
| 359 | Ga0439458_0050501 | 3300042157 | Bacteria | 1026 |
| 360 | Ga0439434_0017482 | 3300042435 | Bacteria | 2146 |
| 361 | Ga0450918_001134 | 3300042531 | Bacteria | 5459 |
| 362 | Ga0450893_0036380 | 3300042532 | Bacteria | 891 |
| 363 | Ga0451577_0000303 | 3300042876 | Bacteria | 95840 |
| 364 | Ga0451577_0003093 | 3300042876 | Bacteria | 18788 |
| 365 | Ga0466969_0000100 | 3300044656 | Bacteria | 45570 |
| 366 | Ga0466969_0024033 | 3300044656 | Bacteria | 3135 |
| 367 | Ga0466972_0024741 | 3300044658 | Bacteria | 2979 |
| 368 | Ga0466972_0095882 | 3300044658 | Bacteria | 1405 |
| 369 | Ga0466965_0006107 | 3300044683 | Bacteria | 5443 |
| 370 | Ga0466965_0006505 | 3300044683 | Bacteria | 5311 |
| 371 | Ga0466966_0041188 | 3300044684 | Bacteria | 2968 |
| 372 | Ga0466966_0058201 | 3300044684 | Bacteria | 2443 |
| 373 | Ga0466961_0002147 | 3300044693 | Bacteria | 12260 |
| 374 | Ga0466961_0029042 | 3300044693 | Bacteria | 3555 |
| 375 | Ga0466963_0002684 | 3300044694 | Bacteria | 10020 |
| 376 | Ga0466964_0007187 | 3300044706 | Bacteria | 4164 |
| 377 | Ga0466964_0027777 | 3300044706 | Bacteria | 2224 |
| 378 | Ga0466964_0060540 | 3300044706 | Bacteria | 1575 |
| 379 | Ga0453684_0000947 | 3300044712 | Bacteria | 95768 |
| 380 | Ga0453684_0023418 | 3300044712 | Bacteria | 9099 |
| 381 | Ga0453684_0160050 | 3300044712 | Bacteria | 2664 |
| 382 | Ga0453684_0538015 | 3300044712 | Bacteria | 1288 |
| 383 | Ga0466971_0013109 | 3300044719 | Bacteria | 3635 |
| 384 | Ga0466971_0121205 | 3300044719 | Bacteria | 1210 |
| 385 | Ga0466968_0032551 | 3300044735 | Bacteria | 2170 |
| 386 | Ga0466970_0003278 | 3300044765 | Bacteria | 7869 |
| 387 | Ga0466957_0004566 | 3300044842 | Bacteria | 7733 |
| 388 | Ga0466957_0397337 | 3300044842 | Bacteria | 942 |
| 389 | Ga0466959_0000041 | 3300045049 | Bacteria | 100097 |
| 390 | Ga0466959_0016403 | 3300045049 | Bacteria | 5411 |
| 391 | Ga0466959_0019003 | 3300045049 | Bacteria | 5050 |
| 392 | Ga0451576_0000880 | 3300045051 | Bacteria | 57256 |
| 393 | Ga0451576_0013521 | 3300045051 | Bacteria | 9131 |
| 394 | Ga0451576_0229615 | 3300045051 | Bacteria | 1938 |
| 395 | Ga0466967_0033411 | 3300045976 | Bacteria | 4354 |
| 396 | Ga0495638_0248245 | 3300046460 | Bacteria | 982 |
| 397 | Ga0495585_0035205 | 3300046492 | Bacteria | 2831 |
| 398 | Ga0495583_0000159 | 3300046506 | Bacteria | 113627 |
| 399 | Ga0495606_0003437 | 3300046507 | Bacteria | 16806 |
| 400 | Ga0495630_0071863 | 3300046517 | Bacteria | 2605 |
| 401 | Ga0495632_0022038 | 3300046519 | Bacteria | 3422 |
| 402 | Ga0495632_0260598 | 3300046519 | Bacteria | 775 |
| 403 | Ga0495643_0159889 | 3300046522 | Bacteria | 1109 |
| 404 | Ga0495642_0033010 | 3300046528 | Bacteria | 2080 |
| 405 | Ga0495642_0143193 | 3300046528 | Bacteria | 1032 |
| 406 | Ga0495642_0153447 | 3300046528 | Bacteria | 997 |
| 407 | Ga0495654_0084833 | 3300046530 | Bacteria | 1479 |
| 408 | Ga0495597_0023224 | 3300046542 | Bacteria | 2870 |
| 409 | Ga0495597_0023929 | 3300046542 | Bacteria | 2823 |
| 410 | Ga0495633_0165772 | 3300046558 | Bacteria | 1019 |
| 411 | Ga0495668_0028187 | 3300046616 | Bacteria | 3177 |
| 412 | Ga0495668_0054387 | 3300046616 | Bacteria | 2213 |
| 413 | Ga0495611_0082720 | 3300046648 | Bacteria | 1478 |
| 414 | Ga0495625_0001168 | 3300046660 | Bacteria | 33801 |
| 415 | Ga0495625_0011185 | 3300046660 | Bacteria | 7341 |
| 416 | Ga0495658_0154516 | 3300046683 | Bacteria | 1411 |
| 417 | Ga0495669_0123590 | 3300046684 | Bacteria | 1215 |
| 418 | Ga0495624_0024912 | 3300046690 | Bacteria | 3936 |
| 419 | Ga0495671_0070149 | 3300046692 | Bacteria | 1722 |
| 420 | Ga0495671_0234591 | 3300046692 | Bacteria | 887 |
| 421 | Ga0495649_0001310 | 3300046694 | Bacteria | 19011 |
| 422 | Ga0495649_0002829 | 3300046694 | Bacteria | 12048 |
| 423 | Ga0495589_0006046 | 3300046794 | Bacteria | 6393 |
| 424 | Ga0495687_000628 | 3300047443 | Bacteria | 40562 |
| 425 | Ga0495687_002720 | 3300047443 | Bacteria | 13717 |
| 426 | Ga0495687_012385 | 3300047443 | Bacteria | 4513 |
| 427 | Ga0495679_089414 | 3300047446 | Bacteria | 865 |
| 428 | Ga0495686_0009194 | 3300047472 | Bacteria | 7153 |
| 429 | Ga0495593_0052945 | 3300047673 | Bacteria | 2143 |
| 430 | Ga0495626_0102131 | 3300048091 | Bacteria | 1249 |
| 431 | Ga0496100_0107039 | 3300048903 | Bacteria | 1937 |
| 432 | Ga0496101_0195009 | 3300048904 | Bacteria | 1564 |
| 433 | Ga0496101_0406079 | 3300048904 | Bacteria | 1073 |
| 434 | Ga0496102_0002611 | 3300048905 | Bacteria | 15339 |
| 435 | Ga0496102_0034503 | 3300048905 | Bacteria | 4551 |
| 436 | Ga0496104_0416836 | 3300048907 | Bacteria | 1255 |
| 437 | Ga0496105_0049224 | 3300048908 | Bacteria | 3479 |
| 438 | Ga0496105_0150388 | 3300048908 | Bacteria | 1914 |
| 439 | Ga0496106_0319603 | 3300048909 | Bacteria | 1246 |
| 440 | Ga0496109_1007784 | 3300048912 | Bacteria | 770 |
| 441 | Ga0496110_0310437 | 3300048913 | Bacteria | 1436 |
| 442 | Ga0496113_0076861 | 3300048916 | Bacteria | 2551 |
| 443 | Ga0496114_0128038 | 3300048917 | Bacteria | 2190 |
| 444 | Ga0496114_0132696 | 3300048917 | Bacteria | 2152 |
| 445 | Ga0496114_0379298 | 3300048917 | Bacteria | 1252 |
| 446 | Ga0496115_0607802 | 3300048918 | Bacteria | 869 |
| 447 | Ga0496121_0023384 | 3300048924 | Bacteria | 5954 |
| 448 | Ga0496124_0000086 | 3300048927 | Bacteria | 202844 |
| 449 | Ga0496125_0015950 | 3300048928 | Bacteria | 7236 |
| 450 | Ga0496126_0365800 | 3300048929 | Bacteria | 1177 |
| 451 | Ga0501306_006178 | 3300049127 | Bacteria | 1397 |
| 452 | Ga0501309_002339 | 3300049129 | Bacteria | 2028 |
| 453 | Ga0501292_033183 | 3300049515 | Bacteria | 873 |
| 454 | Ga0501298_009500 | 3300049521 | Bacteria | 1657 |
| 455 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 456 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 457 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 458 | Ga0501048_0005708 | 3300049582 | Bacteria | 9458 |
| 459 | Ga0501198_000028 | 3300049649 | Bacteria | 64045 |
| 460 | Ga0501206_008287 | 3300049653 | Bacteria | 1372 |
| 461 | Ga0501222_000024 | 3300049662 | Bacteria | 65412 |
| 462 | Ga0501257_028997 | 3300049686 | Bacteria | 1329 |
| 463 | Ga0501273_020043 | 3300049770 | Bacteria | 900 |
| 464 | Ga0501045_0383257 | 3300049824 | Bacteria | 1046 |
| 465 | nmdc:mga03683_107996_c1 | 3300050489 | Bacteria | 1228 |
| 466 | nmdc:mga03683_1212_c1 | 3300050489 | Bacteria | 7621 |
| 467 | nmdc:mga03683_13843_c1 | 3300050489 | Bacteria | 2974 |
