F461028

General Info

Members Datasets Scaffolds Average Seq Length
538 326 528 219

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0012687|Ga0395905_0012687_5978_6688
Length 236
Sequence MSGFSPQYPFQDEPTLADKKHIMALASTLAPPASSRLDHLKAQPRKPGEASFFFYDAHFRNDAVKILPGEYFVYNEDILIMTTLGSCIAACLWDRTARVGGMNHFMLPDGAGDSGRYGSYAMELLINEMMKRGASRMNMEAKVFGGGQVVAGMNSLNVGERNTSFVIDYLKMERIPILSKDVLDIYPRKVCFLPASGKAMVKRLAPANAEALVAQDRAAQQRAVPASTGGGSVDLF

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
11 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
12 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
108 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
109 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
160 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
174 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
203 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
204 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
205 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
206 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
207 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
217 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
218 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
219 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
220 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
221 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
222 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
223 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
226 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
245 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
264 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
281 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
286 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
292 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
293 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
294 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
295 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
307 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
308 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
309 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
310 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
311 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
312 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
313 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
314 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
315 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
316 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
317 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
318 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
319 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
320 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
321 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
322 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
323 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
324 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
325 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.37
Isolates 1.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.14
Nodule 0.37
Rhizoplane 4.46
Rhizosphere 57.81
Stem 0
Stem Tuber 0
Unclassified 10.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1015859 3300002705 Bacteria 1489
2 JGI25154J39366_1000722 3300002738 Bacteria 14934
3 JGI25157J39369_1000018 3300002741 Bacteria 177410
4 JGI25164J39214_1003494 3300002772 Bacteria 1982
5 JGI25152J39213_1018532 3300002773 Bacteria 1284
6 JGI25150J39212_1019541 3300002774 Bacteria 1059
7 JGI25153J46596_10003113 3300003215 Bacteria 9354
8 JGI25153J46596_10003765 3300003215 Bacteria 8374
9 JGI25153J46596_10008735 3300003215 Bacteria 4801
10 JGI25153J46596_10009276 3300003215 Bacteria 4598
11 rootL2_10002966 3300003322 Bacteria 6484
12 rootH1_10004484 3300003323 Bacteria 4093
13 rootH1_10153801 3300003323 Bacteria 1202
14 JGI26128J50194_1000079 3300003347 Bacteria 3603
15 Ga0055539_1000283 3300003752 Bacteria 28988
16 Ga0055539_1001803 3300003752 Bacteria 3664
17 Ga0055533_1000103 3300003756 Bacteria 107860
18 Ga0055525_1000249 3300003759 Bacteria 53433
19 Ga0055525_1001205 3300003759 Bacteria 5755
20 Ga0055535_1000822 3300003761 Bacteria 22272
21 Ga0055529_1000198 3300003763 Bacteria 81554
22 Ga0055526_1006445 3300003771 Bacteria 6364
23 Ga0055524_1000013 3300003775 Bacteria 259850
24 Ga0055530_10021452 3300003791 Bacteria 1903
25 Ga0055540_1000001 3300003792 Bacteria 466834
26 Ga0055540_1011583 3300003792 Bacteria 2831
27 Ga0055531_10002731 3300003794 Bacteria 11607
28 Ga0065165_1005447 3300005262 Bacteria 7148
29 Ga0070658_10371771 3300005327 Bacteria 1225
30 Ga0070676_10004911 3300005328 Bacteria 7086
31 Ga0070683_100256908 3300005329 Bacteria 1662
32 Ga0070690_100015896 3300005330 Bacteria 4497
33 Ga0070670_100080568 3300005331 Bacteria 2798
34 Ga0068869_100095411 3300005334 Bacteria 2244
35 Ga0068869_100116098 3300005334 Bacteria 2042
36 Ga0068869_100117689 3300005334 Bacteria 2029
37 Ga0068868_100008861 3300005338 Bacteria 7208
38 Ga0068868_100451100 3300005338 Bacteria 1119
39 Ga0070660_100191878 3300005339 Bacteria 1655
40 Ga0070660_100633595 3300005339 Bacteria 895
41 Ga0070661_100000166 3300005344 Bacteria 53989
42 Ga0070675_100188113 3300005354 Bacteria 1788
43 Ga0070671_100004264 3300005355 Bacteria 11312
44 Ga0070671_100052441 3300005355 Bacteria 3391
45 Ga0070674_100247587 3300005356 Bacteria 1398
46 Ga0070674_100579843 3300005356 Bacteria 945
47 Ga0070659_100000596 3300005366 Bacteria 26453
48 Ga0070659_100302881 3300005366 Bacteria 1333
49 Ga0070659_100373310 3300005366 Bacteria 1200
50 Ga0070708_100397363 3300005445 Bacteria 1300
51 Ga0070708_100428296 3300005445 Bacteria 1248
52 Ga0070663_100004564 3300005455 Bacteria 8157
53 Ga0070678_100926475 3300005456 Bacteria 798
54 Ga0070662_100072823 3300005457 Bacteria 2537
55 Ga0070662_100081066 3300005457 Bacteria 2417
56 Ga0068867_100001106 3300005459 Bacteria 18425
57 Ga0068867_100254744 3300005459 Bacteria 1429
58 Ga0068867_100360480 3300005459 Bacteria 1216
59 Ga0070706_100004462 3300005467 Bacteria 13518
60 Ga0070707_100034841 3300005468 Bacteria 4801
61 Ga0070698_100361762 3300005471 Bacteria 1383
62 Ga0070672_100163725 3300005543 Bacteria 1847
63 Ga0070665_100055460 3300005548 Bacteria 3974
64 Ga0068855_100003105 3300005563 Bacteria 20329
65 Ga0068855_100008362 3300005563 Bacteria 12514
66 Ga0068855_100043517 3300005563 Bacteria 5319
67 Ga0068855_100247887 3300005563 Bacteria 1987
68 Ga0068855_100709698 3300005563 Bacteria 1075
69 Ga0070664_100001214 3300005564 Bacteria 20557
70 Ga0070664_100130675 3300005564 Bacteria 2206
71 Ga0068857_100003053 3300005577 Bacteria 13849
72 Ga0068857_100699675 3300005577 Bacteria 963
73 Ga0068854_100008624 3300005578 Bacteria 6562
74 Ga0068856_100005614 3300005614 Bacteria 12341
75 Ga0068852_100053853 3300005616 Bacteria 3465
76 Ga0068852_100109476 3300005616 Bacteria 2509
77 Ga0068852_100132911 3300005616 Bacteria 2294
78 Ga0068859_100113536 3300005617 Bacteria 2773
79 Ga0068859_100423920 3300005617 Bacteria 1427
80 Ga0068864_100011328 3300005618 Bacteria 7369
81 Ga0068864_100494558 3300005618 Bacteria 1176
82 Ga0068863_100026987 3300005841 Bacteria 5477
83 Ga0068863_100270213 3300005841 Bacteria 1646
84 Ga0068858_100162479 3300005842 Bacteria 2103
85 Ga0068860_100140069 3300005843 Bacteria 2325
86 Ga0068860_100207591 3300005843 Bacteria 1900
87 Ga0068862_100080540 3300005844 Bacteria 2824
88 Ga0068862_101108849 3300005844 Bacteria 787
89 Ga0075365_10033607 3300006038 Bacteria 3307
90 Ga0075368_10008653 3300006042 Bacteria 3635
91 Ga0075368_10067102 3300006042 Bacteria 1443
92 Ga0075363_100000955 3300006048 Bacteria 10269
93 Ga0075364_10012510 3300006051 Bacteria 5194
94 Ga0075362_10002335 3300006177 Bacteria 6348
95 Ga0075362_10019227 3300006177 Bacteria 2838