| 468 | nmdc:mga03683_195575_c1 | 3300050489 | Bacteria | 926 |
| 469 | nmdc:mga03683_37482_c1 | 3300050489 | Bacteria | 1976 |
| 470 | nmdc:mga03683_76125_c1 | 3300050489 | Bacteria | 1442 |
| 471 | nmdc:mga03n38_25315_c1 | 3300050490 | Bacteria | 2435 |
| 472 | nmdc:mga03n38_593_c1 | 3300050490 | Bacteria | 9218 |
| 473 | nmdc:mga03n38_87593_c1 | 3300050490 | Bacteria | 1476 |
| 474 | nmdc:mga00v17_229500_c1 | 3300050491 | Bacteria | 1203 |
| 475 | nmdc:mga0yw44_23719_c1 | 3300050492 | Bacteria | 3461 |
| 476 | nmdc:mga0k408_15903_c1 | 3300050493 | Bacteria | 3730 |
| 477 | nmdc:mga0k408_159269_c1 | 3300050493 | Bacteria | 1345 |
| 478 | nmdc:mga0k408_242278_c1 | 3300050493 | Bacteria | 1077 |
| 479 | nmdc:mga0k408_25429_c1 | 3300050493 | Bacteria | 2815 |
| 480 | nmdc:mga0k408_307473_c1 | 3300050493 | Bacteria | 946 |
| 481 | nmdc:mga0k408_31112_c1 | 3300050493 | Bacteria | 3046 |
| 482 | nmdc:mga0k408_32627_c1 | 3300050493 | Bacteria | 2974 |
| 483 | nmdc:mga0k408_53733_c1 | 3300050493 | Bacteria | 2335 |
| 484 | nmdc:mga0k408_75757_c1 | 3300050493 | Bacteria | 1966 |
| 485 | nmdc:mga0k408_79_c1 | 3300050493 | Bacteria | 45658 |
| 486 | nmdc:mga0k408_82788_c1 | 3300050493 | Bacteria | 1881 |
| 487 | nmdc:mga0k408_98966_c1 | 3300050493 | Bacteria | 1719 |
| 488 | nmdc:mga06z11_20503_c1 | 3300050494 | Bacteria | 3056 |
| 489 | nmdc:mga06z11_25939_c1 | 3300050494 | Bacteria | 2784 |
| 490 | nmdc:mga06z11_2696_c1 | 3300050494 | Bacteria | 6797 |
| 491 | nmdc:mga06z11_274646_c1 | 3300050494 | Bacteria | 997 |
| 492 | nmdc:mga06z11_44685_c1 | 3300050494 | Bacteria | 2235 |
| 493 | nmdc:mga04h51_558_c1 | 3300050495 | Bacteria | 8865 |
| 494 | nmdc:mga04h51_56703_c1 | 3300050495 | Bacteria | 1331 |
| 495 | nmdc:mga07m45_126_c1 | 3300050496 | Bacteria | 30476 |
| 496 | nmdc:mga07m45_279033_c1 | 3300050496 | Bacteria | 972 |
| 497 | nmdc:mga07m45_28514_c1 | 3300050496 | Bacteria | 3082 |
| 498 | nmdc:mga07m45_28726_c1 | 3300050496 | Bacteria | 3070 |
| 499 | nmdc:mga07m45_31221_c1 | 3300050496 | Bacteria | 2952 |
| 500 | nmdc:mga07m45_33561_c1 | 3300050496 | Bacteria | 2851 |
| 501 | nmdc:mga07m45_42168_c1 | 3300050496 | Bacteria | 2558 |
| 502 | nmdc:mga07m45_438_c1 | 3300050496 | Bacteria | 17312 |
| 503 | nmdc:mga0sz30_101608_c1 | 3300050516 | Bacteria | 1256 |
| 504 | nmdc:mga0sz30_40774_c1 | 3300050516 | Bacteria | 1952 |
| 505 | Ga0500635_0000035 | 3300053080 | Bacteria | 94938 |
| 506 | Ga0500578_0001958 | 3300053086 | Bacteria | 18805 |
| 507 | Ga0500644_0038755 | 3300053088 | Bacteria | 1566 |
| 508 | Ga0500646_0007390 | 3300053090 | Bacteria | 2806 |
| 509 | Ga0500583_0036205 | 3300053092 | Bacteria | 2208 |
| 510 | Ga0500651_0060839 | 3300053093 | Bacteria | 2360 |
| 511 | Ga0500651_0065244 | 3300053093 | Bacteria | 2269 |
| 512 | Ga0500651_0247038 | 3300053093 | Bacteria | 1039 |
| 513 | Ga0500650_0012176 | 3300053098 | Bacteria | 3571 |
| 514 | Ga0500562_032907 | 3300053108 | Bacteria | 1369 |
| 515 | Ga0500593_000573 | 3300053117 | Bacteria | 14130 |
| 516 | Ga0500623_060638 | 3300053127 | Bacteria | 1870 |
| 517 | Ga0500628_005859 | 3300053129 | Bacteria | 2065 |
| 518 | Ga0500642_0005820 | 3300053130 | Bacteria | 4009 |
| 519 | Ga0500652_001332 | 3300053131 | Bacteria | 7760 |
| 520 | Ga0500658_0025932 | 3300053134 | Bacteria | 2255 |
| 521 | Ga0500559_0006966 | 3300053136 | Bacteria | 5054 |
| 522 | Ga0500568_0007623 | 3300053139 | Bacteria | 5289 |
| 523 | Ga0500568_0015752 | 3300053139 | Bacteria | 3377 |
| 524 | Ga0500590_017967 | 3300053148 | Bacteria | 3658 |
| 525 | Ga0500619_000321 | 3300053154 | Bacteria | 9344 |
| 526 | Ga0500570_025358 | 3300053724 | Bacteria | 3259 |
| 527 | Ga0590075_015655 | 3300059424 | Bacteria | 1861 |
| 528 | Ga0466962_0027598 | 3300061719 | Bacteria | 2724 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_256777_257436 | 191 |
| 2 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_34400_35059 | 191 |
| 3 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_34080_34739 | 191 |
| 4 | 3300049582 | Ga0501048_0005708 | Ga0501048_0005708_6313_6972 | 191 |
| 5 | 3300049824 | Ga0501045_0383257 | Ga0501045_0383257_20_679 | 191 |
| 6 | 3300046528 | Ga0495642_0153447 | Ga0495642_0153447_109_789 | 197 |
| 7 | 3300005616 | Ga0068852_100109476 | Ga0068852_1001094764 | 198 |
| 8 | 3300031903 | Ga0307407_10218264 | Ga0307407_102182642 | 200 |
| 9 | 3300032005 | Ga0307411_10204241 | Ga0307411_102042412 | 200 |
| 10 | 3300005563 | Ga0068855_100008362 | Ga0068855_1000083623 | 201 |
| 11 | 3300025949 | Ga0207667_10021522 | Ga0207667_100215222 | 201 |
| 12 | 3300042131 | Ga0450894_026219 | Ga0450894_026219_154_771 | 205 |
| 13 | 3300042134 | Ga0450898_001232 | Ga0450898_001232_215_832 | 205 |
| 14 | 3300042135 | Ga0450899_004259 | Ga0450899_004259_808_1425 | 205 |
| 15 | 3300006353 | Ga0075370_10316352 | Ga0075370_103163521 | 206 |
| 16 | 3300031901 | Ga0307406_10111293 | Ga0307406_101112932 | 206 |
| 17 | 3300031911 | Ga0307412_10107337 | Ga0307412_101073372 | 206 |
| 18 | 3300031995 | Ga0307409_100477828 | Ga0307409_1004778282 | 206 |
| 19 | 3300037471 | Ga0395905_0326151 | Ga0395905_0326151_308_928 | 206 |
| 20 | 3300042011 | Ga0439454_007535 | Ga0439454_007535_174_794 | 206 |
| 21 | 3300042128 | Ga0450897_005991 | Ga0450897_005991_421_1041 | 206 |
| 22 | 3300044656 | Ga0466969_0024033 | Ga0466969_0024033_1366_2061 | 206 |
| 23 | 3300044683 | Ga0466965_0006505 | Ga0466965_0006505_2646_3341 | 206 |
| 24 | 3300044684 | Ga0466966_0058201 | Ga0466966_0058201_1209_1904 | 206 |
| 25 | 3300044693 | Ga0466961_0029042 | Ga0466961_0029042_1914_2609 | 206 |
| 26 | 3300044706 | Ga0466964_0060540 | Ga0466964_0060540_201_896 | 206 |
| 27 | 3300044719 | Ga0466971_0013109 | Ga0466971_0013109_2497_3192 | 206 |
| 28 | 3300044735 | Ga0466968_0032551 | Ga0466968_0032551_286_981 | 206 |
| 29 | 3300044842 | Ga0466957_0397337 | Ga0466957_0397337_34_729 | 206 |
| 30 | 3300045049 | Ga0466959_0019003 | Ga0466959_0019003_1462_2157 | 206 |
| 31 | 3300050496 | nmdc:mga07m45_28726_c1 | nmdc:mga07m45_28726_c1_2002_2685 | 206 |
| 32 | 3300061719 | Ga0466962_0027598 | Ga0466962_0027598_1458_2153 | 206 |
| 33 | 3300031649 | Ga0307514_10023730 | Ga0307514_100237302 | 207 |
| 34 | iso_pu_bacteria | 2643221644 | 2644248874 | 207 |
| 35 | 3300013297 | Ga0157378_10237507 | Ga0157378_102375072 | 208 |
| 36 | 3300031251 | Ga0265327_10120131 | Ga0265327_101201312 | 209 |
| 37 | 3300044712 | Ga0453684_0160050 | Ga0453684_0160050_643_1278 | 209 |
| 38 | 3300045051 | Ga0451576_0013521 | Ga0451576_0013521_6349_6984 | 209 |
| 39 | 3300048091 | Ga0495626_0102131 | Ga0495626_0102131_19_666 | 209 |
| 40 | 3300005355 | Ga0070671_100004264 | Ga0070671_1000042647 | 210 |
| 41 | 3300009176 | Ga0105242_10025488 | Ga0105242_100254885 | 210 |
| 42 | 3300009177 | Ga0105248_10001199 | Ga0105248_1000119915 | 210 |
| 43 | 3300010375 | Ga0105239_10702863 | Ga0105239_107028632 | 210 |
| 44 | 3300013296 | Ga0157374_10295712 | Ga0157374_102957122 | 210 |
| 45 | 3300013297 | Ga0157378_10134590 | Ga0157378_101345902 | 210 |
| 46 | 3300021361 | Ga0213872_10000008 | Ga0213872_1000000814 | 210 |
| 47 | 3300025931 | Ga0207644_10011821 | Ga0207644_100118212 | 210 |
| 48 | 3300025941 | Ga0207711_10099282 | Ga0207711_100992822 | 210 |
| 49 | 3300026095 | Ga0207676_10353110 | Ga0207676_103531102 | 210 |
| 50 | 3300035725 | Ga0373947_0294130 | Ga0373947_0294130_277_942 | 210 |
| 51 | 3300039447 | Ga0436361_0757401 | Ga0436361_0757401_40166_40834 | 210 |
| 52 | 3300042007 | Ga0439449_0024846 | Ga0439449_0024846_467_1105 | 210 |
| 53 | 3300042014 | Ga0439457_018178 | Ga0439457_018178_882_1514 | 210 |
| 54 | 3300048904 | Ga0496101_0195009 | Ga0496101_0195009_768_1406 | 210 |
| 55 | 3300048907 | Ga0496104_0416836 | Ga0496104_0416836_193_831 | 210 |
| 56 | 3300048908 | Ga0496105_0049224 | Ga0496105_0049224_1726_2364 | 210 |
| 57 | 3300048909 | Ga0496106_0319603 | Ga0496106_0319603_195_827 | 210 |
| 58 | 3300048913 | Ga0496110_0310437 | Ga0496110_0310437_402_1040 | 210 |
| 59 | 3300048916 | Ga0496113_0076861 | Ga0496113_0076861_1512_2150 | 210 |
| 60 | 3300049515 | Ga0501292_033183 | Ga0501292_033183_37_669 | 210 |
| 61 | 3300049521 | Ga0501298_009500 | Ga0501298_009500_987_1619 | 210 |
| 62 | 3300049653 | Ga0501206_008287 | Ga0501206_008287_161_793 | 210 |
| 63 | 3300049686 | Ga0501257_028997 | Ga0501257_028997_132_764 | 210 |
| 64 | 3300049770 | Ga0501273_020043 | Ga0501273_020043_255_887 | 210 |
| 65 | iso_pu_bacteria | 2585428057 | 2587728395 | 210 |
| 66 | iso_pu_bacteria | 2585428058 | 2587735477 | 210 |
| 67 | iso_pu_bacteria | 2585428062 | 2587758642 | 210 |
| 68 | iso_pu_bacteria | 2588253510 | 2588293745 | 210 |
| 69 | iso_pu_bacteria | 2643221592 | 2643968785 | 210 |
| 70 | iso_pu_bacteria | 2643221625 | 2644139577 | 210 |
| 71 | iso_pu_bacteria | 2643221648 | 2644272390 | 210 |
| 72 | 3300003347 | JGI26128J50194_1000079 | JGI26128J50194_10000794 | 211 |
| 73 | 3300005338 | Ga0068868_100008861 | Ga0068868_1000088619 | 211 |
| 74 | 3300005339 | Ga0070660_100191878 | Ga0070660_1001918781 | 211 |
| 75 | 3300005344 | Ga0070661_100000166 | Ga0070661_1000001662 | 211 |
| 76 | 3300005366 | Ga0070659_100000596 | Ga0070659_10000059623 | 211 |
| 77 | 3300005366 | Ga0070659_100373310 | Ga0070659_1003733101 | 211 |
| 78 | 3300005564 | Ga0070664_100001214 | Ga0070664_1000012141 | 211 |
| 79 | 3300005564 | Ga0070664_100130675 | Ga0070664_1001306752 | 211 |
| 80 | 3300005617 | Ga0068859_100423920 | Ga0068859_1004239202 | 211 |
| 81 | 3300005618 | Ga0068864_100011328 | Ga0068864_10001132811 | 211 |
| 82 | 3300005841 | Ga0068863_100026987 | Ga0068863_1000269873 | 211 |
| 83 | 3300005843 | Ga0068860_100140069 | Ga0068860_1001400692 | 211 |
| 84 | 3300006177 | Ga0075362_10019227 | Ga0075362_100192275 | 211 |
| 85 | 3300006195 | Ga0075366_10000604 | Ga0075366_1000060416 | 211 |
| 86 | 3300006195 | Ga0075366_10005349 | Ga0075366_100053492 | 211 |
| 87 | 3300006195 | Ga0075366_10322788 | Ga0075366_103227881 | 211 |
| 88 | 3300006237 | Ga0097621_100152530 | Ga0097621_1001525302 | 211 |
| 89 | 3300006931 | Ga0097620_100423880 | Ga0097620_1004238802 | 211 |
| 90 | 3300009545 | Ga0105237_10138343 | Ga0105237_101383432 | 211 |
| 91 | 3300011119 | Ga0105246_10212944 | Ga0105246_102129442 | 211 |
| 92 | 3300013306 | Ga0163162_10623067 | Ga0163162_106230672 | 211 |
| 93 | 3300014325 | Ga0163163_10245719 | Ga0163163_102457192 | 211 |
| 94 | 3300025914 | Ga0207671_10482629 | Ga0207671_104826292 | 211 |
| 95 | 3300025920 | Ga0207649_10245493 | Ga0207649_102454932 | 211 |
| 96 | 3300025932 | Ga0207690_10007998 | Ga0207690_100079983 | 211 |
| 97 | 3300025945 | Ga0207679_10069410 | Ga0207679_100694103 | 211 |
| 98 | 3300025945 | Ga0207679_10109017 | Ga0207679_101090172 | 211 |
| 99 | 3300026088 | Ga0207641_10025685 | Ga0207641_100256857 | 211 |
| 100 | 3300027378 | Ga0209981_1004231 | Ga0209981_10042312 | 211 |
| 101 | 3300027395 | Ga0209996_1007205 | Ga0209996_10072052 | 211 |
| 102 | 3300027471 | Ga0209995_1002718 | Ga0209995_10027182 | 211 |
| 103 | 3300027526 | Ga0209968_1004092 | Ga0209968_10040922 | 211 |
| 104 | 3300027695 | Ga0209966_1000078 | Ga0209966_100007819 | 211 |
| 105 | 3300028786 | Ga0307517_10007352 | Ga0307517_100073529 | 211 |
| 106 | 3300031616 | Ga0307508_10013038 | Ga0307508_100130386 | 211 |
| 107 | 3300042121 | Ga0450919_000357 | Ga0450919_000357_1163_1798 | 211 |
| 108 | 3300042122 | Ga0450920_013737 | Ga0450920_013737_565_1200 | 211 |
| 109 | 3300042531 | Ga0450918_001134 | Ga0450918_001134_509_1144 | 211 |
| 110 | 3300044712 | Ga0453684_0023418 | Ga0453684_0023418_6779_7423 | 211 |
| 111 | 3300050489 | nmdc:mga03683_107996_c1 | nmdc:mga03683_107996_c1_115_750 | 211 |
| 112 | 3300050493 | nmdc:mga0k408_307473_c1 | nmdc:mga0k408_307473_c1_216_893 | 211 |
| 113 | 3300050493 | nmdc:mga0k408_79_c1 | nmdc:mga0k408_79_c1_32031_32666 | 211 |
| 114 | 3300050496 | nmdc:mga07m45_279033_c1 | nmdc:mga07m45_279033_c1_113_802 | 211 |
| 115 | 3300003323 | rootH1_10153801 | rootH1_101538012 | 212 |
| 116 | 3300003759 | Ga0055525_1000249 | Ga0055525_100024938 | 212 |
| 117 | 3300009177 | Ga0105248_10432476 | Ga0105248_104324762 | 212 |
| 118 | 3300025226 | Ga0209674_110532 | Ga0209674_1105322 | 212 |
| 119 | 3300025230 | Ga0209563_100013 | Ga0209563_100013856 | 212 |
| 120 | 3300031649 | Ga0307514_10044689 | Ga0307514_100446892 | 212 |
| 121 | 3300041441 | Ga0451787_391274 | Ga0451787_391274_144_785 | 212 |
| 122 | 3300003775 | Ga0055524_1000013 | Ga0055524_1000013206 | 213 |
| 123 | 3300003792 | Ga0055540_1000001 | Ga0055540_100000156 | 213 |
| 124 | 3300003794 | Ga0055531_10002731 | Ga0055531_100027312 | 213 |
| 125 | 3300006195 | Ga0075366_10029290 | Ga0075366_100292904 | 213 |
| 126 | 3300006195 | Ga0075366_10033782 | Ga0075366_100337822 | 213 |
| 127 | 3300006946 | Ga0079104_1000070 | Ga0079104_100007090 | 213 |