96 Ga0075362_10020665 3300006177 Bacteria 2754
97 Ga0075362_10024026 3300006177 Bacteria 2583
98 Ga0075362_10043384 3300006177 Bacteria 1991
99 Ga0075367_10000248 3300006178 Bacteria 18367
100 Ga0075367_10002089 3300006178 Bacteria 8953
101 Ga0075367_10010731 3300006178 Bacteria 4824
102 Ga0075367_10075843 3300006178 Bacteria 2028
103 Ga0075367_10121450 3300006178 Bacteria 1610
104 Ga0075367_10237994 3300006178 Bacteria 1140
105 Ga0075369_10175797 3300006186 Bacteria 984
106 Ga0075369_10187655 3300006186 Bacteria 952
107 Ga0075366_10000604 3300006195 Bacteria 16839
108 Ga0075366_10001157 3300006195 Bacteria 13049
109 Ga0075366_10005349 3300006195 Bacteria 6959
110 Ga0075366_10029290 3300006195 Bacteria 3235
111 Ga0075366_10033782 3300006195 Bacteria 3014
112 Ga0075366_10156721 3300006195 Bacteria 1379
113 Ga0075366_10188166 3300006195 Bacteria 1254
114 Ga0075366_10191789 3300006195 Bacteria 1242
115 Ga0075366_10322788 3300006195 Bacteria 946
116 Ga0097621_100152530 3300006237 Bacteria 1982
117 Ga0075370_10000766 3300006353 Bacteria 12858
118 Ga0075370_10001525 3300006353 Bacteria 10127
119 Ga0075370_10003099 3300006353 Bacteria 7848
120 Ga0075370_10004128 3300006353 Bacteria 6999
121 Ga0075370_10012132 3300006353 Bacteria 4547
122 Ga0075370_10316352 3300006353 Bacteria 929
123 Ga0068871_100708154 3300006358 Bacteria 923
124 Ga0068865_100043017 3300006881 Bacteria 3084
125 Ga0097620_100113539 3300006931 Bacteria 2773
126 Ga0097620_100423880 3300006931 Bacteria 1427
127 Ga0079104_1000070 3300006946 Bacteria 153879
128 Ga0105240_10048445 3300009093 Bacteria 5370
129 Ga0105240_10088123 3300009093 Bacteria 3799
130 Ga0105245_10212485 3300009098 Bacteria 1863
131 Ga0105247_10356288 3300009101 Bacteria 1030
132 Ga0114129_10644397 3300009147 Bacteria 1368
133 Ga0105243_10007836 3300009148 Bacteria 8211
134 Ga0105243_10081584 3300009148 Bacteria 2641
135 Ga0105242_10025488 3300009176 Bacteria 4681
136 Ga0105248_10001199 3300009177 Bacteria 28958
137 Ga0105248_10432476 3300009177 Bacteria 1482
138 Ga0105237_10018364 3300009545 Bacteria 7237
139 Ga0105237_10138343 3300009545 Bacteria 2430
140 Ga0105238_10379483 3300009551 Bacteria 1405
141 Ga0105238_10768369 3300009551 Bacteria 978
142 Ga0105239_10039994 3300010375 Bacteria 5137
143 Ga0105239_10074103 3300010375 Bacteria 3743
144 Ga0105239_10702863 3300010375 Bacteria 1156
145 Ga0105246_10117958 3300011119 Bacteria 1962
146 Ga0105246_10212944 3300011119 Bacteria 1509
147 Ga0157371_10207005 3300013102 Bacteria 1407
148 Ga0157369_10008425 3300013105 Bacteria 11825
149 Ga0157374_10295712 3300013296 Bacteria 1601
150 Ga0157378_10134590 3300013297 Bacteria 2290
151 Ga0157378_10237507 3300013297 Bacteria 1740
152 Ga0163162_10348872 3300013306 Bacteria 1613
153 Ga0163162_10623067 3300013306 Bacteria 1204
154 Ga0157375_10014574 3300013308 Bacteria 7019
155 Ga0157375_10672776 3300013308 Bacteria 1190
156 Ga0163163_10245719 3300014325 Bacteria 1840
157 Ga0163163_11185262 3300014325 Bacteria 826
158 Ga0157377_10000091 3300014745 Bacteria 66087
159 Ga0157379_10018297 3300014968 Bacteria 6175
160 Ga0182007_10028861 3300015262 Bacteria 1903
161 Ga0213872_10000008 3300021361 Bacteria 226283
162 Ga0213872_10000044 3300021361 Bacteria 114843
163 Ga0213872_10011647 3300021361 Bacteria 4159
164 Ga0213872_10013889 3300021361 Bacteria 3765
165 Ga0209674_100003 3300025226 Bacteria 2196646
166 Ga0209674_110532 3300025226 Bacteria 980
167 Ga0209563_100013 3300025230 Bacteria 941463
168 Ga0209563_100141 3300025230 Bacteria 79513
169 Ga0207427_100546 3300025231 Bacteria 19253
170 Ga0209258_100044 3300025242 Bacteria 376336
171 Ga0207425_1000581 3300025245 Bacteria 21349
172 Ga0209646_1000067 3300025246 Bacteria 241595
173 Ga0209026_1000033 3300025250 Bacteria 318512
174 Ga0209677_100133 3300025253 Bacteria 69526
175 Ga0209677_100196 3300025253 Bacteria 48682
176 Ga0209677_102270 3300025253 Bacteria 7431
177 Ga0209759_1000024 3300025256 Bacteria 318512
178 Ga0209759_1004001 3300025256 Bacteria 5649
179 Ga0209759_1005519 3300025256 Bacteria 4410
180 Ga0209129_1000043 3300025258 Bacteria 298978
181 Ga0209129_1018269 3300025258 Bacteria 1351
182 Ga0209565_1011421 3300025263 Bacteria 2159
183 Ga0209565_1024128 3300025263 Bacteria 1241
184 Ga0209455_1000048 3300025272 Bacteria 376260
185 Ga0209673_1044532 3300025273 Bacteria 1227
186 Ga0209673_1061652 3300025273 Bacteria 934
187 Ga0209675_1009681 3300025291 Bacteria 3379
188 Ga0209564_1000014 3300025295 Bacteria 621501
189 Ga0209758_1000093 3300025297 Bacteria 241169
190 Ga0209758_1000204 3300025297 Bacteria 131754
191 Ga0209050_1000730 3300025298 Bacteria 47896
192 Ga0209050_1002169 3300025298 Bacteria 17761
193 Ga0209256_1000061 3300025299 Bacteria 260890
194 Ga0209051_1000018 3300025303 Bacteria 527061
195 Ga0209051_1009498 3300025303 Bacteria 5008
196 Ga0209051_1020564 3300025303 Bacteria 2837
197 Ga0209257_1000461 3300025304 Bacteria 75360
198 Ga0207710_10064937 3300025900 Bacteria 1663
199 Ga0207645_10001536 3300025907 Bacteria 18872
200 Ga0207645_10031817 3300025907 Bacteria 3392
201 Ga0207643_10026228 3300025908 Bacteria 3225
202 Ga0207684_10009321 3300025910 Bacteria 8674
203 Ga0207671_10306167 3300025914 Bacteria 1256
204 Ga0207671_10317904 3300025914 Bacteria 1232
205 Ga0207671_10482629 3300025914 Bacteria 988
206 Ga0207657_10044736 3300025919 Bacteria 3890
207 Ga0207657_10046860 3300025919 Bacteria 3785
208 Ga0207649_10245493 3300025920 Bacteria 1287
209 Ga0207646_10162518 3300025922 Bacteria 2015
210 Ga0207694_10006906 3300025924 Bacteria 8617
211 Ga0207694_10362390 3300025924 Bacteria 1201
212 Ga0207659_10401372 3300025926 Bacteria 1147
213 Ga0207687_10177592 3300025927 Bacteria 1647
214 Ga0207687_10368215 3300025927 Bacteria 1174
215 Ga0207644_10011821 3300025931 Bacteria 5781
216 Ga0207644_10388556 3300025931 Bacteria 1139
217 Ga0207690_10007998 3300025932 Bacteria 6279
218 Ga0207690_10358448 3300025932 Bacteria 1155
219 Ga0207706_10000499 3300025933 Bacteria 41776
220 Ga0207686_10041390 3300025934 Bacteria 2809
221 Ga0207709_10006138 3300025935 Bacteria 6770
222 Ga0207709_10030982 3300025935 Bacteria 3118
223 Ga0207709_10073180 3300025935 Bacteria 2183
224 Ga0207669_10138545 3300025937 Bacteria 1685
225 Ga0207704_10003303 3300025938 Bacteria 7325
226 Ga0207691_10011060 3300025940 Bacteria 8662
227 Ga0207711_10099282 3300025941 Bacteria 2573
228 Ga0207711_10646455 3300025941 Bacteria 987
229 Ga0207689_10015550 3300025942 Bacteria 6445
230 Ga0207689_10042634 3300025942 Bacteria 3752
231 Ga0207689_10103112 3300025942 Bacteria 2344
232 Ga0207689_10360606 3300025942 Bacteria 1209
233 Ga0207661_10045411 3300025944 Bacteria 3478
234 Ga0207679_10069410 3300025945 Bacteria 2652
235 Ga0207679_10109017 3300025945 Bacteria 2181
236 Ga0207679_10690624 3300025945 Bacteria 925
237 Ga0207667_10015058 3300025949 Bacteria 8796
238 Ga0207667_10021522 3300025949 Bacteria 7145
239 Ga0207667_10241082 3300025949 Bacteria 1850
240 Ga0207667_10436667 3300025949 Bacteria 1331
241 Ga0207667_10953819 3300025949 Bacteria 847
242 Ga0207651_10302511 3300025960 Bacteria 1330
243 Ga0207651_10784067 3300025960 Bacteria 844
244 Ga0207640_10009925 3300025981 Bacteria 5346
245 Ga0207658_10306007 3300025986 Bacteria 1371
246 Ga0207678_10003138 3300026067 Bacteria 14954
247 Ga0207702_10001078 3300026078 Bacteria 27950
248 Ga0207641_10025685 3300026088 Bacteria 4856
249 Ga0207641_10156342 3300026088 Bacteria 2069
250 Ga0207648_10002366 3300026089 Bacteria 20335
251 Ga0207648_10034057 3300026089 Bacteria 4492
252 Ga0207648_10082737 3300026089 Bacteria 2799
253 Ga0207676_10353110 3300026095 Bacteria 1360
254 Ga0207674_10005131 3300026116 Bacteria 15626
255 Ga0207674_10056935 3300026116 Bacteria 3966
256 Ga0207675_100198514 3300026118 Bacteria 1926
257 Ga0207683_10601000 3300026121 Bacteria 1018
258 Ga0207698_10259141 3300026142 Bacteria 1596
259 Ga0209281_1000103 3300027111 Bacteria 221425
260 Ga0209981_1004231 3300027378 Bacteria 1878
261 Ga0209996_1007205 3300027395 Bacteria 1446