| 128 | 3300021361 | Ga0213872_10000044 | Ga0213872_1000004462 | 213 |
| 129 | 3300025263 | Ga0209565_1011421 | Ga0209565_10114212 | 213 |
| 130 | 3300025291 | Ga0209675_1009681 | Ga0209675_10096813 | 213 |
| 131 | 3300025298 | Ga0209050_1000730 | Ga0209050_10007309 | 213 |
| 132 | 3300025299 | Ga0209256_1000061 | Ga0209256_1000061208 | 213 |
| 133 | 3300025303 | Ga0209051_1000018 | Ga0209051_1000018394 | 213 |
| 134 | 3300025304 | Ga0209257_1000461 | Ga0209257_100046157 | 213 |
| 135 | 3300027111 | Ga0209281_1000103 | Ga0209281_100010390 | 213 |
| 136 | 3300039447 | Ga0436361_0886712 | Ga0436361_0886712_56561_57208 | 213 |
| 137 | 3300048917 | Ga0496114_0128038 | Ga0496114_0128038_1074_1715 | 213 |
| 138 | 3300049649 | Ga0501198_000028 | Ga0501198_000028_39935_40576 | 213 |
| 139 | 3300049662 | Ga0501222_000024 | Ga0501222_000024_49851_50492 | 213 |
| 140 | 3300050493 | nmdc:mga0k408_32627_c1 | nmdc:mga0k408_32627_c1_226_906 | 213 |
| 141 | 3300002773 | JGI25152J39213_1018532 | JGI25152J39213_10185322 | 214 |
| 142 | 3300002774 | JGI25150J39212_1019541 | JGI25150J39212_10195412 | 214 |
| 143 | 3300003215 | JGI25153J46596_10003113 | JGI25153J46596_100031131 | 214 |
| 144 | 3300003215 | JGI25153J46596_10003765 | JGI25153J46596_100037651 | 214 |
| 145 | 3300003215 | JGI25153J46596_10008735 | JGI25153J46596_100087353 | 214 |
| 146 | 3300003215 | JGI25153J46596_10009276 | JGI25153J46596_100092765 | 214 |
| 147 | 3300003771 | Ga0055526_1006445 | Ga0055526_10064455 | 214 |
| 148 | 3300003791 | Ga0055530_10021452 | Ga0055530_100214522 | 214 |
| 149 | 3300005262 | Ga0065165_1005447 | Ga0065165_10054475 | 214 |
| 150 | 3300005455 | Ga0070663_100004564 | Ga0070663_1000045644 | 214 |
| 151 | 3300005459 | Ga0068867_100001106 | Ga0068867_10000110617 | 214 |
| 152 | 3300005577 | Ga0068857_100699675 | Ga0068857_1006996751 | 214 |
| 153 | 3300006177 | Ga0075362_10020665 | Ga0075362_100206652 | 214 |
| 154 | 3300006178 | Ga0075367_10121450 | Ga0075367_101214502 | 214 |
| 155 | 3300006186 | Ga0075369_10187655 | Ga0075369_101876551 | 214 |
| 156 | 3300006195 | Ga0075366_10156721 | Ga0075366_101567212 | 214 |
| 157 | 3300006195 | Ga0075366_10188166 | Ga0075366_101881661 | 214 |
| 158 | 3300006195 | Ga0075366_10191789 | Ga0075366_101917892 | 214 |
| 159 | 3300006353 | Ga0075370_10001525 | Ga0075370_100015252 | 214 |
| 160 | 3300006353 | Ga0075370_10003099 | Ga0075370_100030992 | 214 |
| 161 | 3300009148 | Ga0105243_10007836 | Ga0105243_100078365 | 214 |
| 162 | 3300014745 | Ga0157377_10000091 | Ga0157377_1000009140 | 214 |
| 163 | 3300025245 | Ga0207425_1000581 | Ga0207425_100058116 | 214 |
| 164 | 3300025258 | Ga0209129_1000043 | Ga0209129_100004392 | 214 |
| 165 | 3300025258 | Ga0209129_1018269 | Ga0209129_10182692 | 214 |
| 166 | 3300025263 | Ga0209565_1024128 | Ga0209565_10241282 | 214 |
| 167 | 3300025273 | Ga0209673_1044532 | Ga0209673_10445322 | 214 |
| 168 | 3300025273 | Ga0209673_1061652 | Ga0209673_10616521 | 214 |
| 169 | 3300025295 | Ga0209564_1000014 | Ga0209564_1000014199 | 214 |
| 170 | 3300025297 | Ga0209758_1000093 | Ga0209758_1000093126 | 214 |
| 171 | 3300025297 | Ga0209758_1000204 | Ga0209758_100020477 | 214 |
| 172 | 3300025298 | Ga0209050_1002169 | Ga0209050_10021692 | 214 |
| 173 | 3300025303 | Ga0209051_1009498 | Ga0209051_10094982 | 214 |
| 174 | 3300025935 | Ga0207709_10006138 | Ga0207709_100061385 | 214 |
| 175 | 3300026067 | Ga0207678_10003138 | Ga0207678_100031385 | 214 |
| 176 | 3300026089 | Ga0207648_10002366 | Ga0207648_1000236619 | 214 |
| 177 | 3300027876 | Ga0209974_10000352 | Ga0209974_100003527 | 214 |
| 178 | 3300028794 | Ga0307515_10001658 | Ga0307515_1000165823 | 214 |
| 179 | 3300028794 | Ga0307515_10003085 | Ga0307515_1000308528 | 214 |
| 180 | 3300028794 | Ga0307515_10004515 | Ga0307515_100045152 | 214 |
| 181 | 3300028794 | Ga0307515_10033134 | Ga0307515_100331347 | 214 |
| 182 | 3300030522 | Ga0307512_10183486 | Ga0307512_101834862 | 214 |
| 183 | 3300031456 | Ga0307513_10042402 | Ga0307513_100424023 | 214 |
| 184 | 3300031456 | Ga0307513_10276802 | Ga0307513_102768022 | 214 |
| 185 | 3300031507 | Ga0307509_10233213 | Ga0307509_102332132 | 214 |
| 186 | 3300031616 | Ga0307508_10000082 | Ga0307508_1000008288 | 214 |
| 187 | 3300031730 | Ga0307516_10002190 | Ga0307516_100021904 | 214 |
| 188 | 3300031730 | Ga0307516_10002898 | Ga0307516_100028986 | 214 |
| 189 | 3300031730 | Ga0307516_10266339 | Ga0307516_102663392 | 214 |
| 190 | 3300031730 | Ga0307516_10517599 | Ga0307516_105175992 | 214 |
| 191 | 3300032005 | Ga0307411_10430268 | Ga0307411_104302681 | 214 |
| 192 | 3300033179 | Ga0307507_10018450 | Ga0307507_100184507 | 214 |
| 193 | 3300037471 | Ga0395905_0012687 | Ga0395905_0012687_5978_6688 | 214 |
| 194 | 3300041443 | Ga0451789_1298857 | Ga0451789_1298857_128_772 | 214 |
| 195 | 3300041451 | Ga0451791_0628982 | Ga0451791_0628982_368_1012 | 214 |
| 196 | 3300041452 | Ga0451793_1596311 | Ga0451793_1596311_1926_2570 | 214 |
| 197 | 3300041459 | Ga0451800_1303403 | Ga0451800_1303403_3261_3905 | 214 |
| 198 | 3300041463 | Ga0451804_0735751 | Ga0451804_0735751_382_1026 | 214 |
| 199 | 3300041486 | Ga0451807_0789257 | Ga0451807_0789257_239_883 | 214 |
| 200 | 3300041486 | Ga0451807_0881130 | Ga0451807_0881130_247_891 | 214 |
| 201 | 3300041498 | Ga0451841_1256041 | Ga0451841_1256041_166_828 | 214 |
| 202 | 3300041505 | Ga0451849_1186840 | Ga0451849_1186840_37_681 | 214 |
| 203 | 3300041512 | Ga0451853_1713310 | Ga0451853_1713310_120_779 | 214 |
| 204 | 3300041512 | Ga0451853_1731200 | Ga0451853_1731200_1049_1693 | 214 |
| 205 | 3300046460 | Ga0495638_0248245 | Ga0495638_0248245_18_662 | 214 |
| 206 | 3300046492 | Ga0495585_0035205 | Ga0495585_0035205_1194_1877 | 214 |
| 207 | 3300046660 | Ga0495625_0001168 | Ga0495625_0001168_26815_27459 | 214 |
| 208 | 3300046683 | Ga0495658_0154516 | Ga0495658_0154516_566_1210 | 214 |
| 209 | 3300048904 | Ga0496101_0406079 | Ga0496101_0406079_211_858 | 214 |
| 210 | 3300048905 | Ga0496102_0002611 | Ga0496102_0002611_8055_8699 | 214 |
| 211 | 3300048905 | Ga0496102_0034503 | Ga0496102_0034503_2673_3317 | 214 |
| 212 | 3300048917 | Ga0496114_0132696 | Ga0496114_0132696_249_905 | 214 |
| 213 | 3300050489 | nmdc:mga03683_13843_c1 | nmdc:mga03683_13843_c1_2100_2744 | 214 |
| 214 | 3300050490 | nmdc:mga03n38_25315_c1 | nmdc:mga03n38_25315_c1_1472_2116 | 214 |
| 215 | 3300050490 | nmdc:mga03n38_87593_c1 | nmdc:mga03n38_87593_c1_647_1291 | 214 |
| 216 | 3300050493 | nmdc:mga0k408_242278_c1 | nmdc:mga0k408_242278_c1_307_951 | 214 |
| 217 | 3300050493 | nmdc:mga0k408_25429_c1 | nmdc:mga0k408_25429_c1_572_1252 | 214 |
| 218 | 3300050493 | nmdc:mga0k408_75757_c1 | nmdc:mga0k408_75757_c1_1169_1813 | 214 |
| 219 | 3300050494 | nmdc:mga06z11_274646_c1 | nmdc:mga06z11_274646_c1_162_806 | 214 |
| 220 | 3300050494 | nmdc:mga06z11_44685_c1 | nmdc:mga06z11_44685_c1_1409_2053 | 214 |
| 221 | 3300050496 | nmdc:mga07m45_31221_c1 | nmdc:mga07m45_31221_c1_1241_1906 | 214 |
| 222 | 3300050496 | nmdc:mga07m45_33561_c1 | nmdc:mga07m45_33561_c1_722_1366 | 214 |
| 223 | 3300050516 | nmdc:mga0sz30_101608_c1 | nmdc:mga0sz30_101608_c1_76_720 | 214 |
| 224 | 3300053086 | Ga0500578_0001958 | Ga0500578_0001958_10437_11081 | 214 |
| 225 | 3300053088 | Ga0500644_0038755 | Ga0500644_0038755_304_948 | 214 |
| 226 | 3300053090 | Ga0500646_0007390 | Ga0500646_0007390_2001_2645 | 214 |
| 227 | 3300053092 | Ga0500583_0036205 | Ga0500583_0036205_408_1052 | 214 |
| 228 | 3300053093 | Ga0500651_0065244 | Ga0500651_0065244_840_1484 | 214 |
| 229 | 3300053093 | Ga0500651_0247038 | Ga0500651_0247038_380_1024 | 214 |
| 230 | 3300053098 | Ga0500650_0012176 | Ga0500650_0012176_702_1346 | 214 |
| 231 | 3300053108 | Ga0500562_032907 | Ga0500562_032907_496_1140 | 214 |
| 232 | 3300053117 | Ga0500593_000573 | Ga0500593_000573_7234_7878 | 214 |
| 233 | 3300053127 | Ga0500623_060638 | Ga0500623_060638_1033_1677 | 214 |
| 234 | 3300053129 | Ga0500628_005859 | Ga0500628_005859_1121_1765 | 214 |
| 235 | 3300053130 | Ga0500642_0005820 | Ga0500642_0005820_35_679 | 214 |
| 236 | 3300053131 | Ga0500652_001332 | Ga0500652_001332_4554_5198 | 214 |
| 237 | 3300053139 | Ga0500568_0015752 | Ga0500568_0015752_1834_2478 | 214 |
| 238 | 3300053154 | Ga0500619_000321 | Ga0500619_000321_5343_5987 | 214 |
| 239 | 3300053724 | Ga0500570_025358 | Ga0500570_025358_906_1550 | 214 |
| 240 | iso_pu_bacteria | 2919704043 | 2919706914 | 214 |
| 241 | 3300005356 | Ga0070674_100247587 | Ga0070674_1002475872 | 215 |
| 242 | 3300005548 | Ga0070665_100055460 | Ga0070665_1000554605 | 215 |
| 243 | 3300005617 | Ga0068859_100113536 | Ga0068859_1001135362 | 215 |
| 244 | 3300005841 | Ga0068863_100270213 | Ga0068863_1002702132 | 215 |
| 245 | 3300005842 | Ga0068858_100162479 | Ga0068858_1001624792 | 215 |
| 246 | 3300005843 | Ga0068860_100207591 | Ga0068860_1002075912 | 215 |
| 247 | 3300005844 | Ga0068862_100080540 | Ga0068862_1000805403 | 215 |
| 248 | 3300006931 | Ga0097620_100113539 | Ga0097620_1001135392 | 215 |
| 249 | 3300009147 | Ga0114129_10644397 | Ga0114129_106443972 | 215 |
| 250 | 3300009148 | Ga0105243_10081584 | Ga0105243_100815842 | 215 |
| 251 | 3300014325 | Ga0163163_11185262 | Ga0163163_111852622 | 215 |
| 252 | 3300014968 | Ga0157379_10018297 | Ga0157379_100182974 | 215 |
| 253 | 3300025926 | Ga0207659_10401372 | Ga0207659_104013721 | 215 |
| 254 | 3300025935 | Ga0207709_10073180 | Ga0207709_100731803 | 215 |
| 255 | 3300025937 | Ga0207669_10138545 | Ga0207669_101385452 | 215 |
| 256 | 3300025942 | Ga0207689_10360606 | Ga0207689_103606062 | 215 |
| 257 | 3300026088 | Ga0207641_10156342 | Ga0207641_101563422 | 215 |
| 258 | 3300028379 | Ga0268266_11132791 | Ga0268266_111327911 | 215 |
| 259 | 3300028380 | Ga0268265_10008545 | Ga0268265_100085453 | 215 |
| 260 | 3300028381 | Ga0268264_10557547 | Ga0268264_105575472 | 215 |
| 261 | 3300031731 | Ga0307405_10039982 | Ga0307405_100399822 | 215 |
| 262 | 3300031852 | Ga0307410_10034588 | Ga0307410_100345882 | 215 |
| 263 | 3300031903 | Ga0307407_10010312 | Ga0307407_100103125 | 215 |
| 264 | 3300031995 | Ga0307409_101021267 | Ga0307409_1010212672 | 215 |
| 265 | 3300032005 | Ga0307411_10020463 | Ga0307411_100204633 | 215 |
| 266 | 3300032126 | Ga0307415_100051981 | Ga0307415_1000519814 | 215 |
| 267 | 3300041413 | Ga0439465_0066443 | Ga0439465_0066443_351_1001 | 215 |
| 268 | 3300042876 | Ga0451577_0000303 | Ga0451577_0000303_59512_60168 | 215 |
| 269 | 3300044712 | Ga0453684_0000947 | Ga0453684_0000947_35673_36329 | 215 |
| 270 | 3300045051 | Ga0451576_0000880 | Ga0451576_0000880_33975_34631 | 215 |
| 271 | 3300047472 | Ga0495686_0009194 | Ga0495686_0009194_1214_1879 | 215 |
| 272 | 3300050493 | nmdc:mga0k408_98966_c1 | nmdc:mga0k408_98966_c1_709_1365 | 215 |
| 273 | 3300053148 | Ga0500590_017967 | Ga0500590_017967_2855_3508 | 215 |
| 274 | 3300005334 | Ga0068869_100095411 | Ga0068869_1000954112 | 216 |
| 275 | 3300005445 | Ga0070708_100397363 | Ga0070708_1003973632 | 216 |
| 276 | 3300005467 | Ga0070706_100004462 | Ga0070706_1000044625 | 216 |
| 277 | 3300005468 | Ga0070707_100034841 | Ga0070707_1000348415 | 216 |
| 278 | 3300005471 | Ga0070698_100361762 | Ga0070698_1003617622 | 216 |
| 279 | 3300005616 | Ga0068852_100132911 | Ga0068852_1001329112 | 216 |
| 280 | 3300005844 | Ga0068862_101108849 | Ga0068862_1011088491 | 216 |
| 281 | 3300006038 | Ga0075365_10033607 | Ga0075365_100336073 | 216 |
| 282 | 3300006042 | Ga0075368_10008653 | Ga0075368_100086532 | 216 |
| 283 | 3300006048 | Ga0075363_100000955 | Ga0075363_1000009557 | 216 |
| 284 | 3300006177 | Ga0075362_10002335 | Ga0075362_100023352 | 216 |
| 285 | 3300006177 | Ga0075362_10043384 | Ga0075362_100433843 | 216 |
| 286 | 3300006178 | Ga0075367_10000248 | Ga0075367_1000024815 | 216 |
| 287 | 3300006178 | Ga0075367_10002089 | Ga0075367_100020892 | 216 |
| 288 | 3300006186 | Ga0075369_10175797 | Ga0075369_101757972 | 216 |
| 289 | 3300006353 | Ga0075370_10004128 | Ga0075370_100041285 | 216 |
| 290 | 3300006353 | Ga0075370_10012132 | Ga0075370_100121322 | 216 |
| 291 | 3300025910 | Ga0207684_10009321 | Ga0207684_100093219 | 216 |
| 292 | 3300025922 | Ga0207646_10162518 | Ga0207646_101625182 | 216 |
| 293 | 3300027866 | Ga0209813_10001410 | Ga0209813_100014104 | 216 |
| 294 | 3300027866 | Ga0209813_10047404 | Ga0209813_100474042 | 216 |
| 295 | 3300028786 | Ga0307517_10140984 | Ga0307517_101409842 | 216 |
| 296 | 3300031616 | Ga0307508_10106602 | Ga0307508_101066022 | 216 |
| 297 | 3300033180 | Ga0307510_10264326 | Ga0307510_102643262 | 216 |
| 298 | 3300044712 | Ga0453684_0538015 | Ga0453684_0538015_381_1043 | 216 |
| 299 | 3300045051 | Ga0451576_0229615 | Ga0451576_0229615_801_1463 | 216 |
| 300 | 3300046519 | Ga0495632_0022038 | Ga0495632_0022038_2676_3347 | 216 |
| 301 | 3300046528 | Ga0495642_0033010 | Ga0495642_0033010_196_867 | 216 |
| 302 | 3300046528 | Ga0495642_0143193 | Ga0495642_0143193_106_777 | 216 |