262 Ga0209995_1002718 3300027471 Bacteria 2801
263 Ga0209968_1004092 3300027526 Bacteria 2191
264 Ga0209966_1000078 3300027695 Bacteria 42139
265 Ga0209813_10001410 3300027866 Bacteria 5426
266 Ga0209813_10047404 3300027866 Bacteria 1331
267 Ga0209974_10000352 3300027876 Bacteria 15062
268 Ga0268266_10018969 3300028379 Bacteria 5859
269 Ga0268266_11132791 3300028379 Bacteria 757
270 Ga0268265_10008545 3300028380 Bacteria 6921
271 Ga0268264_10557547 3300028381 Bacteria 1124
272 Ga0265336_10000053 3300028666 Bacteria 113034
273 Ga0307517_10007352 3300028786 Bacteria 16079
274 Ga0307517_10140984 3300028786 Bacteria 1692
275 Ga0307515_10001658 3300028794 Bacteria 49584
276 Ga0307515_10003085 3300028794 Bacteria 35271
277 Ga0307515_10004515 3300028794 Bacteria 28764
278 Ga0307515_10033134 3300028794 Bacteria 8519
279 Ga0307515_10038935 3300028794 Bacteria 7582
280 Ga0265324_10001024 3300029957 Bacteria 17194
281 Ga0307511_10086935 3300030521 Bacteria 2149
282 Ga0307512_10183486 3300030522 Bacteria 1170
283 Ga0265327_10000374 3300031251 Bacteria 84337
284 Ga0265327_10120131 3300031251 Bacteria 1246
285 Ga0307513_10010543 3300031456 Bacteria 11566
286 Ga0307513_10042402 3300031456 Bacteria 5011
287 Ga0307513_10276802 3300031456 Bacteria 1458
288 Ga0307509_10067221 3300031507 Bacteria 3756
289 Ga0307509_10233213 3300031507 Bacteria 1641
290 Ga0307508_10000082 3300031616 Bacteria 111720
291 Ga0307508_10013038 3300031616 Bacteria 7601
292 Ga0307508_10106602 3300031616 Bacteria 2401
293 Ga0307514_10001022 3300031649 Bacteria 40547
294 Ga0307514_10023730 3300031649 Bacteria 4973
295 Ga0307514_10044689 3300031649 Bacteria 3469
296 Ga0307516_10000286 3300031730 Bacteria 65447
297 Ga0307516_10002190 3300031730 Bacteria 26468
298 Ga0307516_10002898 3300031730 Bacteria 22490
299 Ga0307516_10117316 3300031730 Bacteria 2456
300 Ga0307516_10266339 3300031730 Bacteria 1402
301 Ga0307516_10360097 3300031730 Bacteria 1119
302 Ga0307516_10517599 3300031730 Bacteria 847
303 Ga0307405_10039982 3300031731 Bacteria 2838
304 Ga0307410_10034588 3300031852 Bacteria 3274
305 Ga0307406_10111293 3300031901 Bacteria 1886
306 Ga0307407_10010312 3300031903 Bacteria 4400
307 Ga0307407_10218264 3300031903 Bacteria 1288
308 Ga0307412_10107337 3300031911 Bacteria 1987
309 Ga0307412_10507324 3300031911 Bacteria 1005
310 Ga0307409_100477828 3300031995 Bacteria 1209
311 Ga0307409_101021267 3300031995 Bacteria 846
312 Ga0307411_10020463 3300032005 Bacteria 3849
313 Ga0307411_10204241 3300032005 Bacteria 1520
314 Ga0307411_10430268 3300032005 Bacteria 1099
315 Ga0307415_100051981 3300032126 Bacteria 2784
316 Ga0307507_10018450 3300033179 Bacteria 7930
317 Ga0307510_10264326 3300033180 Bacteria 1200
318 Ga0373931_0007609 3300035691 Bacteria 5105
319 Ga0373931_0155635 3300035691 Bacteria 1336
320 Ga0373947_0294130 3300035725 Bacteria 1082
321 Ga0395900_0000025 3300037418 Bacteria 321217
322 Ga0395898_0000811 3300037466 Bacteria 52404
323 Ga0395905_0012243 3300037471 Bacteria 8261
324 Ga0395905_0012687 3300037471 Bacteria 8107
325 Ga0395905_0138667 3300037471 Bacteria 2288
326 Ga0395905_0326151 3300037471 Bacteria 1425
327 Ga0395901_0013605 3300038443 Bacteria 8273
328 Ga0436365_1861796 3300039437 Bacteria 873
329 Ga0436361_0155039 3300039447 Bacteria 5127
330 Ga0436361_0609590 3300039447 Bacteria 21697
331 Ga0436361_0757401 3300039447 Bacteria 49858
332 Ga0436361_0886712 3300039447 Bacteria 114879
333 Ga0436361_0971257 3300039447 Bacteria 2214
334 Ga0439461_0016736 3300041410 Bacteria 1419
335 Ga0439465_0066443 3300041413 Bacteria 1202
336 Ga0451787_391274 3300041441 Bacteria 806
337 Ga0451789_1298857 3300041443 Bacteria 792
338 Ga0451791_0628982 3300041451 Bacteria 1232
339 Ga0451793_1596311 3300041452 Bacteria 2956
340 Ga0451800_1303403 3300041459 Bacteria 4146
341 Ga0451804_0735751 3300041463 Bacteria 2920
342 Ga0451807_0789257 3300041486 Bacteria 907
343 Ga0451807_0881130 3300041486 Bacteria 1142
344 Ga0451841_1256041 3300041498 Bacteria 848
345 Ga0451849_1186840 3300041505 Bacteria 2032
346 Ga0451853_1713310 3300041512 Bacteria 869
347 Ga0451853_1731200 3300041512 Bacteria 2553
348 Ga0439431_0004245 3300041997 Bacteria 3146
349 Ga0439449_0024846 3300042007 Bacteria 2240
350 Ga0439454_007535 3300042011 Bacteria 1367
351 Ga0439455_0011499 3300042012 Bacteria 1968
352 Ga0439457_018178 3300042014 Bacteria 1561
353 Ga0450919_000357 3300042121 Bacteria 5521
354 Ga0450920_013737 3300042122 Bacteria 1526
355 Ga0450897_005991 3300042128 Bacteria 1073
356 Ga0450894_026219 3300042131 Bacteria 800
357 Ga0450898_001232 3300042134 Bacteria 3318
358 Ga0450899_004259 3300042135 Bacteria 1533
359 Ga0439458_0050501 3300042157 Bacteria 1026
360 Ga0439434_0017482 3300042435 Bacteria 2146
361 Ga0450918_001134 3300042531 Bacteria 5459
362 Ga0450893_0036380 3300042532 Bacteria 891
363 Ga0451577_0000303 3300042876 Bacteria 95840
364 Ga0451577_0003093 3300042876 Bacteria 18788
365 Ga0466969_0000100 3300044656 Bacteria 45570
366 Ga0466969_0024033 3300044656 Bacteria 3135
367 Ga0466972_0024741 3300044658 Bacteria 2979
368 Ga0466972_0095882 3300044658 Bacteria 1405
369 Ga0466965_0006107 3300044683 Bacteria 5443
370 Ga0466965_0006505 3300044683 Bacteria 5311
371 Ga0466966_0041188 3300044684 Bacteria 2968
372 Ga0466966_0058201 3300044684 Bacteria 2443
373 Ga0466961_0002147 3300044693 Bacteria 12260
374 Ga0466961_0029042 3300044693 Bacteria 3555
375 Ga0466963_0002684 3300044694 Bacteria 10020
376 Ga0466964_0007187 3300044706 Bacteria 4164
377 Ga0466964_0027777 3300044706 Bacteria 2224
378 Ga0466964_0060540 3300044706 Bacteria 1575
379 Ga0453684_0000947 3300044712 Bacteria 95768
380 Ga0453684_0023418 3300044712 Bacteria 9099
381 Ga0453684_0160050 3300044712 Bacteria 2664
382 Ga0453684_0538015 3300044712 Bacteria 1288
383 Ga0466971_0013109 3300044719 Bacteria 3635
384 Ga0466971_0121205 3300044719 Bacteria 1210
385 Ga0466968_0032551 3300044735 Bacteria 2170
386 Ga0466970_0003278 3300044765 Bacteria 7869
387 Ga0466957_0004566 3300044842 Bacteria 7733
388 Ga0466957_0397337 3300044842 Bacteria 942
389 Ga0466959_0000041 3300045049 Bacteria 100097
390 Ga0466959_0016403 3300045049 Bacteria 5411
391 Ga0466959_0019003 3300045049 Bacteria 5050
392 Ga0451576_0000880 3300045051 Bacteria 57256
393 Ga0451576_0013521 3300045051 Bacteria 9131
394 Ga0451576_0229615 3300045051 Bacteria 1938
395 Ga0466967_0033411 3300045976 Bacteria 4354
396 Ga0495638_0248245 3300046460 Bacteria 982
397 Ga0495585_0035205 3300046492 Bacteria 2831
398 Ga0495583_0000159 3300046506 Bacteria 113627
399 Ga0495606_0003437 3300046507 Bacteria 16806
400 Ga0495630_0071863 3300046517 Bacteria 2605
401 Ga0495632_0022038 3300046519 Bacteria 3422
402 Ga0495632_0260598 3300046519 Bacteria 775
403 Ga0495643_0159889 3300046522 Bacteria 1109
404 Ga0495642_0033010 3300046528 Bacteria 2080
405 Ga0495642_0143193 3300046528 Bacteria 1032
406 Ga0495642_0153447 3300046528 Bacteria 997
407 Ga0495654_0084833 3300046530 Bacteria 1479
408 Ga0495597_0023224 3300046542 Bacteria 2870
409 Ga0495597_0023929 3300046542 Bacteria 2823
410 Ga0495633_0165772 3300046558 Bacteria 1019
411 Ga0495668_0028187 3300046616 Bacteria 3177
412 Ga0495668_0054387 3300046616 Bacteria 2213
413 Ga0495611_0082720 3300046648 Bacteria 1478
414 Ga0495625_0001168 3300046660 Bacteria 33801
415 Ga0495625_0011185 3300046660 Bacteria 7341
416 Ga0495658_0154516 3300046683 Bacteria 1411
417 Ga0495669_0123590 3300046684 Bacteria 1215
418 Ga0495624_0024912 3300046690 Bacteria 3936
419 Ga0495671_0070149 3300046692 Bacteria 1722
420 Ga0495671_0234591 3300046692 Bacteria 887
421 Ga0495649_0001310 3300046694 Bacteria 19011
422 Ga0495649_0002829 3300046694 Bacteria 12048
423 Ga0495589_0006046 3300046794 Bacteria 6393
424 Ga0495687_000628 3300047443 Bacteria 40562
425 Ga0495687_002720 3300047443 Bacteria 13717
426 Ga0495687_012385 3300047443 Bacteria 4513
427 Ga0495679_089414 3300047446 Bacteria 865
428 Ga0495686_0009194 3300047472 Bacteria 7153