| 303 | 3300046530 | Ga0495654_0084833 | Ga0495654_0084833_137_808 | 216 |
| 304 | 3300046542 | Ga0495597_0023929 | Ga0495597_0023929_450_1121 | 216 |
| 305 | 3300046558 | Ga0495633_0165772 | Ga0495633_0165772_200_859 | 216 |
| 306 | 3300046616 | Ga0495668_0054387 | Ga0495668_0054387_1253_1924 | 216 |
| 307 | 3300046648 | Ga0495611_0082720 | Ga0495611_0082720_611_1282 | 216 |
| 308 | 3300046684 | Ga0495669_0123590 | Ga0495669_0123590_301_972 | 216 |
| 309 | 3300046692 | Ga0495671_0070149 | Ga0495671_0070149_148_819 | 216 |
| 310 | 3300046694 | Ga0495649_0002829 | Ga0495649_0002829_7872_8543 | 216 |
| 311 | 3300047443 | Ga0495687_002720 | Ga0495687_002720_10553_11224 | 216 |
| 312 | 3300047443 | Ga0495687_012385 | Ga0495687_012385_1343_2014 | 216 |
| 313 | 3300047446 | Ga0495679_089414 | Ga0495679_089414_95_766 | 216 |
| 314 | 3300050489 | nmdc:mga03683_1212_c1 | nmdc:mga03683_1212_c1_2378_3049 | 216 |
| 315 | 3300050490 | nmdc:mga03n38_593_c1 | nmdc:mga03n38_593_c1_7796_8467 | 216 |
| 316 | 3300050491 | nmdc:mga00v17_229500_c1 | nmdc:mga00v17_229500_c1_303_974 | 216 |
| 317 | 3300050492 | nmdc:mga0yw44_23719_c1 | nmdc:mga0yw44_23719_c1_753_1424 | 216 |
| 318 | 3300050493 | nmdc:mga0k408_53733_c1 | nmdc:mga0k408_53733_c1_185_856 | 216 |
| 319 | 3300050493 | nmdc:mga0k408_82788_c1 | nmdc:mga0k408_82788_c1_1016_1687 | 216 |
| 320 | 3300050494 | nmdc:mga06z11_25939_c1 | nmdc:mga06z11_25939_c1_700_1371 | 216 |
| 321 | 3300050494 | nmdc:mga06z11_2696_c1 | nmdc:mga06z11_2696_c1_3398_4069 | 216 |
| 322 | 3300050495 | nmdc:mga04h51_558_c1 | nmdc:mga04h51_558_c1_6046_6717 | 216 |
| 323 | 3300050495 | nmdc:mga04h51_56703_c1 | nmdc:mga04h51_56703_c1_463_1134 | 216 |
| 324 | 3300050496 | nmdc:mga07m45_438_c1 | nmdc:mga07m45_438_c1_13209_13880 | 216 |
| 325 | 3300050516 | nmdc:mga0sz30_40774_c1 | nmdc:mga0sz30_40774_c1_959_1630 | 216 |
| 326 | 3300053093 | Ga0500651_0060839 | Ga0500651_0060839_863_1534 | 216 |
| 327 | 3300053134 | Ga0500658_0025932 | Ga0500658_0025932_176_847 | 216 |
| 328 | 3300053139 | Ga0500568_0007623 | Ga0500568_0007623_1708_2379 | 216 |
| 329 | 3300009551 | Ga0105238_10379483 | Ga0105238_103794831 | 217 |
| 330 | 3300059424 | Ga0590075_015655 | Ga0590075_015655_423_1103 | 217 |
| 331 | iso_pu_bacteria | 2643221660 | 2644339032 | 217 |
| 332 | 3300021361 | Ga0213872_10011647 | Ga0213872_100116472 | 218 |
| 333 | 3300031251 | Ga0265327_10000374 | Ga0265327_1000037428 | 218 |
| 334 | 3300039447 | Ga0436361_0971257 | Ga0436361_0971257_90_755 | 218 |
| 335 | 3300050489 | nmdc:mga03683_195575_c1 | nmdc:mga03683_195575_c1_38_736 | 218 |
| 336 | 3300021361 | Ga0213872_10013889 | Ga0213872_100138894 | 219 |
| 337 | 3300037471 | Ga0395905_0138667 | Ga0395905_0138667_1398_2084 | 219 |
| 338 | 3300039447 | Ga0436361_0155039 | Ga0436361_0155039_3558_4229 | 219 |
| 339 | 3300003322 | rootL2_10002966 | rootL2_100029667 | 220 |
| 340 | 3300005334 | Ga0068869_100117689 | Ga0068869_1001176892 | 220 |
| 341 | 3300005338 | Ga0068868_100451100 | Ga0068868_1004511001 | 220 |
| 342 | 3300005339 | Ga0070660_100633595 | Ga0070660_1006335951 | 220 |
| 343 | 3300005355 | Ga0070671_100052441 | Ga0070671_1000524412 | 220 |
| 344 | 3300005356 | Ga0070674_100579843 | Ga0070674_1005798431 | 220 |
| 345 | 3300005457 | Ga0070662_100072823 | Ga0070662_1000728232 | 220 |
| 346 | 3300005459 | Ga0068867_100254744 | Ga0068867_1002547442 | 220 |
| 347 | 3300005616 | Ga0068852_100053853 | Ga0068852_1000538533 | 220 |
| 348 | 3300006042 | Ga0075368_10067102 | Ga0075368_100671022 | 220 |
| 349 | 3300006051 | Ga0075364_10012510 | Ga0075364_100125105 | 220 |
| 350 | 3300006177 | Ga0075362_10024026 | Ga0075362_100240262 | 220 |
| 351 | 3300006178 | Ga0075367_10010731 | Ga0075367_100107315 | 220 |
| 352 | 3300006178 | Ga0075367_10075843 | Ga0075367_100758432 | 220 |
| 353 | 3300009093 | Ga0105240_10088123 | Ga0105240_100881232 | 220 |
| 354 | 3300009545 | Ga0105237_10018364 | Ga0105237_1001836411 | 220 |
| 355 | 3300010375 | Ga0105239_10074103 | Ga0105239_100741032 | 220 |
| 356 | 3300025907 | Ga0207645_10031817 | Ga0207645_100318173 | 220 |
| 357 | 3300025914 | Ga0207671_10306167 | Ga0207671_103061671 | 220 |
| 358 | 3300025931 | Ga0207644_10388556 | Ga0207644_103885562 | 220 |
| 359 | 3300025935 | Ga0207709_10030982 | Ga0207709_100309822 | 220 |
| 360 | 3300025942 | Ga0207689_10042634 | Ga0207689_100426343 | 220 |
| 361 | 3300025949 | Ga0207667_10953819 | Ga0207667_109538191 | 220 |
| 362 | 3300025960 | Ga0207651_10784067 | Ga0207651_107840672 | 220 |
| 363 | 3300025986 | Ga0207658_10306007 | Ga0207658_103060072 | 220 |
| 364 | 3300026089 | Ga0207648_10034057 | Ga0207648_100340575 | 220 |
| 365 | 3300026089 | Ga0207648_10082737 | Ga0207648_100827372 | 220 |
| 366 | 3300026116 | Ga0207674_10056935 | Ga0207674_100569356 | 220 |
| 367 | 3300026118 | Ga0207675_100198514 | Ga0207675_1001985142 | 220 |
| 368 | 3300026142 | Ga0207698_10259141 | Ga0207698_102591412 | 220 |
| 369 | 3300031456 | Ga0307513_10010543 | Ga0307513_1001054313 | 220 |
| 370 | 3300031730 | Ga0307516_10360097 | Ga0307516_103600972 | 220 |
| 371 | 3300046522 | Ga0495643_0159889 | Ga0495643_0159889_217_900 | 220 |
| 372 | 3300046542 | Ga0495597_0023224 | Ga0495597_0023224_2057_2740 | 220 |
| 373 | 3300047443 | Ga0495687_000628 | Ga0495687_000628_26566_27249 | 220 |
| 374 | 3300048908 | Ga0496105_0150388 | Ga0496105_0150388_779_1444 | 220 |
| 375 | 3300048924 | Ga0496121_0023384 | Ga0496121_0023384_1634_2299 | 220 |
| 376 | 3300050489 | nmdc:mga03683_37482_c1 | nmdc:mga03683_37482_c1_1197_1880 | 220 |
| 377 | 3300050489 | nmdc:mga03683_76125_c1 | nmdc:mga03683_76125_c1_331_1011 | 220 |
| 378 | 3300050493 | nmdc:mga0k408_159269_c1 | nmdc:mga0k408_159269_c1_433_1116 | 220 |
| 379 | 3300050494 | nmdc:mga06z11_20503_c1 | nmdc:mga06z11_20503_c1_2325_3008 | 220 |
| 380 | 3300050496 | nmdc:mga07m45_42168_c1 | nmdc:mga07m45_42168_c1_1715_2398 | 220 |
| 381 | 3300005445 | Ga0070708_100428296 | Ga0070708_1004282961 | 221 |
| 382 | 3300005563 | Ga0068855_100247887 | Ga0068855_1002478872 | 221 |
| 383 | 3300005618 | Ga0068864_100494558 | Ga0068864_1004945581 | 221 |
| 384 | 3300006178 | Ga0075367_10237994 | Ga0075367_102379942 | 221 |
| 385 | 3300006195 | Ga0075366_10001157 | Ga0075366_100011573 | 221 |
| 386 | 3300006353 | Ga0075370_10000766 | Ga0075370_100007667 | 221 |
| 387 | 3300009101 | Ga0105247_10356288 | Ga0105247_103562882 | 221 |
| 388 | 3300025933 | Ga0207706_10000499 | Ga0207706_1000049939 | 221 |
| 389 | 3300037418 | Ga0395900_0000025 | Ga0395900_0000025_120729_121430 | 221 |
| 390 | 3300037466 | Ga0395898_0000811 | Ga0395898_0000811_9474_10148 | 221 |
| 391 | 3300044658 | Ga0466972_0024741 | Ga0466972_0024741_365_1051 | 221 |
| 392 | 3300044658 | Ga0466972_0095882 | Ga0466972_0095882_551_1249 | 221 |
| 393 | 3300044683 | Ga0466965_0006107 | Ga0466965_0006107_4653_5351 | 221 |
| 394 | 3300044684 | Ga0466966_0041188 | Ga0466966_0041188_2115_2783 | 221 |
| 395 | 3300044693 | Ga0466961_0002147 | Ga0466961_0002147_1333_2001 | 221 |
| 396 | 3300044694 | Ga0466963_0002684 | Ga0466963_0002684_6239_6907 | 221 |
| 397 | 3300044706 | Ga0466964_0007187 | Ga0466964_0007187_1864_2532 | 221 |
| 398 | 3300044706 | Ga0466964_0027777 | Ga0466964_0027777_1133_1801 | 221 |
| 399 | 3300044719 | Ga0466971_0121205 | Ga0466971_0121205_310_978 | 221 |
| 400 | 3300044765 | Ga0466970_0003278 | Ga0466970_0003278_5909_6577 | 221 |
| 401 | 3300044842 | Ga0466957_0004566 | Ga0466957_0004566_361_1029 | 221 |
| 402 | 3300045049 | Ga0466959_0000041 | Ga0466959_0000041_12344_13012 | 221 |
| 403 | 3300045976 | Ga0466967_0033411 | Ga0466967_0033411_3249_3917 | 221 |
| 404 | 3300050493 | nmdc:mga0k408_31112_c1 | nmdc:mga0k408_31112_c1_2253_2939 | 221 |
| 405 | 3300050496 | nmdc:mga07m45_126_c1 | nmdc:mga07m45_126_c1_25792_26478 | 221 |
| 406 | 3300050496 | nmdc:mga07m45_28514_c1 | nmdc:mga07m45_28514_c1_693_1379 | 221 |
| 407 | 3300005328 | Ga0070676_10004911 | Ga0070676_100049117 | 222 |
| 408 | 3300005330 | Ga0070690_100015896 | Ga0070690_1000158961 | 222 |
| 409 | 3300005331 | Ga0070670_100080568 | Ga0070670_1000805683 | 222 |
| 410 | 3300005334 | Ga0068869_100116098 | Ga0068869_1001160982 | 222 |
| 411 | 3300005354 | Ga0070675_100188113 | Ga0070675_1001881131 | 222 |
| 412 | 3300005456 | Ga0070678_100926475 | Ga0070678_1009264751 | 222 |
| 413 | 3300005457 | Ga0070662_100081066 | Ga0070662_1000810662 | 222 |
| 414 | 3300005543 | Ga0070672_100163725 | Ga0070672_1001637252 | 222 |
| 415 | 3300005563 | Ga0068855_100709698 | Ga0068855_1007096982 | 222 |
| 416 | 3300006881 | Ga0068865_100043017 | Ga0068865_1000430174 | 222 |
| 417 | 3300009098 | Ga0105245_10212485 | Ga0105245_102124852 | 222 |
| 418 | 3300011119 | Ga0105246_10117958 | Ga0105246_101179582 | 222 |
| 419 | 3300013308 | Ga0157375_10014574 | Ga0157375_100145745 | 222 |
| 420 | 3300025907 | Ga0207645_10001536 | Ga0207645_1000153621 | 222 |
| 421 | 3300025908 | Ga0207643_10026228 | Ga0207643_100262282 | 222 |
| 422 | 3300025927 | Ga0207687_10368215 | Ga0207687_103682152 | 222 |
| 423 | 3300025934 | Ga0207686_10041390 | Ga0207686_100413904 | 222 |
| 424 | 3300025938 | Ga0207704_10003303 | Ga0207704_100033034 | 222 |
| 425 | 3300025940 | Ga0207691_10011060 | Ga0207691_100110606 | 222 |
| 426 | 3300025941 | Ga0207711_10646455 | Ga0207711_106464552 | 222 |
| 427 | 3300025942 | Ga0207689_10015550 | Ga0207689_100155507 | 222 |
| 428 | 3300025942 | Ga0207689_10103112 | Ga0207689_101031122 | 222 |
| 429 | 3300025960 | Ga0207651_10302511 | Ga0207651_103025112 | 222 |
| 430 | 3300026121 | Ga0207683_10601000 | Ga0207683_106010001 | 222 |
| 431 | 3300031649 | Ga0307514_10001022 | Ga0307514_1000102224 | 222 |
| 432 | 3300031730 | Ga0307516_10117316 | Ga0307516_101173162 | 222 |
| 433 | 3300039447 | Ga0436361_0609590 | Ga0436361_0609590_7209_7895 | 222 |
| 434 | 3300042012 | Ga0439455_0011499 | Ga0439455_0011499_1007_1678 | 222 |
| 435 | 3300042157 | Ga0439458_0050501 | Ga0439458_0050501_14_685 | 222 |
| 436 | 3300006358 | Ga0068871_100708154 | Ga0068871_1007081542 | 223 |
| 437 | 3300013308 | Ga0157375_10672776 | Ga0157375_106727762 | 223 |
| 438 | 3300025900 | Ga0207710_10064937 | Ga0207710_100649372 | 223 |
| 439 | 3300028379 | Ga0268266_10018969 | Ga0268266_100189692 | 223 |
| 440 | 3300044656 | Ga0466969_0000100 | Ga0466969_0000100_23930_24634 | 223 |
| 441 | 3300045049 | Ga0466959_0016403 | Ga0466959_0016403_409_1113 | 223 |
| 442 | 3300046517 | Ga0495630_0071863 | Ga0495630_0071863_1794_2471 | 223 |
| 443 | 3300046519 | Ga0495632_0260598 | Ga0495632_0260598_62_739 | 223 |
| 444 | 3300046690 | Ga0495624_0024912 | Ga0495624_0024912_1962_2639 | 223 |
| 445 | 3300047673 | Ga0495593_0052945 | Ga0495593_0052945_1396_2073 | 223 |
| 446 | 3300049127 | Ga0501306_006178 | Ga0501306_006178_27_713 | 223 |
| 447 | 3300049129 | Ga0501309_002339 | Ga0501309_002339_1020_1706 | 223 |
| 448 | 3300031911 | Ga0307412_10507324 | Ga0307412_105073242 | 224 |
| 449 | 3300037471 | Ga0395905_0012243 | Ga0395905_0012243_3068_3760 | 224 |
| 450 | 3300041410 | Ga0439461_0016736 | Ga0439461_0016736_516_1202 | 224 |
| 451 | 3300041997 | Ga0439431_0004245 | Ga0439431_0004245_1215_1901 | 224 |
| 452 | 3300042435 | Ga0439434_0017482 | Ga0439434_0017482_1173_1859 | 224 |
| 453 | 3300042532 | Ga0450893_0036380 | Ga0450893_0036380_37_723 | 224 |
| 454 | 3300048927 | Ga0496124_0000086 | Ga0496124_0000086_90858_91568 | 224 |
| 455 | 3300048928 | Ga0496125_0015950 | Ga0496125_0015950_1029_1739 | 224 |
| 456 | 3300003792 | Ga0055540_1011583 | Ga0055540_10115833 | 226 |
| 457 | 3300013102 | Ga0157371_10207005 | Ga0157371_102070051 | 226 |
| 458 | 3300013306 | Ga0163162_10348872 | Ga0163162_103488722 | 226 |
| 459 | 3300025303 | Ga0209051_1020564 | Ga0209051_10205642 | 226 |
| 460 | 3300028794 | Ga0307515_10038935 | Ga0307515_100389352 | 226 |
| 461 | 3300031507 | Ga0307509_10067221 | Ga0307509_100672212 | 226 |
| 462 | 3300031730 | Ga0307516_10000286 | Ga0307516_100002863 | 226 |
| 463 | 3300042876 | Ga0451577_0003093 | Ga0451577_0003093_1535_2239 | 226 |
| 464 | 3300048912 | Ga0496109_1007784 | Ga0496109_1007784_39_719 | 226 |
| 465 | 3300002705 | JGI25156J39149_1015859 | JGI25156J39149_10158592 | 227 |
| 466 | 3300002738 | JGI25154J39366_1000722 | JGI25154J39366_100072215 | 227 |
| 467 | 3300002741 | JGI25157J39369_1000018 | JGI25157J39369_1000018150 | 227 |
| 468 | 3300002772 | JGI25164J39214_1003494 | JGI25164J39214_10034942 | 227 |
| 469 | 3300003323 | rootH1_10004484 | rootH1_100044844 | 227 |
| 470 | 3300003752 | Ga0055539_1000283 | Ga0055539_100028311 | 227 |
| 471 | 3300003752 | Ga0055539_1001803 | Ga0055539_10018032 | 227 |
| 472 | 3300003756 | Ga0055533_1000103 | Ga0055533_100010392 | 227 |
| 473 | 3300003759 | Ga0055525_1001205 | Ga0055525_10012052 | 227 |
| 474 | 3300003761 | Ga0055535_1000822 | Ga0055535_10008227 | 227 |
| 475 | 3300003763 | Ga0055529_1000198 | Ga0055529_100019859 | 227 |