429 Ga0495593_0052945 3300047673 Bacteria 2143
430 Ga0495626_0102131 3300048091 Bacteria 1249
431 Ga0496100_0107039 3300048903 Bacteria 1937
432 Ga0496101_0195009 3300048904 Bacteria 1564
433 Ga0496101_0406079 3300048904 Bacteria 1073
434 Ga0496102_0002611 3300048905 Bacteria 15339
435 Ga0496102_0034503 3300048905 Bacteria 4551
436 Ga0496104_0416836 3300048907 Bacteria 1255
437 Ga0496105_0049224 3300048908 Bacteria 3479
438 Ga0496105_0150388 3300048908 Bacteria 1914
439 Ga0496106_0319603 3300048909 Bacteria 1246
440 Ga0496109_1007784 3300048912 Bacteria 770
441 Ga0496110_0310437 3300048913 Bacteria 1436
442 Ga0496113_0076861 3300048916 Bacteria 2551
443 Ga0496114_0128038 3300048917 Bacteria 2190
444 Ga0496114_0132696 3300048917 Bacteria 2152
445 Ga0496114_0379298 3300048917 Bacteria 1252
446 Ga0496115_0607802 3300048918 Bacteria 869
447 Ga0496121_0023384 3300048924 Bacteria 5954
448 Ga0496124_0000086 3300048927 Bacteria 202844
449 Ga0496125_0015950 3300048928 Bacteria 7236
450 Ga0496126_0365800 3300048929 Bacteria 1177
451 Ga0501306_006178 3300049127 Bacteria 1397
452 Ga0501309_002339 3300049129 Bacteria 2028
453 Ga0501292_033183 3300049515 Bacteria 873
454 Ga0501298_009500 3300049521 Bacteria 1657
455 Ga0501043_0000004 3300049579 Bacteria 291085
456 Ga0501046_0000016 3300049580 Bacteria 234374
457 Ga0501047_0000012 3300049581 Bacteria 368824
458 Ga0501048_0005708 3300049582 Bacteria 9458
459 Ga0501198_000028 3300049649 Bacteria 64045
460 Ga0501206_008287 3300049653 Bacteria 1372
461 Ga0501222_000024 3300049662 Bacteria 65412
462 Ga0501257_028997 3300049686 Bacteria 1329
463 Ga0501273_020043 3300049770 Bacteria 900
464 Ga0501045_0383257 3300049824 Bacteria 1046
465 nmdc:mga03683_107996_c1 3300050489 Bacteria 1228
466 nmdc:mga03683_1212_c1 3300050489 Bacteria 7621
467 nmdc:mga03683_13843_c1 3300050489 Bacteria 2974
468 nmdc:mga03683_195575_c1 3300050489 Bacteria 926
469 nmdc:mga03683_37482_c1 3300050489 Bacteria 1976
470 nmdc:mga03683_76125_c1 3300050489 Bacteria 1442
471 nmdc:mga03n38_25315_c1 3300050490 Bacteria 2435
472 nmdc:mga03n38_593_c1 3300050490 Bacteria 9218
473 nmdc:mga03n38_87593_c1 3300050490 Bacteria 1476
474 nmdc:mga00v17_229500_c1 3300050491 Bacteria 1203
475 nmdc:mga0yw44_23719_c1 3300050492 Bacteria 3461
476 nmdc:mga0k408_15903_c1 3300050493 Bacteria 3730
477 nmdc:mga0k408_159269_c1 3300050493 Bacteria 1345
478 nmdc:mga0k408_242278_c1 3300050493 Bacteria 1077
479 nmdc:mga0k408_25429_c1 3300050493 Bacteria 2815
480 nmdc:mga0k408_307473_c1 3300050493 Bacteria 946
481 nmdc:mga0k408_31112_c1 3300050493 Bacteria 3046
482 nmdc:mga0k408_32627_c1 3300050493 Bacteria 2974
483 nmdc:mga0k408_53733_c1 3300050493 Bacteria 2335
484 nmdc:mga0k408_75757_c1 3300050493 Bacteria 1966
485 nmdc:mga0k408_79_c1 3300050493 Bacteria 45658
486 nmdc:mga0k408_82788_c1 3300050493 Bacteria 1881
487 nmdc:mga0k408_98966_c1 3300050493 Bacteria 1719
488 nmdc:mga06z11_20503_c1 3300050494 Bacteria 3056
489 nmdc:mga06z11_25939_c1 3300050494 Bacteria 2784
490 nmdc:mga06z11_2696_c1 3300050494 Bacteria 6797
491 nmdc:mga06z11_274646_c1 3300050494 Bacteria 997
492 nmdc:mga06z11_44685_c1 3300050494 Bacteria 2235
493 nmdc:mga04h51_558_c1 3300050495 Bacteria 8865
494 nmdc:mga04h51_56703_c1 3300050495 Bacteria 1331
495 nmdc:mga07m45_126_c1 3300050496 Bacteria 30476
496 nmdc:mga07m45_279033_c1 3300050496 Bacteria 972
497 nmdc:mga07m45_28514_c1 3300050496 Bacteria 3082
498 nmdc:mga07m45_28726_c1 3300050496 Bacteria 3070
499 nmdc:mga07m45_31221_c1 3300050496 Bacteria 2952
500 nmdc:mga07m45_33561_c1 3300050496 Bacteria 2851
501 nmdc:mga07m45_42168_c1 3300050496 Bacteria 2558
502 nmdc:mga07m45_438_c1 3300050496 Bacteria 17312
503 nmdc:mga0sz30_101608_c1 3300050516 Bacteria 1256
504 nmdc:mga0sz30_40774_c1 3300050516 Bacteria 1952
505 Ga0500635_0000035 3300053080 Bacteria 94938
506 Ga0500578_0001958 3300053086 Bacteria 18805
507 Ga0500644_0038755 3300053088 Bacteria 1566
508 Ga0500646_0007390 3300053090 Bacteria 2806
509 Ga0500583_0036205 3300053092 Bacteria 2208
510 Ga0500651_0060839 3300053093 Bacteria 2360
511 Ga0500651_0065244 3300053093 Bacteria 2269
512 Ga0500651_0247038 3300053093 Bacteria 1039
513 Ga0500650_0012176 3300053098 Bacteria 3571
514 Ga0500562_032907 3300053108 Bacteria 1369
515 Ga0500593_000573 3300053117 Bacteria 14130
516 Ga0500623_060638 3300053127 Bacteria 1870
517 Ga0500628_005859 3300053129 Bacteria 2065
518 Ga0500642_0005820 3300053130 Bacteria 4009
519 Ga0500652_001332 3300053131 Bacteria 7760
520 Ga0500658_0025932 3300053134 Bacteria 2255
521 Ga0500559_0006966 3300053136 Bacteria 5054
522 Ga0500568_0007623 3300053139 Bacteria 5289
523 Ga0500568_0015752 3300053139 Bacteria 3377
524 Ga0500590_017967 3300053148 Bacteria 3658
525 Ga0500619_000321 3300053154 Bacteria 9344
526 Ga0500570_025358 3300053724 Bacteria 3259
527 Ga0590075_015655 3300059424 Bacteria 1861
528 Ga0466962_0027598 3300061719 Bacteria 2724

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0000004 Ga0501043_0000004_256777_257436 191
2 3300049580 Ga0501046_0000016 Ga0501046_0000016_34400_35059 191
3 3300049581 Ga0501047_0000012 Ga0501047_0000012_34080_34739 191
4 3300049582 Ga0501048_0005708 Ga0501048_0005708_6313_6972 191
5 3300049824 Ga0501045_0383257 Ga0501045_0383257_20_679 191
6 3300046528 Ga0495642_0153447 Ga0495642_0153447_109_789 197
7 3300005616 Ga0068852_100109476 Ga0068852_1001094764 198
8 3300031903 Ga0307407_10218264 Ga0307407_102182642 200
9 3300032005 Ga0307411_10204241 Ga0307411_102042412 200
10 3300005563 Ga0068855_100008362 Ga0068855_1000083623 201
11 3300025949 Ga0207667_10021522 Ga0207667_100215222 201
12 3300042131 Ga0450894_026219 Ga0450894_026219_154_771 205
13 3300042134 Ga0450898_001232 Ga0450898_001232_215_832 205
14 3300042135 Ga0450899_004259 Ga0450899_004259_808_1425 205
15 3300006353 Ga0075370_10316352 Ga0075370_103163521 206
16 3300031901 Ga0307406_10111293 Ga0307406_101112932 206
17 3300031911 Ga0307412_10107337 Ga0307412_101073372 206
18 3300031995 Ga0307409_100477828 Ga0307409_1004778282 206
19 3300037471 Ga0395905_0326151 Ga0395905_0326151_308_928 206
20 3300042011 Ga0439454_007535 Ga0439454_007535_174_794 206
21 3300042128 Ga0450897_005991 Ga0450897_005991_421_1041 206
22 3300044656 Ga0466969_0024033 Ga0466969_0024033_1366_2061 206
23 3300044683 Ga0466965_0006505 Ga0466965_0006505_2646_3341 206
24 3300044684 Ga0466966_0058201 Ga0466966_0058201_1209_1904 206
25 3300044693 Ga0466961_0029042 Ga0466961_0029042_1914_2609 206
26 3300044706 Ga0466964_0060540 Ga0466964_0060540_201_896 206
27 3300044719 Ga0466971_0013109 Ga0466971_0013109_2497_3192 206
28 3300044735 Ga0466968_0032551 Ga0466968_0032551_286_981 206
29 3300044842 Ga0466957_0397337 Ga0466957_0397337_34_729 206
30 3300045049 Ga0466959_0019003 Ga0466959_0019003_1462_2157 206
31 3300050496 nmdc:mga07m45_28726_c1 nmdc:mga07m45_28726_c1_2002_2685 206
32 3300061719 Ga0466962_0027598 Ga0466962_0027598_1458_2153 206
33 3300031649 Ga0307514_10023730 Ga0307514_100237302 207
34 iso_pu_bacteria 2643221644 2644248874 207
35 3300013297 Ga0157378_10237507 Ga0157378_102375072 208
36 3300031251 Ga0265327_10120131 Ga0265327_101201312 209
37 3300044712 Ga0453684_0160050 Ga0453684_0160050_643_1278 209
38 3300045051 Ga0451576_0013521 Ga0451576_0013521_6349_6984 209
39 3300048091 Ga0495626_0102131 Ga0495626_0102131_19_666 209
40 3300005355 Ga0070671_100004264 Ga0070671_1000042647 210
41 3300009176 Ga0105242_10025488 Ga0105242_100254885 210
42 3300009177 Ga0105248_10001199 Ga0105248_1000119915 210
43 3300010375 Ga0105239_10702863 Ga0105239_107028632 210
44 3300013296 Ga0157374_10295712 Ga0157374_102957122 210
45 3300013297 Ga0157378_10134590 Ga0157378_101345902 210
46 3300021361 Ga0213872_10000008 Ga0213872_1000000814 210
47 3300025931 Ga0207644_10011821 Ga0207644_100118212 210
48 3300025941 Ga0207711_10099282 Ga0207711_100992822 210
49 3300026095 Ga0207676_10353110 Ga0207676_103531102 210
50 3300035725 Ga0373947_0294130 Ga0373947_0294130_277_942 210
51 3300039447 Ga0436361_0757401 Ga0436361_0757401_40166_40834 210
52 3300042007 Ga0439449_0024846 Ga0439449_0024846_467_1105 210
53 3300042014 Ga0439457_018178 Ga0439457_018178_882_1514 210
54 3300048904 Ga0496101_0195009 Ga0496101_0195009_768_1406 210
55 3300048907 Ga0496104_0416836 Ga0496104_0416836_193_831 210
56 3300048908 Ga0496105_0049224 Ga0496105_0049224_1726_2364 210
57 3300048909 Ga0496106_0319603 Ga0496106_0319603_195_827 210
58 3300048913 Ga0496110_0310437 Ga0496110_0310437_402_1040 210
59 3300048916 Ga0496113_0076861 Ga0496113_0076861_1512_2150 210
60 3300049515 Ga0501292_033183 Ga0501292_033183_37_669 210
61 3300049521 Ga0501298_009500 Ga0501298_009500_987_1619 210
62 3300049653 Ga0501206_008287 Ga0501206_008287_161_793 210
63 3300049686 Ga0501257_028997 Ga0501257_028997_132_764 210
64 3300049770 Ga0501273_020043 Ga0501273_020043_255_887 210
65 iso_pu_bacteria 2585428057 2587728395 210
66 iso_pu_bacteria 2585428058 2587735477 210
67 iso_pu_bacteria 2585428062 2587758642 210
68 iso_pu_bacteria 2588253510 2588293745 210
69 iso_pu_bacteria 2643221592 2643968785 210
70 iso_pu_bacteria 2643221625 2644139577 210
71 iso_pu_bacteria 2643221648 2644272390 210
72 3300003347 JGI26128J50194_1000079 JGI26128J50194_10000794 211
73 3300005338 Ga0068868_100008861 Ga0068868_1000088619 211
74 3300005339 Ga0070660_100191878 Ga0070660_1001918781 211
75 3300005344 Ga0070661_100000166 Ga0070661_1000001662 211
76 3300005366 Ga0070659_100000596 Ga0070659_10000059623 211
77 3300005366 Ga0070659_100373310 Ga0070659_1003733101 211
78 3300005564 Ga0070664_100001214 Ga0070664_1000012141 211
79 3300005564 Ga0070664_100130675 Ga0070664_1001306752 211
80 3300005617 Ga0068859_100423920 Ga0068859_1004239202 211
81 3300005618 Ga0068864_100011328 Ga0068864_10001132811 211
82 3300005841 Ga0068863_100026987 Ga0068863_1000269873 211
83 3300005843 Ga0068860_100140069 Ga0068860_1001400692 211
84 3300006177 Ga0075362_10019227 Ga0075362_100192275 211
85 3300006195 Ga0075366_10000604 Ga0075366_1000060416 211
86 3300006195 Ga0075366_10005349 Ga0075366_100053492 211
87 3300006195 Ga0075366_10322788 Ga0075366_103227881 211
88 3300006237 Ga0097621_100152530 Ga0097621_1001525302 211
89 3300006931 Ga0097620_100423880 Ga0097620_1004238802 211
90 3300009545 Ga0105237_10138343 Ga0105237_101383432 211
91 3300011119 Ga0105246_10212944 Ga0105246_102129442 211
92 3300013306 Ga0163162_10623067 Ga0163162_106230672 211
93 3300014325 Ga0163163_10245719 Ga0163163_102457192 211
94 3300025914 Ga0207671_10482629 Ga0207671_104826292 211
95 3300025920 Ga0207649_10245493 Ga0207649_102454932 211
96 3300025932 Ga0207690_10007998 Ga0207690_100079983 211
97 3300025945 Ga0207679_10069410 Ga0207679_100694103 211
98 3300025945 Ga0207679_10109017 Ga0207679_101090172 211
99 3300026088 Ga0207641_10025685 Ga0207641_100256857 211
100 3300027378 Ga0209981_1004231 Ga0209981_10042312 211
101 3300027395 Ga0209996_1007205 Ga0209996_10072052 211
102 3300027471 Ga0209995_1002718 Ga0209995_10027182 211
103 3300027526 Ga0209968_1004092 Ga0209968_10040922 211
104 3300027695 Ga0209966_1000078 Ga0209966_100007819 211
105 3300028786 Ga0307517_10007352 Ga0307517_100073529 211
106 3300031616 Ga0307508_10013038 Ga0307508_100130386 211
107 3300042121 Ga0450919_000357 Ga0450919_000357_1163_1798 211
108 3300042122 Ga0450920_013737 Ga0450920_013737_565_1200 211
109 3300042531 Ga0450918_001134 Ga0450918_001134_509_1144 211
110 3300044712 Ga0453684_0023418 Ga0453684_0023418_6779_7423 211
111 3300050489 nmdc:mga03683_107996_c1 nmdc:mga03683_107996_c1_115_750 211
112 3300050493 nmdc:mga0k408_307473_c1 nmdc:mga0k408_307473_c1_216_893 211
113 3300050493 nmdc:mga0k408_79_c1 nmdc:mga0k408_79_c1_32031_32666 211
114 3300050496 nmdc:mga07m45_279033_c1 nmdc:mga07m45_279033_c1_113_802 211
115 3300003323 rootH1_10153801 rootH1_101538012 212
116 3300003759 Ga0055525_1000249 Ga0055525_100024938 212
117 3300009177 Ga0105248_10432476 Ga0105248_104324762 212
118 3300025226 Ga0209674_110532 Ga0209674_1105322 212
119 3300025230 Ga0209563_100013 Ga0209563_100013856 212
120 3300031649 Ga0307514_10044689 Ga0307514_100446892 212
121 3300041441 Ga0451787_391274 Ga0451787_391274_144_785 212
122 3300003775 Ga0055524_1000013 Ga0055524_1000013206 213
123 3300003792 Ga0055540_1000001 Ga0055540_100000156 213
124 3300003794 Ga0055531_10002731 Ga0055531_100027312 213
125 3300006195 Ga0075366_10029290 Ga0075366_100292904 213
126 3300006195 Ga0075366_10033782 Ga0075366_100337822 213
127 3300006946 Ga0079104_1000070 Ga0079104_100007090 213
128 3300021361 Ga0213872_10000044 Ga0213872_1000004462 213
129 3300025263 Ga0209565_1011421 Ga0209565_10114212 213
130 3300025291 Ga0209675_1009681 Ga0209675_10096813 213
131 3300025298 Ga0209050_1000730 Ga0209050_10007309 213
132 3300025299 Ga0209256_1000061 Ga0209256_1000061208 213
133 3300025303 Ga0209051_1000018 Ga0209051_1000018394 213
134 3300025304 Ga0209257_1000461 Ga0209257_100046157 213
135 3300027111 Ga0209281_1000103 Ga0209281_100010390 213
136 3300039447 Ga0436361_0886712 Ga0436361_0886712_56561_57208 213
137 3300048917 Ga0496114_0128038 Ga0496114_0128038_1074_1715 213
138 3300049649 Ga0501198_000028 Ga0501198_000028_39935_40576 213
139 3300049662 Ga0501222_000024 Ga0501222_000024_49851_50492 213
140 3300050493 nmdc:mga0k408_32627_c1 nmdc:mga0k408_32627_c1_226_906 213
141 3300002773 JGI25152J39213_1018532 JGI25152J39213_10185322 214
142 3300002774 JGI25150J39212_1019541 JGI25150J39212_10195412 214
143 3300003215 JGI25153J46596_10003113 JGI25153J46596_100031131 214
144 3300003215 JGI25153J46596_10003765 JGI25153J46596_100037651 214
145 3300003215 JGI25153J46596_10008735 JGI25153J46596_100087353 214
146 3300003215 JGI25153J46596_10009276 JGI25153J46596_100092765 214
147 3300003771 Ga0055526_1006445 Ga0055526_10064455 214
148 3300003791 Ga0055530_10021452 Ga0055530_100214522 214
149 3300005262 Ga0065165_1005447 Ga0065165_10054475 214
150 3300005455 Ga0070663_100004564 Ga0070663_1000045644 214
151 3300005459 Ga0068867_100001106 Ga0068867_10000110617 214
152 3300005577 Ga0068857_100699675 Ga0068857_1006996751 214
153 3300006177 Ga0075362_10020665 Ga0075362_100206652 214
154 3300006178 Ga0075367_10121450 Ga0075367_101214502 214
155 3300006186 Ga0075369_10187655 Ga0075369_101876551 214
156 3300006195 Ga0075366_10156721 Ga0075366_101567212 214
157 3300006195 Ga0075366_10188166 Ga0075366_101881661 214
158 3300006195 Ga0075366_10191789 Ga0075366_101917892 214
159 3300006353 Ga0075370_10001525 Ga0075370_100015252 214
160 3300006353 Ga0075370_10003099 Ga0075370_100030992 214
161 3300009148 Ga0105243_10007836 Ga0105243_100078365 214
162 3300014745 Ga0157377_10000091 Ga0157377_1000009140 214
163 3300025245 Ga0207425_1000581 Ga0207425_100058116 214
164 3300025258 Ga0209129_1000043 Ga0209129_100004392 214
165 3300025258 Ga0209129_1018269 Ga0209129_10182692 214
166 3300025263 Ga0209565_1024128 Ga0209565_10241282 214
167 3300025273 Ga0209673_1044532 Ga0209673_10445322 214
168 3300025273 Ga0209673_1061652 Ga0209673_10616521 214
169 3300025295 Ga0209564_1000014 Ga0209564_1000014199 214
170 3300025297 Ga0209758_1000093 Ga0209758_1000093126 214
171 3300025297 Ga0209758_1000204 Ga0209758_100020477 214
172 3300025298 Ga0209050_1002169 Ga0209050_10021692 214
173 3300025303 Ga0209051_1009498 Ga0209051_10094982 214
174 3300025935 Ga0207709_10006138 Ga0207709_100061385 214
175 3300026067 Ga0207678_10003138 Ga0207678_100031385 214
176 3300026089 Ga0207648_10002366 Ga0207648_1000236619 214
177 3300027876 Ga0209974_10000352 Ga0209974_100003527 214
178 3300028794 Ga0307515_10001658 Ga0307515_1000165823 214
179 3300028794 Ga0307515_10003085 Ga0307515_1000308528 214
180 3300028794 Ga0307515_10004515 Ga0307515_100045152 214
181 3300028794 Ga0307515_10033134 Ga0307515_100331347 214
182 3300030522 Ga0307512_10183486 Ga0307512_101834862 214
183 3300031456 Ga0307513_10042402 Ga0307513_100424023 214
184 3300031456 Ga0307513_10276802 Ga0307513_102768022 214
185 3300031507 Ga0307509_10233213 Ga0307509_102332132 214
186 3300031616 Ga0307508_10000082 Ga0307508_1000008288 214
187 3300031730 Ga0307516_10002190 Ga0307516_100021904 214
188 3300031730 Ga0307516_10002898 Ga0307516_100028986 214
189 3300031730 Ga0307516_10266339 Ga0307516_102663392 214
190 3300031730 Ga0307516_10517599 Ga0307516_105175992 214
191 3300032005 Ga0307411_10430268 Ga0307411_104302681 214
192 3300033179 Ga0307507_10018450 Ga0307507_100184507 214
193 3300037471 Ga0395905_0012687 Ga0395905_0012687_5978_6688 214
194 3300041443 Ga0451789_1298857 Ga0451789_1298857_128_772 214
195 3300041451 Ga0451791_0628982 Ga0451791_0628982_368_1012 214
196 3300041452 Ga0451793_1596311 Ga0451793_1596311_1926_2570 214
197 3300041459 Ga0451800_1303403 Ga0451800_1303403_3261_3905 214
198 3300041463 Ga0451804_0735751 Ga0451804_0735751_382_1026 214
199 3300041486 Ga0451807_0789257 Ga0451807_0789257_239_883 214
200 3300041486 Ga0451807_0881130 Ga0451807_0881130_247_891 214
201 3300041498 Ga0451841_1256041 Ga0451841_1256041_166_828 214
202 3300041505 Ga0451849_1186840 Ga0451849_1186840_37_681 214
203 3300041512 Ga0451853_1713310 Ga0451853_1713310_120_779 214
204 3300041512 Ga0451853_1731200 Ga0451853_1731200_1049_1693 214
205 3300046460 Ga0495638_0248245 Ga0495638_0248245_18_662 214
206 3300046492 Ga0495585_0035205 Ga0495585_0035205_1194_1877 214
207 3300046660 Ga0495625_0001168 Ga0495625_0001168_26815_27459 214
208 3300046683 Ga0495658_0154516 Ga0495658_0154516_566_1210 214
209 3300048904 Ga0496101_0406079 Ga0496101_0406079_211_858 214
210 3300048905 Ga0496102_0002611 Ga0496102_0002611_8055_8699 214
211 3300048905 Ga0496102_0034503 Ga0496102_0034503_2673_3317 214
212 3300048917 Ga0496114_0132696 Ga0496114_0132696_249_905 214
213 3300050489 nmdc:mga03683_13843_c1 nmdc:mga03683_13843_c1_2100_2744 214
214 3300050490 nmdc:mga03n38_25315_c1 nmdc:mga03n38_25315_c1_1472_2116 214
215 3300050490 nmdc:mga03n38_87593_c1 nmdc:mga03n38_87593_c1_647_1291 214
216 3300050493 nmdc:mga0k408_242278_c1 nmdc:mga0k408_242278_c1_307_951 214
217 3300050493 nmdc:mga0k408_25429_c1 nmdc:mga0k408_25429_c1_572_1252 214
218 3300050493 nmdc:mga0k408_75757_c1 nmdc:mga0k408_75757_c1_1169_1813 214
219 3300050494 nmdc:mga06z11_274646_c1 nmdc:mga06z11_274646_c1_162_806 214
220 3300050494 nmdc:mga06z11_44685_c1 nmdc:mga06z11_44685_c1_1409_2053 214
221 3300050496 nmdc:mga07m45_31221_c1 nmdc:mga07m45_31221_c1_1241_1906 214
222 3300050496 nmdc:mga07m45_33561_c1 nmdc:mga07m45_33561_c1_722_1366 214
223 3300050516 nmdc:mga0sz30_101608_c1 nmdc:mga0sz30_101608_c1_76_720 214
224 3300053086 Ga0500578_0001958 Ga0500578_0001958_10437_11081 214
225 3300053088 Ga0500644_0038755 Ga0500644_0038755_304_948 214
226 3300053090 Ga0500646_0007390 Ga0500646_0007390_2001_2645 214
227 3300053092 Ga0500583_0036205 Ga0500583_0036205_408_1052 214
228 3300053093 Ga0500651_0065244 Ga0500651_0065244_840_1484 214
229 3300053093 Ga0500651_0247038 Ga0500651_0247038_380_1024 214
230 3300053098 Ga0500650_0012176 Ga0500650_0012176_702_1346 214
231 3300053108 Ga0500562_032907 Ga0500562_032907_496_1140 214
232 3300053117 Ga0500593_000573 Ga0500593_000573_7234_7878 214
233 3300053127 Ga0500623_060638 Ga0500623_060638_1033_1677 214
234 3300053129 Ga0500628_005859 Ga0500628_005859_1121_1765 214
235 3300053130 Ga0500642_0005820 Ga0500642_0005820_35_679 214
236 3300053131 Ga0500652_001332 Ga0500652_001332_4554_5198 214
237 3300053139 Ga0500568_0015752 Ga0500568_0015752_1834_2478 214
238 3300053154 Ga0500619_000321 Ga0500619_000321_5343_5987 214
239 3300053724 Ga0500570_025358 Ga0500570_025358_906_1550 214
240 iso_pu_bacteria 2919704043 2919706914 214
241 3300005356 Ga0070674_100247587 Ga0070674_1002475872 215
242 3300005548 Ga0070665_100055460 Ga0070665_1000554605 215
243 3300005617 Ga0068859_100113536 Ga0068859_1001135362 215
244 3300005841 Ga0068863_100270213 Ga0068863_1002702132 215
245 3300005842 Ga0068858_100162479 Ga0068858_1001624792 215
246 3300005843 Ga0068860_100207591 Ga0068860_1002075912 215
247 3300005844 Ga0068862_100080540 Ga0068862_1000805403 215
248 3300006931 Ga0097620_100113539 Ga0097620_1001135392 215
249 3300009147 Ga0114129_10644397 Ga0114129_106443972 215
250 3300009148 Ga0105243_10081584 Ga0105243_100815842 215
251 3300014325 Ga0163163_11185262 Ga0163163_111852622 215
252 3300014968 Ga0157379_10018297 Ga0157379_100182974 215
253 3300025926 Ga0207659_10401372 Ga0207659_104013721 215
254 3300025935 Ga0207709_10073180 Ga0207709_100731803 215
255 3300025937 Ga0207669_10138545 Ga0207669_101385452 215
256 3300025942 Ga0207689_10360606 Ga0207689_103606062 215
257 3300026088 Ga0207641_10156342 Ga0207641_101563422 215
258 3300028379 Ga0268266_11132791 Ga0268266_111327911 215
259 3300028380 Ga0268265_10008545 Ga0268265_100085453 215
260 3300028381 Ga0268264_10557547 Ga0268264_105575472 215
261 3300031731 Ga0307405_10039982 Ga0307405_100399822 215
262 3300031852 Ga0307410_10034588 Ga0307410_100345882 215
263 3300031903 Ga0307407_10010312 Ga0307407_100103125 215
264 3300031995 Ga0307409_101021267 Ga0307409_1010212672 215
265 3300032005 Ga0307411_10020463 Ga0307411_100204633 215
266 3300032126 Ga0307415_100051981 Ga0307415_1000519814 215
267 3300041413 Ga0439465_0066443 Ga0439465_0066443_351_1001 215
268 3300042876 Ga0451577_0000303 Ga0451577_0000303_59512_60168 215
269 3300044712 Ga0453684_0000947 Ga0453684_0000947_35673_36329 215
270 3300045051 Ga0451576_0000880 Ga0451576_0000880_33975_34631 215
271 3300047472 Ga0495686_0009194 Ga0495686_0009194_1214_1879 215
272 3300050493 nmdc:mga0k408_98966_c1 nmdc:mga0k408_98966_c1_709_1365 215
273 3300053148 Ga0500590_017967 Ga0500590_017967_2855_3508 215
274 3300005334 Ga0068869_100095411 Ga0068869_1000954112 216
275 3300005445 Ga0070708_100397363 Ga0070708_1003973632 216
276 3300005467 Ga0070706_100004462 Ga0070706_1000044625 216
277 3300005468 Ga0070707_100034841 Ga0070707_1000348415 216
278 3300005471 Ga0070698_100361762 Ga0070698_1003617622 216
279 3300005616 Ga0068852_100132911 Ga0068852_1001329112 216
280 3300005844 Ga0068862_101108849 Ga0068862_1011088491 216
281 3300006038 Ga0075365_10033607 Ga0075365_100336073 216
282 3300006042 Ga0075368_10008653 Ga0075368_100086532 216
283 3300006048 Ga0075363_100000955 Ga0075363_1000009557 216
284 3300006177 Ga0075362_10002335 Ga0075362_100023352 216
285 3300006177 Ga0075362_10043384 Ga0075362_100433843 216
286 3300006178 Ga0075367_10000248 Ga0075367_1000024815 216
287 3300006178 Ga0075367_10002089 Ga0075367_100020892 216
288 3300006186 Ga0075369_10175797 Ga0075369_101757972 216
289 3300006353 Ga0075370_10004128 Ga0075370_100041285 216
290 3300006353 Ga0075370_10012132 Ga0075370_100121322 216
291 3300025910 Ga0207684_10009321 Ga0207684_100093219 216
292 3300025922 Ga0207646_10162518 Ga0207646_101625182 216
293 3300027866 Ga0209813_10001410 Ga0209813_100014104 216
294 3300027866 Ga0209813_10047404 Ga0209813_100474042 216
295 3300028786 Ga0307517_10140984 Ga0307517_101409842 216
296 3300031616 Ga0307508_10106602 Ga0307508_101066022 216
297 3300033180 Ga0307510_10264326 Ga0307510_102643262 216
298 3300044712 Ga0453684_0538015 Ga0453684_0538015_381_1043 216
299 3300045051 Ga0451576_0229615 Ga0451576_0229615_801_1463 216
300 3300046519 Ga0495632_0022038 Ga0495632_0022038_2676_3347 216
301 3300046528 Ga0495642_0033010 Ga0495642_0033010_196_867 216
302 3300046528 Ga0495642_0143193 Ga0495642_0143193_106_777 216
303 3300046530 Ga0495654_0084833 Ga0495654_0084833_137_808 216
304 3300046542 Ga0495597_0023929 Ga0495597_0023929_450_1121 216
305 3300046558 Ga0495633_0165772 Ga0495633_0165772_200_859 216
306 3300046616 Ga0495668_0054387 Ga0495668_0054387_1253_1924 216
307 3300046648 Ga0495611_0082720 Ga0495611_0082720_611_1282 216
308 3300046684 Ga0495669_0123590 Ga0495669_0123590_301_972 216
309 3300046692 Ga0495671_0070149 Ga0495671_0070149_148_819 216
310 3300046694 Ga0495649_0002829 Ga0495649_0002829_7872_8543 216
311 3300047443 Ga0495687_002720 Ga0495687_002720_10553_11224 216
312 3300047443 Ga0495687_012385 Ga0495687_012385_1343_2014 216
313 3300047446 Ga0495679_089414 Ga0495679_089414_95_766 216
314 3300050489 nmdc:mga03683_1212_c1 nmdc:mga03683_1212_c1_2378_3049 216
315 3300050490 nmdc:mga03n38_593_c1 nmdc:mga03n38_593_c1_7796_8467 216
316 3300050491 nmdc:mga00v17_229500_c1 nmdc:mga00v17_229500_c1_303_974 216
317 3300050492 nmdc:mga0yw44_23719_c1 nmdc:mga0yw44_23719_c1_753_1424 216
318 3300050493 nmdc:mga0k408_53733_c1 nmdc:mga0k408_53733_c1_185_856 216
319 3300050493 nmdc:mga0k408_82788_c1 nmdc:mga0k408_82788_c1_1016_1687 216
320 3300050494 nmdc:mga06z11_25939_c1 nmdc:mga06z11_25939_c1_700_1371 216
321 3300050494 nmdc:mga06z11_2696_c1 nmdc:mga06z11_2696_c1_3398_4069 216
322 3300050495 nmdc:mga04h51_558_c1 nmdc:mga04h51_558_c1_6046_6717 216
323 3300050495 nmdc:mga04h51_56703_c1 nmdc:mga04h51_56703_c1_463_1134 216
324 3300050496 nmdc:mga07m45_438_c1 nmdc:mga07m45_438_c1_13209_13880 216
325 3300050516 nmdc:mga0sz30_40774_c1 nmdc:mga0sz30_40774_c1_959_1630 216
326 3300053093 Ga0500651_0060839 Ga0500651_0060839_863_1534 216
327 3300053134 Ga0500658_0025932 Ga0500658_0025932_176_847 216
328 3300053139 Ga0500568_0007623 Ga0500568_0007623_1708_2379 216
329 3300009551 Ga0105238_10379483 Ga0105238_103794831 217
330 3300059424 Ga0590075_015655 Ga0590075_015655_423_1103 217
331 iso_pu_bacteria 2643221660 2644339032 217
332 3300021361 Ga0213872_10011647 Ga0213872_100116472 218
333 3300031251 Ga0265327_10000374 Ga0265327_1000037428 218
334 3300039447 Ga0436361_0971257 Ga0436361_0971257_90_755 218
335 3300050489 nmdc:mga03683_195575_c1 nmdc:mga03683_195575_c1_38_736 218
336 3300021361 Ga0213872_10013889 Ga0213872_100138894 219
337 3300037471 Ga0395905_0138667 Ga0395905_0138667_1398_2084 219
338 3300039447 Ga0436361_0155039 Ga0436361_0155039_3558_4229 219
339 3300003322 rootL2_10002966 rootL2_100029667 220
340 3300005334 Ga0068869_100117689 Ga0068869_1001176892 220
341 3300005338 Ga0068868_100451100 Ga0068868_1004511001 220
342 3300005339 Ga0070660_100633595 Ga0070660_1006335951 220
343 3300005355 Ga0070671_100052441 Ga0070671_1000524412 220
344 3300005356 Ga0070674_100579843 Ga0070674_1005798431 220
345 3300005457 Ga0070662_100072823 Ga0070662_1000728232 220
346 3300005459 Ga0068867_100254744 Ga0068867_1002547442 220
347 3300005616 Ga0068852_100053853 Ga0068852_1000538533 220
348 3300006042 Ga0075368_10067102 Ga0075368_100671022 220
349 3300006051 Ga0075364_10012510 Ga0075364_100125105 220
350 3300006177 Ga0075362_10024026 Ga0075362_100240262 220
351 3300006178 Ga0075367_10010731 Ga0075367_100107315 220
352 3300006178 Ga0075367_10075843 Ga0075367_100758432 220
353 3300009093 Ga0105240_10088123 Ga0105240_100881232 220
354 3300009545 Ga0105237_10018364 Ga0105237_1001836411 220
355 3300010375 Ga0105239_10074103 Ga0105239_100741032 220
356 3300025907 Ga0207645_10031817 Ga0207645_100318173 220
357 3300025914 Ga0207671_10306167 Ga0207671_103061671 220
358 3300025931 Ga0207644_10388556 Ga0207644_103885562 220
359 3300025935 Ga0207709_10030982 Ga0207709_100309822 220
360 3300025942 Ga0207689_10042634 Ga0207689_100426343 220
361 3300025949 Ga0207667_10953819 Ga0207667_109538191 220
362 3300025960 Ga0207651_10784067 Ga0207651_107840672 220
363 3300025986 Ga0207658_10306007 Ga0207658_103060072 220
364 3300026089 Ga0207648_10034057 Ga0207648_100340575 220
365 3300026089 Ga0207648_10082737 Ga0207648_100827372 220
366 3300026116 Ga0207674_10056935 Ga0207674_100569356 220
367 3300026118 Ga0207675_100198514 Ga0207675_1001985142 220
368 3300026142 Ga0207698_10259141 Ga0207698_102591412 220
369 3300031456 Ga0307513_10010543 Ga0307513_1001054313 220
370 3300031730 Ga0307516_10360097 Ga0307516_103600972 220
371 3300046522 Ga0495643_0159889 Ga0495643_0159889_217_900 220
372 3300046542 Ga0495597_0023224 Ga0495597_0023224_2057_2740 220
373 3300047443 Ga0495687_000628 Ga0495687_000628_26566_27249 220
374 3300048908 Ga0496105_0150388 Ga0496105_0150388_779_1444 220
375 3300048924 Ga0496121_0023384 Ga0496121_0023384_1634_2299 220
376 3300050489 nmdc:mga03683_37482_c1 nmdc:mga03683_37482_c1_1197_1880 220
377 3300050489 nmdc:mga03683_76125_c1 nmdc:mga03683_76125_c1_331_1011 220
378 3300050493 nmdc:mga0k408_159269_c1 nmdc:mga0k408_159269_c1_433_1116 220
379 3300050494 nmdc:mga06z11_20503_c1 nmdc:mga06z11_20503_c1_2325_3008 220
380 3300050496 nmdc:mga07m45_42168_c1 nmdc:mga07m45_42168_c1_1715_2398 220
381 3300005445 Ga0070708_100428296 Ga0070708_1004282961 221
382 3300005563 Ga0068855_100247887 Ga0068855_1002478872 221
383 3300005618 Ga0068864_100494558 Ga0068864_1004945581 221
384 3300006178 Ga0075367_10237994 Ga0075367_102379942 221
385 3300006195 Ga0075366_10001157 Ga0075366_100011573 221
386 3300006353 Ga0075370_10000766 Ga0075370_100007667 221
387 3300009101 Ga0105247_10356288 Ga0105247_103562882 221
388 3300025933 Ga0207706_10000499 Ga0207706_1000049939 221
389 3300037418 Ga0395900_0000025 Ga0395900_0000025_120729_121430 221
390 3300037466 Ga0395898_0000811 Ga0395898_0000811_9474_10148 221
391 3300044658 Ga0466972_0024741 Ga0466972_0024741_365_1051 221
392 3300044658 Ga0466972_0095882 Ga0466972_0095882_551_1249 221
393 3300044683 Ga0466965_0006107 Ga0466965_0006107_4653_5351 221
394 3300044684 Ga0466966_0041188 Ga0466966_0041188_2115_2783 221
395 3300044693 Ga0466961_0002147 Ga0466961_0002147_1333_2001 221
396 3300044694 Ga0466963_0002684 Ga0466963_0002684_6239_6907 221
397 3300044706 Ga0466964_0007187 Ga0466964_0007187_1864_2532 221
398 3300044706 Ga0466964_0027777 Ga0466964_0027777_1133_1801 221
399 3300044719 Ga0466971_0121205 Ga0466971_0121205_310_978 221
400 3300044765 Ga0466970_0003278 Ga0466970_0003278_5909_6577 221
401 3300044842 Ga0466957_0004566 Ga0466957_0004566_361_1029 221
402 3300045049 Ga0466959_0000041 Ga0466959_0000041_12344_13012 221
403 3300045976 Ga0466967_0033411 Ga0466967_0033411_3249_3917 221
404 3300050493 nmdc:mga0k408_31112_c1 nmdc:mga0k408_31112_c1_2253_2939 221
405 3300050496 nmdc:mga07m45_126_c1 nmdc:mga07m45_126_c1_25792_26478 221
406 3300050496 nmdc:mga07m45_28514_c1 nmdc:mga07m45_28514_c1_693_1379 221
407 3300005328 Ga0070676_10004911 Ga0070676_100049117 222
408 3300005330 Ga0070690_100015896 Ga0070690_1000158961 222
409 3300005331 Ga0070670_100080568 Ga0070670_1000805683 222
410 3300005334 Ga0068869_100116098 Ga0068869_1001160982 222
411 3300005354 Ga0070675_100188113 Ga0070675_1001881131 222
412 3300005456 Ga0070678_100926475 Ga0070678_1009264751 222
413 3300005457 Ga0070662_100081066 Ga0070662_1000810662 222
414 3300005543 Ga0070672_100163725 Ga0070672_1001637252 222
415 3300005563 Ga0068855_100709698 Ga0068855_1007096982 222
416 3300006881 Ga0068865_100043017 Ga0068865_1000430174 222
417 3300009098 Ga0105245_10212485 Ga0105245_102124852 222
418 3300011119 Ga0105246_10117958 Ga0105246_101179582 222
419 3300013308 Ga0157375_10014574 Ga0157375_100145745 222
420 3300025907 Ga0207645_10001536 Ga0207645_1000153621 222
421 3300025908 Ga0207643_10026228 Ga0207643_100262282 222
422 3300025927 Ga0207687_10368215 Ga0207687_103682152 222
423 3300025934 Ga0207686_10041390 Ga0207686_100413904 222
424 3300025938 Ga0207704_10003303 Ga0207704_100033034 222
425 3300025940 Ga0207691_10011060 Ga0207691_100110606 222
426 3300025941 Ga0207711_10646455 Ga0207711_106464552 222
427 3300025942 Ga0207689_10015550 Ga0207689_100155507 222
428 3300025942 Ga0207689_10103112 Ga0207689_101031122 222
429 3300025960 Ga0207651_10302511 Ga0207651_103025112 222
430 3300026121 Ga0207683_10601000 Ga0207683_106010001 222
431 3300031649 Ga0307514_10001022 Ga0307514_1000102224 222
432 3300031730 Ga0307516_10117316 Ga0307516_101173162 222
433 3300039447 Ga0436361_0609590 Ga0436361_0609590_7209_7895 222
434 3300042012 Ga0439455_0011499 Ga0439455_0011499_1007_1678 222
435 3300042157 Ga0439458_0050501 Ga0439458_0050501_14_685 222
436 3300006358 Ga0068871_100708154 Ga0068871_1007081542 223
437 3300013308 Ga0157375_10672776 Ga0157375_106727762 223
438 3300025900 Ga0207710_10064937 Ga0207710_100649372 223
439 3300028379 Ga0268266_10018969 Ga0268266_100189692 223
440 3300044656 Ga0466969_0000100 Ga0466969_0000100_23930_24634 223
441 3300045049 Ga0466959_0016403 Ga0466959_0016403_409_1113 223
442 3300046517 Ga0495630_0071863 Ga0495630_0071863_1794_2471 223
443 3300046519 Ga0495632_0260598 Ga0495632_0260598_62_739 223
444 3300046690 Ga0495624_0024912 Ga0495624_0024912_1962_2639 223
445 3300047673 Ga0495593_0052945 Ga0495593_0052945_1396_2073 223
446 3300049127 Ga0501306_006178 Ga0501306_006178_27_713 223
447 3300049129 Ga0501309_002339 Ga0501309_002339_1020_1706 223
448 3300031911 Ga0307412_10507324 Ga0307412_105073242 224
449 3300037471 Ga0395905_0012243 Ga0395905_0012243_3068_3760 224
450 3300041410 Ga0439461_0016736 Ga0439461_0016736_516_1202 224
451 3300041997 Ga0439431_0004245 Ga0439431_0004245_1215_1901 224
452 3300042435 Ga0439434_0017482 Ga0439434_0017482_1173_1859 224
453 3300042532 Ga0450893_0036380 Ga0450893_0036380_37_723 224
454 3300048927 Ga0496124_0000086 Ga0496124_0000086_90858_91568 224
455 3300048928 Ga0496125_0015950 Ga0496125_0015950_1029_1739 224
456 3300003792 Ga0055540_1011583 Ga0055540_10115833 226
457 3300013102 Ga0157371_10207005 Ga0157371_102070051 226
458 3300013306 Ga0163162_10348872 Ga0163162_103488722 226
459 3300025303 Ga0209051_1020564 Ga0209051_10205642 226
460 3300028794 Ga0307515_10038935 Ga0307515_100389352 226
461 3300031507 Ga0307509_10067221 Ga0307509_100672212 226
462 3300031730 Ga0307516_10000286 Ga0307516_100002863 226
463 3300042876 Ga0451577_0003093 Ga0451577_0003093_1535_2239 226
464 3300048912 Ga0496109_1007784 Ga0496109_1007784_39_719 226
465 3300002705 JGI25156J39149_1015859 JGI25156J39149_10158592 227
466 3300002738 JGI25154J39366_1000722 JGI25154J39366_100072215 227
467 3300002741 JGI25157J39369_1000018 JGI25157J39369_1000018150 227
468 3300002772 JGI25164J39214_1003494 JGI25164J39214_10034942 227
469 3300003323 rootH1_10004484 rootH1_100044844 227
470 3300003752 Ga0055539_1000283 Ga0055539_100028311 227
471 3300003752 Ga0055539_1001803 Ga0055539_10018032 227
472 3300003756 Ga0055533_1000103 Ga0055533_100010392 227
473 3300003759 Ga0055525_1001205 Ga0055525_10012052 227
474 3300003761 Ga0055535_1000822 Ga0055535_10008227 227
475 3300003763 Ga0055529_1000198 Ga0055529_100019859 227
476 3300005327 Ga0070658_10371771 Ga0070658_103717712 227
477 3300005329 Ga0070683_100256908 Ga0070683_1002569081 227
478 3300005366 Ga0070659_100302881 Ga0070659_1003028812 227
479 3300005459 Ga0068867_100360480 Ga0068867_1003604802 227
480 3300005563 Ga0068855_100003105 Ga0068855_10000310515 227
481 3300005563 Ga0068855_100043517 Ga0068855_1000435172 227
482 3300005577 Ga0068857_100003053 Ga0068857_1000030535 227
483 3300005578 Ga0068854_100008624 Ga0068854_1000086242 227
484 3300005614 Ga0068856_100005614 Ga0068856_1000056144 227
485 3300009093 Ga0105240_10048445 Ga0105240_100484452 227
486 3300009551 Ga0105238_10768369 Ga0105238_107683692 227
487 3300010375 Ga0105239_10039994 Ga0105239_100399942 227
488 3300013105 Ga0157369_10008425 Ga0157369_1000842512 227
489 3300015262 Ga0182007_10028861 Ga0182007_100288611 227
490 3300025226 Ga0209674_100003 Ga0209674_100003213 227
491 3300025230 Ga0209563_100141 Ga0209563_10014161 227
492 3300025231 Ga0207427_100546 Ga0207427_10054616 227
493 3300025242 Ga0209258_100044 Ga0209258_100044116 227
494 3300025246 Ga0209646_1000067 Ga0209646_100006784 227
495 3300025250 Ga0209026_1000033 Ga0209026_1000033146 227
496 3300025253 Ga0209677_100133 Ga0209677_10013342 227
497 3300025253 Ga0209677_100196 Ga0209677_10019634 227
498 3300025253 Ga0209677_102270 Ga0209677_1022704 227
499 3300025256 Ga0209759_1000024 Ga0209759_1000024146 227
500 3300025256 Ga0209759_1004001 Ga0209759_10040013 227
501 3300025256 Ga0209759_1005519 Ga0209759_10055192 227
502 3300025272 Ga0209455_1000048 Ga0209455_1000048116 227
503 3300025914 Ga0207671_10317904 Ga0207671_103179042 227
504 3300025919 Ga0207657_10044736 Ga0207657_100447365 227
505 3300025919 Ga0207657_10046860 Ga0207657_100468602 227
506 3300025924 Ga0207694_10006906 Ga0207694_100069067 227
507 3300025924 Ga0207694_10362390 Ga0207694_103623902 227
508 3300025927 Ga0207687_10177592 Ga0207687_101775922 227
509 3300025932 Ga0207690_10358448 Ga0207690_103584482 227
510 3300025944 Ga0207661_10045411 Ga0207661_100454112 227
511 3300025945 Ga0207679_10690624 Ga0207679_106906241 227
512 3300025949 Ga0207667_10015058 Ga0207667_100150582 227
513 3300025949 Ga0207667_10241082 Ga0207667_102410822 227
514 3300025949 Ga0207667_10436667 Ga0207667_104366672 227
515 3300025981 Ga0207640_10009925 Ga0207640_100099254 227
516 3300026078 Ga0207702_10001078 Ga0207702_1000107815 227
517 3300026116 Ga0207674_10005131 Ga0207674_100051315 227
518 3300028666 Ga0265336_10000053 Ga0265336_1000005338 227
519 3300029957 Ga0265324_10001024 Ga0265324_1000102410 227
520 3300030521 Ga0307511_10086935 Ga0307511_100869352 227
521 3300035691 Ga0373931_0007609 Ga0373931_0007609_3205_3888 227
522 3300035691 Ga0373931_0155635 Ga0373931_0155635_573_1256 227
523 3300038443 Ga0395901_0013605 Ga0395901_0013605_7074_7760 227
524 3300039437 Ga0436365_1861796 Ga0436365_1861796_25_708 227
525 3300046506 Ga0495583_0000159 Ga0495583_0000159_25577_26260 227
526 3300046507 Ga0495606_0003437 Ga0495606_0003437_5519_6202 227
527 3300046616 Ga0495668_0028187 Ga0495668_0028187_59_742 227
528 3300046660 Ga0495625_0011185 Ga0495625_0011185_2574_3257 227
529 3300046692 Ga0495671_0234591 Ga0495671_0234591_59_742 227
530 3300046694 Ga0495649_0001310 Ga0495649_0001310_7206_7889 227
531 3300046794 Ga0495589_0006046 Ga0495589_0006046_303_986 227
532 3300048903 Ga0496100_0107039 Ga0496100_0107039_225_911 227
533 3300048917 Ga0496114_0379298 Ga0496114_0379298_332_1015 227
534 3300048918 Ga0496115_0607802 Ga0496115_0607802_132_815 227
535 3300048929 Ga0496126_0365800 Ga0496126_0365800_218_901 227
536 3300050493 nmdc:mga0k408_15903_c1 nmdc:mga0k408_15903_c1_97_780 227
537 3300053080 Ga0500635_0000035 Ga0500635_0000035_73879_74562 227
538 3300053136 Ga0500559_0006966 Ga0500559_0006966_2296_2979 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03975

CheD

CheD chemotactic sensory transduction

106

203

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9z-assembly2.cif.gz_D complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima 0.8585 54 194
2f9z-assembly2.cif.gz_D complex between the chemotaxis deamidase ched and the chemotaxis phosphatase chec from thermotoga maritima 0.7847 54 194
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6759 135 175
1xfj-assembly1.cif.gz_A crystal structure of protein cc_0490 from caulobacter crescentus, pfam duf152 0.6737 62 173
6n4y-assembly4.cif.gz_D metabotropic glutamate receptor 5 extracellular domain with nb43 0.6594 135 175
ID Description Score Start End Superfamily
2f9zD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; 0.8585 54 194 3.30.1330.200
af_Q8IV20_177_430_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.8069 62 139 3.60.140.10
2f9zD00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; 0.7847 54 194 3.30.1330.200
3hutA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7457 135 175 3.40.50.2300
af_Q7KIS4_37_307_3.30.1330.200 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;; 0.708 54 190 3.30.1330.200
ID Description Score Start End GO Terms
AF-A0A850QA06-F1-model_v4 Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) 0.9387 54 198 GO:0006935
GO:0050568
AF-A0A7Y2TUH6-F1-model_v4 Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) 0.9299 54 198 GO:0006935
GO:0050568
AF-A0A352V8Y5-F1-model_v4 Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) 0.9283 54 197 GO:0006935
GO:0050568
AF-A0A4Q4BQ35-F1-model_v4 Chemotaxis protein CheD 0.9271 64 198 GO:0006935
GO:0050568
AF-A0A4Y1YNR2-F1-model_v4 Probable chemoreceptor glutamine deamidase CheD (EC 3.5.1.44) 0.9217 35 199 GO:0006935
GO:0050568

Feature Viewer

pLDDT pTM Quality
80.08 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map