| 476 | 3300005327 | Ga0070658_10371771 | Ga0070658_103717712 | 227 |
| 477 | 3300005329 | Ga0070683_100256908 | Ga0070683_1002569081 | 227 |
| 478 | 3300005366 | Ga0070659_100302881 | Ga0070659_1003028812 | 227 |
| 479 | 3300005459 | Ga0068867_100360480 | Ga0068867_1003604802 | 227 |
| 480 | 3300005563 | Ga0068855_100003105 | Ga0068855_10000310515 | 227 |
| 481 | 3300005563 | Ga0068855_100043517 | Ga0068855_1000435172 | 227 |
| 482 | 3300005577 | Ga0068857_100003053 | Ga0068857_1000030535 | 227 |
| 483 | 3300005578 | Ga0068854_100008624 | Ga0068854_1000086242 | 227 |
| 484 | 3300005614 | Ga0068856_100005614 | Ga0068856_1000056144 | 227 |
| 485 | 3300009093 | Ga0105240_10048445 | Ga0105240_100484452 | 227 |
| 486 | 3300009551 | Ga0105238_10768369 | Ga0105238_107683692 | 227 |
| 487 | 3300010375 | Ga0105239_10039994 | Ga0105239_100399942 | 227 |
| 488 | 3300013105 | Ga0157369_10008425 | Ga0157369_1000842512 | 227 |
| 489 | 3300015262 | Ga0182007_10028861 | Ga0182007_100288611 | 227 |
| 490 | 3300025226 | Ga0209674_100003 | Ga0209674_100003213 | 227 |
| 491 | 3300025230 | Ga0209563_100141 | Ga0209563_10014161 | 227 |
| 492 | 3300025231 | Ga0207427_100546 | Ga0207427_10054616 | 227 |
| 493 | 3300025242 | Ga0209258_100044 | Ga0209258_100044116 | 227 |
| 494 | 3300025246 | Ga0209646_1000067 | Ga0209646_100006784 | 227 |
| 495 | 3300025250 | Ga0209026_1000033 | Ga0209026_1000033146 | 227 |
| 496 | 3300025253 | Ga0209677_100133 | Ga0209677_10013342 | 227 |
| 497 | 3300025253 | Ga0209677_100196 | Ga0209677_10019634 | 227 |
| 498 | 3300025253 | Ga0209677_102270 | Ga0209677_1022704 | 227 |
| 499 | 3300025256 | Ga0209759_1000024 | Ga0209759_1000024146 | 227 |
| 500 | 3300025256 | Ga0209759_1004001 | Ga0209759_10040013 | 227 |
| 501 | 3300025256 | Ga0209759_1005519 | Ga0209759_10055192 | 227 |
| 502 | 3300025272 | Ga0209455_1000048 | Ga0209455_1000048116 | 227 |
| 503 | 3300025914 | Ga0207671_10317904 | Ga0207671_103179042 | 227 |
| 504 | 3300025919 | Ga0207657_10044736 | Ga0207657_100447365 | 227 |
| 505 | 3300025919 | Ga0207657_10046860 | Ga0207657_100468602 | 227 |
| 506 | 3300025924 | Ga0207694_10006906 | Ga0207694_100069067 | 227 |
| 507 | 3300025924 | Ga0207694_10362390 | Ga0207694_103623902 | 227 |
| 508 | 3300025927 | Ga0207687_10177592 | Ga0207687_101775922 | 227 |
| 509 | 3300025932 | Ga0207690_10358448 | Ga0207690_103584482 | 227 |
| 510 | 3300025944 | Ga0207661_10045411 | Ga0207661_100454112 | 227 |
| 511 | 3300025945 | Ga0207679_10690624 | Ga0207679_106906241 | 227 |
| 512 | 3300025949 | Ga0207667_10015058 | Ga0207667_100150582 | 227 |
| 513 | 3300025949 | Ga0207667_10241082 | Ga0207667_102410822 | 227 |
| 514 | 3300025949 | Ga0207667_10436667 | Ga0207667_104366672 | 227 |
| 515 | 3300025981 | Ga0207640_10009925 | Ga0207640_100099254 | 227 |
| 516 | 3300026078 | Ga0207702_10001078 | Ga0207702_1000107815 | 227 |
| 517 | 3300026116 | Ga0207674_10005131 | Ga0207674_100051315 | 227 |
| 518 | 3300028666 | Ga0265336_10000053 | Ga0265336_1000005338 | 227 |
| 519 | 3300029957 | Ga0265324_10001024 | Ga0265324_1000102410 | 227 |
| 520 | 3300030521 | Ga0307511_10086935 | Ga0307511_100869352 | 227 |
| 521 | 3300035691 | Ga0373931_0007609 | Ga0373931_0007609_3205_3888 | 227 |
| 522 | 3300035691 | Ga0373931_0155635 | Ga0373931_0155635_573_1256 | 227 |
| 523 | 3300038443 | Ga0395901_0013605 | Ga0395901_0013605_7074_7760 | 227 |
| 524 | 3300039437 | Ga0436365_1861796 | Ga0436365_1861796_25_708 | 227 |
| 525 | 3300046506 | Ga0495583_0000159 | Ga0495583_0000159_25577_26260 | 227 |
| 526 | 3300046507 | Ga0495606_0003437 | Ga0495606_0003437_5519_6202 | 227 |
| 527 | 3300046616 | Ga0495668_0028187 | Ga0495668_0028187_59_742 | 227 |
| 528 | 3300046660 | Ga0495625_0011185 | Ga0495625_0011185_2574_3257 | 227 |
| 529 | 3300046692 | Ga0495671_0234591 | Ga0495671_0234591_59_742 | 227 |
| 530 | 3300046694 | Ga0495649_0001310 | Ga0495649_0001310_7206_7889 | 227 |
| 531 | 3300046794 | Ga0495589_0006046 | Ga0495589_0006046_303_986 | 227 |
| 532 | 3300048903 | Ga0496100_0107039 | Ga0496100_0107039_225_911 | 227 |
| 533 | 3300048917 | Ga0496114_0379298 | Ga0496114_0379298_332_1015 | 227 |
| 534 | 3300048918 | Ga0496115_0607802 | Ga0496115_0607802_132_815 | 227 |
| 535 | 3300048929 | Ga0496126_0365800 | Ga0496126_0365800_218_901 | 227 |
| 536 | 3300050493 | nmdc:mga0k408_15903_c1 | nmdc:mga0k408_15903_c1_97_780 | 227 |
| 537 | 3300053080 | Ga0500635_0000035 | Ga0500635_0000035_73879_74562 | 227 |
| 538 | 3300053136 | Ga0500559_0006966 | Ga0500559_0006966_2296_2979 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f9z-assembly2.cif.gz_D | complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima | 0.8585 | 54 | 194 |
| 2f9z-assembly2.cif.gz_D | complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima | 0.7847 | 54 | 194 |
| 1z18-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.6759 | 135 | 175 |
| 1xfj-assembly1.cif.gz_A | crystal structure of protein cc_0490 from caulobacter crescentus, pfam duf152 | 0.6737 | 62 | 173 |
| 6n4y-assembly4.cif.gz_D | metabotropic glutamate receptor 5 extracellular domain with nb43 | 0.6594 | 135 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f9zD00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; | 0.8585 | 54 | 194 | 3.30.1330.200 |
| af_Q8IV20_177_430_3.60.140.10 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.8069 | 62 | 139 | 3.60.140.10 |
| 2f9zD00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; | 0.7847 | 54 | 194 | 3.30.1330.200 |
| 3hutA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.7457 | 135 | 175 | 3.40.50.2300 |
| af_Q7KIS4_37_307_3.30.1330.200 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; | 0.708 | 54 | 190 | 3.30.1330.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A850QA06-F1-model_v4 | Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) | 0.9387 | 54 | 198 |
GO:0006935
GO:0050568 |
| AF-A0A7Y2TUH6-F1-model_v4 | Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) | 0.9299 | 54 | 198 |
GO:0006935
GO:0050568 |
| AF-A0A352V8Y5-F1-model_v4 | Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) | 0.9283 | 54 | 197 |
GO:0006935
GO:0050568 |
| AF-A0A4Q4BQ35-F1-model_v4 | Chemotaxis protein CheD | 0.9271 | 64 | 198 |
GO:0006935
GO:0050568 |
| AF-A0A4Y1YNR2-F1-model_v4 | Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) | 0.9217 | 35 | 199 |
GO:0006935
GO:0050568 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar