F460952

General Info

Members Datasets Scaffolds Average Seq Length
537 267 536 171

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0000980|Ga0496121_0000980_27816_28445
Length 209
Sequence MSKTSALGARWPDIFFQSFAWNNVRVIDFLSGAKQQEDVMATNTFTDAIALLKADHRKVEELFDQFETRKAATKKQQIAHQICTELKIHTSIEEEIFYPAFRGKIEDDTLDEAYVEHDGAKVLINDIEAGSAEDDFYAAKVKVLSEEVKHHVHEEEMPSEGMFAQCRKTDVDLVALRDQMMARKEELLALATTSGLPAAKPSVVNLIAA

Samples

Sample ID Description Type Environment
1 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
90 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
165 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
166 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
167 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
168 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
174 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
177 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
178 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
181 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
182 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
186 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
187 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
191 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
192 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
196 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
224 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
225 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
228 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
232 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
233 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
236 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
237 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
238 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
239 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
240 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
247 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
251 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
252 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
253 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
254 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
259 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
264 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
265 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
266 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
267 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 1.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.98
Nodule 0.37
Rhizoplane 1.68
Rhizosphere 57.91
Stem 0
Stem Tuber 0
Unclassified 10.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c002125 3300000041 Bacteria 1870
2 ARcpr5yngRDRAFT_c004603 3300000043 Bacteria 1299
3 ARCol0yngRDRAFT_1004974 3300000652 Bacteria 958
4 JGI24736J21556_1000150 3300001904 Bacteria 12238
5 JGI24741J21665_1001648 3300001915 Bacteria 6219
6 JGI24741J21665_1001888 3300001915 Bacteria 5688
7 JGI24740J21852_10008802 3300001979 Bacteria 4001
8 JGI24740J21852_10012416 3300001979 Bacteria 3210
9 JGI24739J22299_10000517 3300001989 Bacteria 13765
10 JGI24739J22299_10029931 3300001989 Bacteria 1890
11 JGI24739J22299_10056979 3300001989 Bacteria 1245
12 JGI24735J21928_10052048 3300002067 Bacteria 1181
13 JGI24738J21930_10003757 3300002075 Bacteria 3793
14 JGI24738J21930_10009583 3300002075 Bacteria 2175
15 JGI24738J21930_10065527 3300002075 Bacteria 748
16 JGI25152J39213_1015597 3300002773 Bacteria 1494
17 JGI25152J39213_1016924 3300002773 Bacteria 1390
18 JGI25150J39212_1000140 3300002774 Bacteria 40705
19 JGI25150J39212_1000202 3300002774 Bacteria 32734
20 JGI25150J39212_1023255 3300002774 Bacteria 923
21 JGI25151J46595_10007315 3300003187 Bacteria 5431
22 JGI25151J46595_10035761 3300003187 Bacteria 1882
23 JGI25153J46596_10000064 3300003215 Bacteria 125642
24 JGI25153J46596_10000109 3300003215 Bacteria 93661
25 JGI25153J46596_10005166 3300003215 Bacteria 6875
26 JGI25153J46596_10050931 3300003215 Bacteria 1190
27 rootH2_10100151 3300003320 Bacteria 2293
28 Ga0055526_1001044 3300003771 Bacteria 20207
29 Ga0055526_1009741 3300003771 Bacteria 4572
30 Ga0055537_1001276 3300003773 Bacteria 10463
31 Ga0055537_1002857 3300003773 Bacteria 5535
32 Ga0055537_1003817 3300003773 Bacteria 4513
33 Ga0055524_1000276 3300003775 Bacteria 50977
34 Ga0055524_1000416 3300003775 Bacteria 35958
35 Ga0055536_1015352 3300003781 Bacteria 2627
36 Ga0055536_1048563 3300003781 Bacteria 948
37 Ga0055528_1012095 3300003790 Bacteria 3376
38 Ga0055528_1018315 3300003790 Bacteria 2378
39 Ga0055528_1045654 3300003790 Bacteria 932
40 Ga0055530_10001271 3300003791 Bacteria 19049
41 Ga0055530_10005032 3300003791 Bacteria 6504
42 Ga0055530_10007090 3300003791 Bacteria 4809
43 Ga0055530_10027406 3300003791 Bacteria 1557
44 Ga0055540_1000185 3300003792 Bacteria 60356
45 Ga0055540_1000667 3300003792 Bacteria 23816
46 Ga0055531_10000088 3300003794 Bacteria 100973
47 Ga0055531_10000260 3300003794 Bacteria 55686
48 Ga0055531_10001272 3300003794 Bacteria 19049
49 Ga0055531_10002774 3300003794 Bacteria 11500
50 Ga0055531_10009307 3300003794 Bacteria 5038
51 Ga0055531_10012145 3300003794 Bacteria 4078
52 Ga0055531_10027193 3300003794 Bacteria 2014
53 Ga0065165_1000712 3300005262 Bacteria 46910
54 Ga0065165_1003761 3300005262 Bacteria 10189
55 Ga0065165_1004847 3300005262 Bacteria 7999
56 Ga0065165_1013993 3300005262 Bacteria 3142
57 Ga0065704_10001975 3300005289 Bacteria 9225
58 Ga0065704_10089679 3300005289 Bacteria 2818
59 Ga0065704_10188778 3300005289 Bacteria 1200
60 Ga0065704_10307525 3300005289 Bacteria 852
61 Ga0065707_10091281 3300005295 Bacteria 3974
62 Ga0065707_10245414 3300005295 Bacteria 1142
63 Ga0070658_10289940 3300005327 Bacteria 1394
64 Ga0070670_100013816 3300005331 Bacteria 6922
65 Ga0070666_10022481 3300005335 Bacteria 4094
66 Ga0070666_10387827 3300005335 Bacteria 1003
67 Ga0070682_100936421 3300005337 Bacteria 714
68 Ga0070660_100061185 3300005339 Bacteria 2923
69 Ga0070661_100126523 3300005344 Bacteria 1917
70 Ga0070668_100001336 3300005347 Bacteria 17622
71 Ga0070668_100005107 3300005347 Bacteria 9722
72 Ga0070668_100019637 3300005347 Bacteria 5088
73 Ga0070668_100028523 3300005347 Bacteria 4237
74 Ga0070669_100022424 3300005353 Bacteria 4513
75 Ga0070669_100028373 3300005353 Bacteria 4031
76 Ga0070669_100055411 3300005353 Bacteria 2905
77 Ga0070671_100114959 3300005355 Bacteria 2262
78 Ga0070659_100212753 3300005366 Bacteria 1593
79 Ga0070667_100000062 3300005367 Bacteria 143729
80 Ga0070667_100000195 3300005367 Bacteria 72280
81 Ga0070663_100052471 3300005455 Bacteria 2908
82 Ga0070663_100590755 3300005455 Bacteria 933
83 Ga0070662_100080675 3300005457 Bacteria 2423
84 Ga0070662_101283154 3300005457 Bacteria 630
85 Ga0070685_10025294 3300005466 Bacteria 3268
86 Ga0068853_100057594 3300005539 Bacteria 3354
87 Ga0068853_100393282 3300005539 Bacteria 1296
88 Ga0070665_100001120 3300005548 Bacteria 32952
89 Ga0070665_100702992 3300005548 Bacteria 1024
90 Ga0068855_100040340 3300005563 Bacteria 5542
91 Ga0068855_100321773 3300005563 Bacteria 1709
92 Ga0068855_100498095 3300005563 Bacteria 1324
93 Ga0070664_100075897 3300005564 Bacteria 2887
94 Ga0068857_100034972 3300005577 Bacteria 4446
95 Ga0068857_100307270 3300005577 Bacteria 1463
96 Ga0068854_100018351 3300005578 Bacteria 4696
97 Ga0068854_100120760 3300005578 Bacteria 1989
98 Ga0068856_100047754 3300005614 Bacteria 4218
99 Ga0068852_100001556 3300005616 Bacteria 15590
100 Ga0068859_100048969 3300005617 Bacteria 4244
101 Ga0068864_100000088 3300005618 Bacteria 98366
102 Ga0068864_100132283 3300005618 Bacteria 2242
103 Ga0068861_100026356 3300005719 Bacteria 4225
104 Ga0068851_10218629 3300005834 Bacteria 1069
105 Ga0068863_100000016 3300005841 Bacteria 213575
106 Ga0068863_100000054 3300005841 Bacteria 124495
107 Ga0068860_100000168 3300005843 Bacteria 107408
108 Ga0068860_100000284 3300005843 Bacteria 72294
109 Ga0068860_100018339 3300005843 Bacteria 6809
110 Ga0068862_100011038 3300005844 Bacteria 7461
111 Ga0068862_100236778 3300005844 Bacteria 1658
112 Ga0075368_10000072 3300006042 Bacteria 24174
113 Ga0075368_10000110 3300006042 Bacteria 21315
114 Ga0075363_100000003 3300006048 Bacteria 61893
115 Ga0075363_100010361 3300006048 Bacteria 4423
116 Ga0075364_10000536 3300006051 Bacteria 19351
117 Ga0075362_10000048 3300006177 Bacteria 40628
118 Ga0075367_10000060 3300006178 Bacteria 26825
119 Ga0075367_10000121 3300006178 Bacteria 22681
120 Ga0075369_10000658 3300006186 Bacteria 10998
121 Ga0075366_10023707 3300006195 Bacteria 3576
122 Ga0075366_10046391 3300006195 Bacteria 2575
123 Ga0075366_10138025 3300006195 Bacteria 1473
124 Ga0075370_10007829 3300006353 Bacteria 5464
125 Ga0075370_10053931 3300006353 Bacteria 2282
126 Ga0097620_100048968 3300006931 Bacteria 4244
127 Ga0099826_10191341 3300006948 Bacteria 1129
128 Ga0105251_10113816 3300009011 Bacteria 1231
129 Ga0105240_10008865 3300009093 Bacteria 14316
130 Ga0105240_10016433 3300009093 Bacteria 10020
131 Ga0105240_10514901 3300009093 Bacteria 1328
132 Ga0105243_10471340 3300009148 Bacteria 1183
133 Ga0105241_10010587 3300009174 Bacteria 6765
134 Ga0105242_11267554 3300009176 Bacteria 759
135 Ga0105248_10050467 3300009177 Bacteria 4666
136 Ga0105248_10061725 3300009177 Bacteria 4209
137 Ga0105248_10910580 3300009177 Bacteria 993
138 Ga0105237_10021790 3300009545 Bacteria 6582
139 Ga0105238_10162188 3300009551 Bacteria 2211
140 Ga0105238_10210568 3300009551 Bacteria 1920
141 Ga0105238_11479457 3300009551 Bacteria 707
142 Ga0105249_10386795 3300009553 Bacteria 1426
143 Ga0105249_10490351 3300009553 Bacteria 1272
144 Ga0105148_100031 3300009978 Bacteria 20228
145 Ga0105239_10001630 3300010375 Bacteria 29606
146 Ga0105246_11339301 3300011119 Bacteria 665
147 Ga0157371_10076545 3300013102 Bacteria 2369
148 Ga0157370_10046826 3300013104 Bacteria 4146
149 Ga0157370_10664947 3300013104 Bacteria 952
150 Ga0157369_10064755 3300013105 Bacteria 3936
151 Ga0157369_10252886 3300013105 Bacteria 1839
152 Ga0157374_10721522 3300013296 Bacteria 1011
153 Ga0157378_10001980 3300013297 Bacteria 18324
154 Ga0163162_10065679 3300013306 Bacteria 3676
155 Ga0157372_10432581 3300013307 Bacteria 1534
156 Ga0157375_11041419 3300013308 Bacteria 956
157 Ga0157380_10000976 3300014326 Bacteria 18134
158 Ga0157380_10013963 3300014326 Bacteria 5864
159 Ga0163161_10104155 3300017792 Bacteria 2115
160 Ga0163161_10112078 3300017792 Bacteria 2041
161 Ga0163161_10170207 3300017792 Bacteria 1665
162 Ga0206356_11335779 3300020070 Bacteria 661
163 Ga0206349_1066120 3300020075 Bacteria 649
164 Ga0206355_1538906 3300020076 Bacteria 823
165 Ga0206351_10972283 3300020077 Bacteria 757
166 Ga0206352_10880385 3300020078 Bacteria 709
167 Ga0206354_11150845 3300020081 Bacteria 653
168 Ga0154015_1405376 3300020610 Bacteria 717
169 Ga0209147_100926 3300025229 Bacteria 13115
170 Ga0209147_101263 3300025229 Bacteria 9908
171 Ga0207425_1000073 3300025245 Bacteria 113233
172 Ga0207425_1000095 3300025245 Bacteria 84955
173 Ga0207425_1012800 3300025245 Bacteria 1955
174 Ga0209129_1000435 3300025258 Bacteria 31097
175 Ga0209129_1001494 3300025258 Bacteria 13003
176 Ga0209565_1000008 3300025263 Bacteria 774179
177 Ga0209565_1000010 3300025263 Bacteria 687724
178 Ga0209565_1000062 3300025263 Bacteria 184007
179 Ga0209565_1000206 3300025263 Bacteria 68867
180 Ga0209565_1026100 3300025263 Bacteria 1175
181 Ga0209673_1001509 3300025273 Bacteria 21455
182 Ga0209673_1006714 3300025273 Bacteria 5488
183 Ga0209673_1028751 3300025273 Bacteria 1783
184 Ga0209673_1038661 3300025273 Bacteria 1386
185 Ga0209675_1016592 3300025291 Bacteria 2136
186 Ga0209675_1021346 3300025291 Bacteria 1729
187 Ga0209675_1064216 3300025291 Bacteria 716
188 Ga0209676_1000288 3300025292 Bacteria 103217
189 Ga0209676_1000588 3300025292 Bacteria 54210
190 Ga0209676_1001454 3300025292 Bacteria 22208
191 Ga0209025_1000202 3300025294 Bacteria 145750
192 Ga0209025_1000421 3300025294 Bacteria 84693
193 Ga0209564_1000378 3300025295 Bacteria 81676
194 Ga0209564_1001476 3300025295 Bacteria 23770
195 Ga0209564_1006959 3300025295 Bacteria 5939
196 Ga0209758_1000019 3300025297 Bacteria 743682
197 Ga0209758_1000242 3300025297 Bacteria 113233
198 Ga0209758_1002052 3300025297 Bacteria 21592
199 Ga0209758_1008054 3300025297 Bacteria 6956
200 Ga0209758_1021546 3300025297 Bacteria 3000
201 Ga0209758_1029035 3300025297 Bacteria 2324
202 Ga0209050_1000001 3300025298 Bacteria 3563507
203 Ga0209050_1000619 3300025298 Bacteria 55726
204 Ga0209050_1002682 3300025298 Bacteria 14509
205 Ga0209050_1003221 3300025298 Bacteria 12348
206 Ga0209050_1006051 3300025298 Bacteria 7325
207 Ga0209256_1000009 3300025299 Bacteria 922071
208 Ga0209256_1000010 3300025299 Bacteria 912110
209 Ga0209256_1000293 3300025299 Bacteria 87792
210 Ga0207426_1028300 3300025302 Bacteria 1859
211 Ga0207426_1059224 3300025302 Bacteria 1108
212 Ga0209051_1000193 3300025303 Bacteria 108391
213 Ga0209051_1000209 3300025303 Bacteria 102832
214 Ga0209051_1003122 3300025303 Bacteria 11163
215 Ga0209051_1035551 3300025303 Bacteria 1852
216 Ga0209257_1000111 3300025304 Bacteria 234809
217 Ga0209257_1000551 3300025304 Bacteria 64327
218 Ga0209257_1001505 3300025304 Bacteria 27373
219 Ga0209257_1001533 3300025304 Bacteria 26941
220 Ga0209257_1001950 3300025304 Bacteria 22274
221 Ga0209257_1005579 3300025304 Bacteria 8743
222 Ga0209257_1008081 3300025304 Bacteria 6123
223 Ga0209257_1084734 3300025304 Bacteria 805
224 Ga0207656_10120580 3300025321 Bacteria 1220
225 Ga0207713_1075333 3300025735 Bacteria 1231
226 Ga0207680_10011928 3300025903 Bacteria 4411
227 Ga0207647_10039943 3300025904 Bacteria 2958
228 Ga0207705_10051672 3300025909 Bacteria 2958
229 Ga0207654_10212672 3300025911 Bacteria 1279
230 Ga0207695_10012916 3300025913 Bacteria 9994
231 Ga0207695_10058776 3300025913 Bacteria 3991
232 Ga0207671_10004540 3300025914 Bacteria 13190
233 Ga0207671_10256428 3300025914 Bacteria 1376
234 Ga0207657_10016794 3300025919 Bacteria 7047
235 Ga0207681_10019166 3300025923 Bacteria 4321
236 Ga0207681_10039619 3300025923 Bacteria 3130
237 Ga0207694_10085891 3300025924 Bacteria 2477
238 Ga0207694_10259529 3300025924 Bacteria 1423
239 Ga0207650_10015123 3300025925 Bacteria 5370
240 Ga0207690_10073383 3300025932 Bacteria 2366
241 Ga0207706_10029825 3300025933 Bacteria 4868
242 Ga0207706_10887088 3300025933 Bacteria 754
243 Ga0207711_10095352 3300025941 Bacteria 2624
244 Ga0207711_10139966 3300025941 Bacteria 2176
245 Ga0207711_10249746 3300025941 Bacteria 1629
246 Ga0207661_10509935 3300025944 Bacteria 1099
247 Ga0207667_10105802 3300025949 Bacteria 2903
248 Ga0207667_10270753 3300025949 Bacteria 1736
249 Ga0207712_10018015 3300025961 Bacteria 4595
250 Ga0207712_10225421 3300025961 Bacteria 1501
251 Ga0207712_10828726 3300025961 Bacteria 814
252 Ga0207668_10000924 3300025972 Bacteria 17639
253 Ga0207668_10001714 3300025972 Bacteria 12826
254 Ga0207668_10038877 3300025972 Bacteria 3197
255 Ga0207668_10079978 3300025972 Bacteria 2366
256 Ga0207640_10012692 3300025981 Bacteria 4806
257 Ga0207640_10132772 3300025981 Bacteria 1802
258 Ga0207640_10924260 3300025981 Bacteria 763
259 Ga0207658_10000039 3300025986 Bacteria 143707
260 Ga0207658_10000279 3300025986 Bacteria 53475
261 Ga0207639_10001103 3300026041 Bacteria 18327
262 Ga0207639_10003148 3300026041 Bacteria 11093
263 Ga0207639_10207004 3300026041 Bacteria 1686
264 Ga0207639_10325529 3300026041 Bacteria 1366
265 Ga0207639_11276231 3300026041 Bacteria 689
266 Ga0207678_10013773 3300026067 Bacteria 7105
267 Ga0207678_10143631 3300026067 Bacteria 2037
268 Ga0207702_10031905 3300026078 Bacteria 4394
269 Ga0207641_10000095 3300026088 Bacteria 124498
270 Ga0207641_10000315 3300026088 Bacteria 60017
271 Ga0207641_10011272 3300026088 Bacteria 7333
272 Ga0207676_10000146 3300026095 Bacteria 61729
273 Ga0207676_10557578 3300026095 Bacteria 1095
274 Ga0207674_10000748 3300026116 Bacteria 42600
275 Ga0207674_10348765 3300026116 Bacteria 1431
276 Ga0207675_100111951 3300026118 Bacteria 2576
277 Ga0207698_10027801 3300026142 Bacteria 4021
278 Ga0207698_10031490 3300026142 Bacteria 3828
279 Ga0209371_1042637 3300027312 Bacteria 912
280 Ga0209282_1205568 3300027666 Bacteria 903
281 Ga0209813_10000018 3300027866 Bacteria 75656
282 Ga0209813_10000070 3300027866 Bacteria 38898
283 Ga0268266_10004104 3300028379 Bacteria 14067
284 Ga0268266_10015509 3300028379 Bacteria 6536
285 Ga0268266_10378504 3300028379 Bacteria 1335
286 Ga0268265_10249775 3300028380 Bacteria 1570
287 Ga0268265_10602618 3300028380 Bacteria 1050
288 Ga0268264_10000040 3300028381 Bacteria 373714
289 Ga0268264_10000337 3300028381 Bacteria 72308
290 Ga0268264_10006874 3300028381 Bacteria 9548
291 Ga0268264_11223732 3300028381 Bacteria 761
292 Ga0265338_10373704 3300028800 Bacteria 1021
293 Ga0268256_1048230 3300030500 Bacteria 912
294 Ga0265331_10043123 3300031250 Bacteria 2186
295 Ga0307408_100049519 3300031548 Bacteria 3018
296 Ga0307408_100105106 3300031548 Bacteria 2158
297 Ga0307405_10045470 3300031731 Bacteria 2691
298 Ga0307405_10230287 3300031731 Bacteria 1365
299 Ga0307405_10457219 3300031731 Bacteria 1014
300 Ga0307413_10028648 3300031824 Bacteria 3105
301 Ga0307413_10217660 3300031824 Bacteria 1392
302 Ga0307413_10382340 3300031824 Bacteria 1097
303 Ga0307413_10610252 3300031824 Bacteria 894
304 Ga0307410_10147209 3300031852 Bacteria 1749
305 Ga0307406_10150356 3300031901 Bacteria 1660
306 Ga0307406_10550010 3300031901 Bacteria 944
307 Ga0307407_10227774 3300031903 Bacteria 1264
308 Ga0307412_10044068 3300031911 Bacteria 2909
309 Ga0307412_10055930 3300031911 Bacteria 2627
310 Ga0307412_10110948 3300031911 Bacteria 1958
311 Ga0307412_10210710 3300031911 Bacteria 1482
312 Ga0307412_10989597 3300031911 Bacteria 742
313 Ga0307412_11333108 3300031911 Bacteria 647
314 Ga0307409_100080191 3300031995 Bacteria 2633
315 Ga0307409_100269579 3300031995 Bacteria 1567
316 Ga0307409_100722406 3300031995 Bacteria 997
317 Ga0307416_100115728 3300032002 Bacteria 2375
318 Ga0307416_100183320 3300032002 Bacteria 1965
319 Ga0307416_101054622 3300032002 Bacteria 917
320 Ga0307416_101727726 3300032002 Bacteria 730
321 Ga0307414_10071381 3300032004 Bacteria 2504
322 Ga0307414_10894099 3300032004 Bacteria 814
323 Ga0307411_10118637 3300032005 Bacteria 1909
324 Ga0307411_10254232 3300032005 Bacteria 1383
325 Ga0307411_10615948 3300032005 Bacteria 935
326 Ga0307411_11004862 3300032005 Bacteria 747
327 Ga0307415_100660734 3300032126 Bacteria 938
328 Ga0237819_01265 3300038705 Bacteria 6937
329 Ga0439436_0025403 3300041404 Bacteria 1740
330 Ga0439439_0040776 3300041406 Bacteria 1202
331 Ga0439461_0000552 3300041410 Bacteria 5430
332 Ga0439461_0049546 3300041410 Bacteria 928
333 Ga0439465_0000182 3300041413 Bacteria 16171
334 Ga0439465_0001027 3300041413 Bacteria 8889
335 Ga0451791_1112956 3300041451 Bacteria 644
336 Ga0451793_0250625 3300041452 Bacteria 784
337 Ga0451802_1705853 3300041460 Bacteria 754
338 Ga0451837_0324922 3300041494 Bacteria 622
339 Ga0451843_1101219 3300041509 Bacteria 1016
340 Ga0439431_0001452 3300041997 Bacteria 5238
341 Ga0439431_0005865 3300041997 Bacteria 2713
342 Ga0439445_0012307 3300042004 Bacteria 2053
343 Ga0439445_0012778 3300042004 Bacteria 2022
344 Ga0439445_0022655 3300042004 Bacteria 1585
345 Ga0439445_0175612 3300042004 Bacteria 628
346 Ga0439432_000375 3300042006 Bacteria 16484
347 Ga0439449_0038369 3300042007 Bacteria 1781
348 Ga0439452_062964 3300042010 Bacteria 828
349 Ga0439457_042048 3300042014 Bacteria 1019
350 Ga0439462_0002527 3300042015 Bacteria 4263
351 Ga0439462_0013022 3300042015 Bacteria 2129
352 Ga0450912_001740 3300042116 Bacteria 1380
353 Ga0450920_025405 3300042122 Bacteria 1154
354 Ga0450898_114462 3300042134 Bacteria 572
355 Ga0439446_0068365 3300042156 Bacteria 1083
356 Ga0439434_0000263 3300042435 Bacteria 14861
357 Ga0439434_0009302 3300042435 Bacteria 2887
358 Ga0495617_129675 3300046452 Bacteria 809
359 Ga0495627_053212 3300046453 Bacteria 1212
360 Ga0495627_126914 3300046453 Bacteria 719
361 Ga0495638_0086197 3300046460 Bacteria 1898
362 Ga0495638_0086228 3300046460 Bacteria 1898
363 Ga0495638_0453740 3300046460 Bacteria 654
364 Ga0495650_0096049 3300046471 Bacteria 1119
365 Ga0495596_0000543 3300046500 Bacteria 23656
366 Ga0495607_0105495 3300046501 Bacteria 1502
367 Ga0495583_0000054 3300046506 Bacteria 208592
368 Ga0495583_0000236 3300046506 Bacteria 91911
369 Ga0495583_0035686 3300046506 Bacteria 2371
370 Ga0495583_0102652 3300046506 Bacteria 1219
371 Ga0495606_0002566 3300046507 Bacteria 20851
372 Ga0495606_0050205 3300046507 Bacteria 2730
373 Ga0495606_0067017 3300046507 Bacteria 2274
374 Ga0495610_0001035 3300046512 Bacteria 25555
375 Ga0495610_0017208 3300046512 Bacteria 4126
376 Ga0495616_0000066 3300046513 Bacteria 90234
377 Ga0495632_0000722 3300046519 Bacteria 30013
378 Ga0495637_0000036 3300046520 Bacteria 122003
379 Ga0495643_0000037 3300046522 Bacteria 237688
380 Ga0495643_0042862 3300046522 Bacteria 2464
381 Ga0495648_0011837 3300046524 Bacteria 6544
382 Ga0495663_0000001 3300046525 Bacteria 595264
383 Ga0495663_0057764 3300046525 Bacteria 1214
384 Ga0495663_0122722 3300046525 Bacteria 871
385 Ga0495654_0000418 3300046530 Bacteria 36299
386 Ga0495598_0040021 3300046537 Bacteria 1365
387 Ga0495609_0005526 3300046538 Bacteria 6608
388 Ga0495621_0166950 3300046539 Bacteria 873
389 Ga0495597_0070616 3300046542 Bacteria 1505
390 Ga0495633_0000179 3300046558 Bacteria 82201
391 Ga0495633_0045861 3300046558 Bacteria 2069
392 Ga0495633_0073804 3300046558 Bacteria 1590
393 Ga0495633_0125959 3300046558 Bacteria 1185
394 Ga0495668_0002154 3300046616 Bacteria 16905
395 Ga0495668_0023152 3300046616 Bacteria 3545
396 Ga0495668_0073891 3300046616 Bacteria 1872
397 Ga0495625_0052732 3300046660 Bacteria 2911
398 Ga0495625_0061678 3300046660 Bacteria 2653
399 Ga0495625_0178734 3300046660 Bacteria 1413
400 Ga0495670_0000034 3300046691 Bacteria 80461
401 Ga0495671_0000004 3300046692 Bacteria 545630
402 Ga0495671_0000025 3300046692 Bacteria 240277
403 Ga0495671_0000045 3300046692 Bacteria 159097
404 Ga0495671_0020076 3300046692 Bacteria 3525
405 Ga0495671_0197582 3300046692 Bacteria 976
406 Ga0495673_0000021 3300047469 Bacteria 545523
407 Ga0495673_0000063 3300047469 Bacteria 225912
408 Ga0495673_0094367 3300047469 Bacteria 1218
409 Ga0495681_0000036 3300047470 Bacteria 124207
410 Ga0495686_0000245 3300047472 Bacteria 97784
411 Ga0495686_0001354 3300047472 Bacteria 27379
412 Ga0495686_0001864 3300047472 Bacteria 21160
413 Ga0495686_0260660 3300047472 Bacteria 970
414 Ga0495686_0394604 3300047472 Bacteria 744
415 Ga0495626_0004465 3300048091 Bacteria 8580
416 Ga0496101_0653397 3300048904 Bacteria 831
417 Ga0496104_0111336 3300048907 Bacteria 2625
418 Ga0496108_0003893 3300048911 Bacteria 11988
419 Ga0496109_0070619 3300048912 Bacteria 3205
420 Ga0496111_0269522 3300048914 Bacteria 1263
421 Ga0496113_0031380 3300048916 Bacteria 3856
422 Ga0496116_0000976 3300048919 Bacteria 35105
423 Ga0496116_0024603 3300048919 Bacteria 4448
424 Ga0496117_0005672 3300048920 Bacteria 13009
425 Ga0496117_0086754 3300048920 Bacteria 2032
426 Ga0496118_0003499 3300048921 Bacteria 19694
427 Ga0496118_0019597 3300048921 Bacteria 6040
428 Ga0496118_0031285 3300048921 Bacteria 4415
429 Ga0496118_0173579 3300048921 Bacteria 1313
430 Ga0496118_0187908 3300048921 Bacteria 1239
431 Ga0496119_0255290 3300048922 Bacteria 882
432 Ga0496119_0261067 3300048922 Bacteria 869
433 Ga0496120_0047341 3300048923 Bacteria 2480
434 Ga0496120_0110482 3300048923 Bacteria 1437
435 Ga0496120_0290027 3300048923 Bacteria 753
436 Ga0496121_0000980 3300048924 Bacteria 51090
437 Ga0496121_0002091 3300048924 Bacteria 31505
438 Ga0496121_0004175 3300048924 Bacteria 19748
439 Ga0496121_0005584 3300048924 Bacteria 16063
440 Ga0496121_0014298 3300048924 Bacteria 8439
441 Ga0496121_0028465 3300048924 Bacteria 5200
442 Ga0496122_0000094 3300048925 Bacteria 202047
443 Ga0496122_0004599 3300048925 Bacteria 16989
444 Ga0496122_0267232 3300048925 Bacteria 945
445 Ga0496122_0375015 3300048925 Bacteria 732
446 Ga0496122_0478206 3300048925 Bacteria 611
447 Ga0496123_0000626 3300048926 Bacteria 59189
448 Ga0496123_0011325 3300048926 Bacteria 7746
449 Ga0496123_0123699 3300048926 Bacteria 1449
450 Ga0496123_0229462 3300048926 Bacteria 930
451 Ga0496123_0255524 3300048926 Bacteria 862
452 Ga0496123_0333982 3300048926 Bacteria 711
453 Ga0496124_0007774 3300048927 Bacteria 11325
454 Ga0496124_0011656 3300048927 Bacteria 8773
455 Ga0496124_0012526 3300048927 Bacteria 8362
456 Ga0496124_0024753 3300048927 Bacteria 5450
457 Ga0496124_0028123 3300048927 Bacteria 5032
458 Ga0496124_0047335 3300048927 Bacteria 3679
459 Ga0496124_0152327 3300048927 Bacteria 1812
460 Ga0496124_0863429 3300048927 Unclassified 553
461 Ga0496125_0015761 3300048928 Bacteria 7287
462 Ga0496125_0026092 3300048928 Bacteria 5335
463 Ga0496125_0030376 3300048928 Bacteria 4835
464 Ga0496125_0031310 3300048928 Bacteria 4742
465 Ga0496125_0031816 3300048928 Bacteria 4695
466 Ga0496125_0054551 3300048928 Bacteria 3265
467 Ga0496125_0156750 3300048928 Bacteria 1554
468 Ga0496125_0253650 3300048928 Bacteria 1108
469 Ga0496126_0000517 3300048929 Bacteria 75042
470 Ga0496126_0057729 3300048929 Bacteria 3502
471 Ga0496126_0292503 3300048929 Bacteria 1346
472 Ga0495678_054690 3300049459 Bacteria 1527
473 Ga0501335_004394 3300049551 Bacteria 1230
474 Ga0501034_0001122 3300049571 Bacteria 37416
475 Ga0501043_0013634 3300049579 Bacteria 6360
476 Ga0501206_010182 3300049653 Bacteria 1257
477 Ga0501211_001557 3300049658 Bacteria 2455
478 Ga0501223_000084 3300049663 Bacteria 28507
479 Ga0501235_099629 3300049669 Bacteria 708
480 Ga0501242_032367 3300049674 Bacteria 713
481 Ga0501255_009650 3300049684 Bacteria 1075
482 Ga0501221_029127 3300049704 Bacteria 1141
483 Ga0501225_0000044 3300049705 Bacteria 41695
484 Ga0501225_0000352 3300049705 Bacteria 14565
485 Ga0501225_0019805 3300049705 Bacteria 1860
486 Ga0501281_02702 3300049777 Bacteria 1283
487 nmdc:mga03683_45_c1 3300050489 Bacteria 58869
488 nmdc:mga03n38_24821_c1 3300050490 Bacteria 2455
489 nmdc:mga03n38_2_c1 3300050490 Bacteria 83515
490 nmdc:mga00v17_20_c1 3300050491 Bacteria 110672
491 nmdc:mga00v17_324461_c1 3300050491 Bacteria 1000
492 nmdc:mga0k408_17584_c1 3300050493 Bacteria 3985
493 nmdc:mga0k408_19280_c1 3300050493 Bacteria 3810
494 nmdc:mga0k408_19601_c1 3300050493 Bacteria 3782
495 nmdc:mga06z11_29_c1 3300050494 Bacteria 60343
496 nmdc:mga06z11_88_c1 3300050494 Bacteria 38889
497 nmdc:mga04h51_51_c1 3300050495 Bacteria 37763
498 nmdc:mga04h51_68_c1 3300050495 Bacteria 33109
499 nmdc:mga07m45_22189_c1 3300050496 Bacteria 3464
500 nmdc:mga07m45_24_c1 3300050496 Bacteria 110671
501 nmdc:mga07m45_464050_c1 3300050496 Bacteria 734
502 nmdc:mga0sz30_160_c1 3300050516 Bacteria 24830
503 Ga0500643_000226 3300053087 Bacteria 52820
504 Ga0500643_000244 3300053087 Bacteria 49957
505 Ga0500643_002018 3300053087 Bacteria 10919
506 Ga0500643_002028 3300053087 Bacteria 10875
507 Ga0500641_0002276 3300053096 Bacteria 6809
508 Ga0500650_0004187 3300053098 Bacteria 5173
509 Ga0500650_0160476 3300053098 Bacteria 1037
510 Ga0500556_0000025 3300053104 Bacteria 167307
511 Ga0500556_0224731 3300053104 Bacteria 740
512 Ga0500562_011424 3300053108 Bacteria 2256
513 Ga0500617_075937 3300053124 Bacteria 1464
514 Ga0500642_0000001 3300053130 Bacteria 1468402
515 Ga0500658_0000261 3300053134 Bacteria 24255
516 Ga0500559_0002494 3300053136 Bacteria 9462
517 Ga0500568_0077195 3300053139 Bacteria 1268
518 Ga0500568_0120288 3300053139 Bacteria 979
519 Ga0500568_0160261 3300053139 Bacteria 830
520 Ga0500577_0047417 3300053142 Bacteria 1597
521 Ga0500604_0003011 3300053151 Bacteria 4523
522 Ga0500604_0064853 3300053151 Bacteria 1154
523 Ga0500616_0014942 3300053153 Bacteria 4450
524 Ga0500616_0017837 3300053153 Bacteria 4021
525 Ga0500622_0000356 3300053156 Bacteria 44558
526 Ga0500622_0271135 3300053156 Bacteria 735
527 Ga0500627_0000174 3300053158 Bacteria 18780
528 Ga0500627_0000816 3300053158 Bacteria 8336
529 Ga0500627_0263600 3300053158 Bacteria 760
530 Ga0500611_002336 3300053727 Bacteria 2253
531 Ga0500611_014200 3300053727 Bacteria 1384
532 Ga0500645_000299 3300053730 Bacteria 35470
533 Ga0500645_001285 3300053730 Bacteria 13110
534 Ga0500587_002876 3300053739 Bacteria 2436
535 Ga0500661_000080 3300055283 Bacteria 15230
536 Ga0587098_009775 3300059604 Bacteria 1049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0255290 Ga0496119_0255290_213_752 165
2 3300048924 Ga0496121_0014298 Ga0496121_0014298_1500_2039 165
3 3300048926 Ga0496123_0123699 Ga0496123_0123699_282_821 165
4 3300041451 Ga0451791_1112956 Ga0451791_1112956_37_582 166
5 3300005563 Ga0068855_100498095 Ga0068855_1004980951 167
6 3300005577 Ga0068857_100034972 Ga0068857_1000349723 167
7 3300026041 Ga0207639_10003148 Ga0207639_100031488 167
8 3300026116 Ga0207674_10000748 Ga0207674_100007488 167
9 3300028379 Ga0268266_10378504 Ga0268266_103785042 167
10 3300046506 Ga0495583_0102652 Ga0495583_0102652_56_568 167
11 3300046660 Ga0495625_0061678 Ga0495625_0061678_1114_1626 167
12 3300053156 Ga0500622_0000356 Ga0500622_0000356_3794_4306 167
13 3300003320 rootH2_10100151 rootH2_101001513 168
14 3300003771 Ga0055526_1009741 Ga0055526_10097415 168
15 3300003773 Ga0055537_1003817 Ga0055537_10038172 168
16 3300003781 Ga0055536_1015352 Ga0055536_10153524 168
17 3300003790 Ga0055528_1012095 Ga0055528_10120952 168
18 3300003792 Ga0055540_1000185 Ga0055540_100018530 168
19 3300003794 Ga0055531_10000088 Ga0055531_1000008875 168
20 3300005262 Ga0065165_1000712 Ga0065165_100071245 168
21 3300005335 Ga0070666_10022481 Ga0070666_100224816 168
22 3300005347 Ga0070668_100001336 Ga0070668_1000013364 168
23 3300005353 Ga0070669_100028373 Ga0070669_1000283736 168
24 3300005367 Ga0070667_100000062 Ga0070667_100000062115 168
25 3300005457 Ga0070662_101283154 Ga0070662_1012831541 168
26 3300005563 Ga0068855_100040340 Ga0068855_1000403403 168
27 3300005617 Ga0068859_100048969 Ga0068859_1000489697 168
28 3300005618 Ga0068864_100000088 Ga0068864_10000008862 168
29 3300005618 Ga0068864_100132283 Ga0068864_1001322833 168
30 3300005719 Ga0068861_100026356 Ga0068861_1000263563 168
31 3300005841 Ga0068863_100000016 Ga0068863_10000001689 168
32 3300005841 Ga0068863_100000054 Ga0068863_100000054102 168
33 3300005843 Ga0068860_100000168 Ga0068860_10000016818 168
34 3300005843 Ga0068860_100018339 Ga0068860_1000183392 168
35 3300006195 Ga0075366_10138025 Ga0075366_101380252 168
36 3300006931 Ga0097620_100048968 Ga0097620_1000489687 168
37 3300009176 Ga0105242_11267554 Ga0105242_112675542 168
38 3300009177 Ga0105248_10910580 Ga0105248_109105801 168
39 3300009553 Ga0105249_10490351 Ga0105249_104903512 168
40 3300013306 Ga0163162_10065679 Ga0163162_100656794 168
41 3300017792 Ga0163161_10104155 Ga0163161_101041554 168
42 3300025263 Ga0209565_1000062 Ga0209565_1000062150 168
43 3300025273 Ga0209673_1038661 Ga0209673_10386613 168
44 3300025291 Ga0209675_1064216 Ga0209675_10642161 168
45 3300025292 Ga0209676_1000288 Ga0209676_100028829 168
46 3300025295 Ga0209564_1000378 Ga0209564_10003783 168
47 3300025297 Ga0209758_1029035 Ga0209758_10290353 168
48 3300025298 Ga0209050_1000001 Ga0209050_10000011602 168
49 3300025302 Ga0207426_1028300 Ga0207426_10283001 168
50 3300025303 Ga0209051_1000209 Ga0209051_100020975 168
51 3300025304 Ga0209257_1000111 Ga0209257_1000111153 168
52 3300025903 Ga0207680_10011928 Ga0207680_100119283 168
53 3300025933 Ga0207706_10887088 Ga0207706_108870881 168
54 3300025944 Ga0207661_10509935 Ga0207661_105099352 168
55 3300025949 Ga0207667_10270753 Ga0207667_102707533 168
56 3300025961 Ga0207712_10225421 Ga0207712_102254212 168
57 3300025972 Ga0207668_10000924 Ga0207668_1000092417 168
58 3300025986 Ga0207658_10000039 Ga0207658_1000003916 168
59 3300026088 Ga0207641_10000095 Ga0207641_1000009518 168
60 3300026088 Ga0207641_10000315 Ga0207641_1000031521 168
61 3300026095 Ga0207676_10000146 Ga0207676_1000014628 168
62 3300026118 Ga0207675_100111951 Ga0207675_1001119513 168
63 3300028379 Ga0268266_10015509 Ga0268266_100155094 168
64 3300028381 Ga0268264_10000040 Ga0268264_10000040122 168
65 3300028381 Ga0268264_10006874 Ga0268264_100068749 168
66 3300028800 Ga0265338_10373704 Ga0265338_103737042 168
67 3300031901 Ga0307406_10550010 Ga0307406_105500101 168
68 3300032002 Ga0307416_101054622 Ga0307416_1010546221 168
69 3300032126 Ga0307415_100660734 Ga0307415_1006607341 168
70 3300042004 Ga0439445_0175612 Ga0439445_0175612_20_526 168
71 3300048907 Ga0496104_0111336 Ga0496104_0111336_1998_2504 168
72 3300048923 Ga0496120_0047341 Ga0496120_0047341_365_871 168
73 3300050493 nmdc:mga0k408_19601_c1 nmdc:mga0k408_19601_c1_237_749 168
74 3300053153 Ga0500616_0017837 Ga0500616_0017837_1569_2078 168
75 3300053727 Ga0500611_014200 Ga0500611_014200_521_1033 168
76 3300053739 Ga0500587_002876 Ga0500587_002876_1413_1925 168
77 3300001989 JGI24739J22299_10029931 JGI24739J22299_100299312 169
78 3300002075 JGI24738J21930_10065527 JGI24738J21930_100655272 169
79 3300003215 JGI25153J46596_10050931 JGI25153J46596_100509312 169
80 3300003775 Ga0055524_1000416 Ga0055524_10004163 169
81 3300003790 Ga0055528_1018315 Ga0055528_10183152 169
82 3300003791 Ga0055530_10027406 Ga0055530_100274062 169
83 3300003794 Ga0055531_10012145 Ga0055531_100121454 169
84 3300003794 Ga0055531_10027193 Ga0055531_100271933 169
85 3300005289 Ga0065704_10188778 Ga0065704_101887782 169
86 3300005289 Ga0065704_10307525 Ga0065704_103075251 169
87 3300005295 Ga0065707_10091281 Ga0065707_100912816 169
88 3300005457 Ga0070662_100080675 Ga0070662_1000806752 169
89 3300005539 Ga0068853_100057594 Ga0068853_1000575944 169
90 3300005577 Ga0068857_100307270 Ga0068857_1003072702 169
91 3300005578 Ga0068854_100120760 Ga0068854_1001207601 169
92 3300006195 Ga0075366_10046391 Ga0075366_100463914 169
93 3300009148 Ga0105243_10471340 Ga0105243_104713402 169
94 3300009177 Ga0105248_10061725 Ga0105248_100617253 169
95 3300009551 Ga0105238_10162188 Ga0105238_101621883 169
96 3300014326 Ga0157380_10000976 Ga0157380_1000097617 169
97 3300017792 Ga0163161_10112078 Ga0163161_101120782 169
98 3300025263 Ga0209565_1000010 Ga0209565_1000010633 169
99 3300025273 Ga0209673_1001509 Ga0209673_100150910 169
100 3300025291 Ga0209675_1016592 Ga0209675_10165922 169
101 3300025297 Ga0209758_1008054 Ga0209758_10080542 169
102 3300025298 Ga0209050_1002682 Ga0209050_10026825 169
103 3300025299 Ga0209256_1000293 Ga0209256_100029338 169
104 3300025304 Ga0209257_1001505 Ga0209257_10015059 169
105 3300025735 Ga0207713_1075333 Ga0207713_10753332 169
106 3300025924 Ga0207694_10259529 Ga0207694_102595292 169
107 3300025933 Ga0207706_10029825 Ga0207706_100298253 169
108 3300025941 Ga0207711_10095352 Ga0207711_100953522 169
109 3300025961 Ga0207712_10018015 Ga0207712_100180152 169
110 3300025981 Ga0207640_10132772 Ga0207640_101327722 169
111 3300026041 Ga0207639_11276231 Ga0207639_112762311 169
112 3300026116 Ga0207674_10348765 Ga0207674_103487652 169
113 3300031250 Ga0265331_10043123 Ga0265331_100431232 169
114 3300031548 Ga0307408_100105106 Ga0307408_1001051063 169
115 3300031911 Ga0307412_10110948 Ga0307412_101109483 169
116 3300031911 Ga0307412_10210710 Ga0307412_102107103 169
117 3300031995 Ga0307409_100080191 Ga0307409_1000801913 169
118 3300041494 Ga0451837_0324922 Ga0451837_0324922_27_536 169
119 3300046460 Ga0495638_0086197 Ga0495638_0086197_522_1031 169
120 3300046460 Ga0495638_0453740 Ga0495638_0453740_13_522 169
121 3300046500 Ga0495596_0000543 Ga0495596_0000543_19346_19855 169
122 3300046501 Ga0495607_0105495 Ga0495607_0105495_114_623 169
123 3300046506 Ga0495583_0035686 Ga0495583_0035686_1100_1609 169
124 3300046507 Ga0495606_0050205 Ga0495606_0050205_659_1168 169
125 3300046512 Ga0495610_0017208 Ga0495610_0017208_2569_3078 169
126 3300046522 Ga0495643_0042862 Ga0495643_0042862_1785_2294 169
127 3300046525 Ga0495663_0057764 Ga0495663_0057764_401_922 169
128 3300046538 Ga0495609_0005526 Ga0495609_0005526_710_1219 169
129 3300046542 Ga0495597_0070616 Ga0495597_0070616_651_1160 169
130 3300046616 Ga0495668_0073891 Ga0495668_0073891_212_721 169
131 3300046660 Ga0495625_0052732 Ga0495625_0052732_986_1495 169
132 3300046692 Ga0495671_0197582 Ga0495671_0197582_102_611 169
133 3300047472 Ga0495686_0394604 Ga0495686_0394604_221_730 169
134 3300048091 Ga0495626_0004465 Ga0495626_0004465_4627_5136 169
135 3300048919 Ga0496116_0000976 Ga0496116_0000976_16243_16752 169
136 3300048924 Ga0496121_0004175 Ga0496121_0004175_15117_15626 169
137 3300048925 Ga0496122_0000094 Ga0496122_0000094_50764_51273 169
138 3300048925 Ga0496122_0004599 Ga0496122_0004599_3865_4374 169
139 3300048926 Ga0496123_0000626 Ga0496123_0000626_7918_8427 169
140 3300048926 Ga0496123_0011325 Ga0496123_0011325_3864_4373 169
141 3300048927 Ga0496124_0011656 Ga0496124_0011656_8080_8589 169
142 3300048927 Ga0496124_0012526 Ga0496124_0012526_7130_7639 169
143 3300048927 Ga0496124_0024753 Ga0496124_0024753_3713_4222 169
144 3300048927 Ga0496124_0863429 Ga0496124_0863429_34_543 169
145 3300048928 Ga0496125_0030376 Ga0496125_0030376_3713_4222 169
146 3300048928 Ga0496125_0031816 Ga0496125_0031816_80_589 169
147 3300048928 Ga0496125_0054551 Ga0496125_0054551_123_632 169
148 3300048929 Ga0496126_0000517 Ga0496126_0000517_42576_43085 169
149 3300049459 Ga0495678_054690 Ga0495678_054690_211_720 169
150 3300049571 Ga0501034_0001122 Ga0501034_0001122_24031_24570 169
151 3300050491 nmdc:mga00v17_324461_c1 nmdc:mga00v17_324461_c1_200_709 169
152 3300050493 nmdc:mga0k408_17584_c1 nmdc:mga0k408_17584_c1_708_1238 169
153 3300050496 nmdc:mga07m45_464050_c1 nmdc:mga07m45_464050_c1_171_680 169
154 3300053098 Ga0500650_0004187 Ga0500650_0004187_1178_1687 169
155 3300053104 Ga0500556_0000025 Ga0500556_0000025_34749_35258 169
156 3300053108 Ga0500562_011424 Ga0500562_011424_1597_2106 169
157 3300053124 Ga0500617_075937 Ga0500617_075937_629_1138 169
158 3300053130 Ga0500642_0000001 Ga0500642_0000001_35567_36076 169
159 3300053139 Ga0500568_0160261 Ga0500568_0160261_139_660 169
160 3300053151 Ga0500604_0064853 Ga0500604_0064853_62_571 169
161 3300053727 Ga0500611_002336 Ga0500611_002336_1589_2098 169
162 3300000041 ARcpr5oldR_c002125 ARcpr5oldR_0021252 170
163 3300000043 ARcpr5yngRDRAFT_c004603 ARcpr5yngRDRAFT_0046032 170
164 3300000652 ARCol0yngRDRAFT_1004974 ARCol0yngRDRAFT_10049741 170
165 3300001904 JGI24736J21556_1000150 JGI24736J21556_10001503 170
166 3300001915 JGI24741J21665_1001648 JGI24741J21665_10016483 170
167 3300001915 JGI24741J21665_1001888 JGI24741J21665_10018886 170
168 3300001979 JGI24740J21852_10008802 JGI24740J21852_100088025 170
169 3300001979 JGI24740J21852_10012416 JGI24740J21852_100124163 170
170 3300001989 JGI24739J22299_10000517 JGI24739J22299_100005171 170
171 3300001989 JGI24739J22299_10056979 JGI24739J22299_100569792 170
172 3300002067 JGI24735J21928_10052048 JGI24735J21928_100520482 170
173 3300002075 JGI24738J21930_10003757 JGI24738J21930_100037574 170
174 3300002075 JGI24738J21930_10009583 JGI24738J21930_100095833 170
175 3300002773 JGI25152J39213_1015597 JGI25152J39213_10155972 170
176 3300002773 JGI25152J39213_1016924 JGI25152J39213_10169241 170
177 3300002774 JGI25150J39212_1000140 JGI25150J39212_100014018 170
178 3300002774 JGI25150J39212_1000202 JGI25150J39212_100020229 170
179 3300002774 JGI25150J39212_1023255 JGI25150J39212_10232551 170
180 3300003187 JGI25151J46595_10007315 JGI25151J46595_100073158 170
181 3300003187 JGI25151J46595_10035761 JGI25151J46595_100357613 170
182 3300003215 JGI25153J46596_10000064 JGI25153J46596_1000006431 170
183 3300003215 JGI25153J46596_10000109 JGI25153J46596_1000010918 170
184 3300003215 JGI25153J46596_10005166 JGI25153J46596_100051663 170
185 3300003771 Ga0055526_1001044 Ga0055526_10010449 170
186 3300003773 Ga0055537_1001276 Ga0055537_10012762 170
187 3300003773 Ga0055537_1002857 Ga0055537_10028574 170
188 3300003775 Ga0055524_1000276 Ga0055524_100027640 170
189 3300003781 Ga0055536_1048563 Ga0055536_10485631 170
190 3300003790 Ga0055528_1045654 Ga0055528_10456542 170
191 3300003791 Ga0055530_10001271 Ga0055530_1000127118 170
192 3300003791 Ga0055530_10005032 Ga0055530_100050324 170
193 3300003791 Ga0055530_10007090 Ga0055530_100070907 170
194 3300003792 Ga0055540_1000667 Ga0055540_100066720 170
195 3300003794 Ga0055531_10000260 Ga0055531_1000026019 170
196 3300003794 Ga0055531_10001272 Ga0055531_1000127218 170
197 3300003794 Ga0055531_10002774 Ga0055531_100027742 170
198 3300003794 Ga0055531_10009307 Ga0055531_100093074 170
199 3300005262 Ga0065165_1003761 Ga0065165_10037617 170
200 3300005262 Ga0065165_1004847 Ga0065165_100484710 170
201 3300005262 Ga0065165_1013993 Ga0065165_10139933 170
202 3300005289 Ga0065704_10001975 Ga0065704_100019753 170
203 3300005289 Ga0065704_10089679 Ga0065704_100896791 170
204 3300005295 Ga0065707_10245414 Ga0065707_102454142 170
205 3300005327 Ga0070658_10289940 Ga0070658_102899403 170
206 3300005331 Ga0070670_100013816 Ga0070670_1000138161 170
207 3300005335 Ga0070666_10387827 Ga0070666_103878271 170
208 3300005337 Ga0070682_100936421 Ga0070682_1009364211 170
209 3300005339 Ga0070660_100061185 Ga0070660_1000611852 170
210 3300005344 Ga0070661_100126523 Ga0070661_1001265233 170
211 3300005347 Ga0070668_100005107 Ga0070668_1000051078 170
212 3300005347 Ga0070668_100019637 Ga0070668_1000196375 170
213 3300005347 Ga0070668_100028523 Ga0070668_1000285233 170
214 3300005353 Ga0070669_100022424 Ga0070669_1000224242 170
215 3300005353 Ga0070669_100055411 Ga0070669_1000554112 170
216 3300005355 Ga0070671_100114959 Ga0070671_1001149593 170
217 3300005366 Ga0070659_100212753 Ga0070659_1002127531 170
218 3300005367 Ga0070667_100000195 Ga0070667_10000019520 170
219 3300005455 Ga0070663_100052471 Ga0070663_1000524711 170
220 3300005455 Ga0070663_100590755 Ga0070663_1005907552 170
221 3300005466 Ga0070685_10025294 Ga0070685_100252943 170
222 3300005539 Ga0068853_100393282 Ga0068853_1003932821 170
223 3300005548 Ga0070665_100001120 Ga0070665_10000112044 170
224 3300005548 Ga0070665_100702992 Ga0070665_1007029922 170
225 3300005563 Ga0068855_100321773 Ga0068855_1003217733 170
226 3300005564 Ga0070664_100075897 Ga0070664_1000758973 170
227 3300005578 Ga0068854_100018351 Ga0068854_1000183511 170
228 3300005614 Ga0068856_100047754 Ga0068856_1000477543 170
229 3300005616 Ga0068852_100001556 Ga0068852_10000155617 170
230 3300005834 Ga0068851_10218629 Ga0068851_102186292 170
231 3300005843 Ga0068860_100000284 Ga0068860_10000028459 170
232 3300005844 Ga0068862_100011038 Ga0068862_1000110387 170
233 3300005844 Ga0068862_100236778 Ga0068862_1002367782 170
234 3300006042 Ga0075368_10000072 Ga0075368_1000007221 170
235 3300006042 Ga0075368_10000110 Ga0075368_100001102 170
236 3300006048 Ga0075363_100000003 Ga0075363_1000000037 170
237 3300006048 Ga0075363_100010361 Ga0075363_1000103616 170
238 3300006051 Ga0075364_10000536 Ga0075364_100005369 170
239 3300006177 Ga0075362_10000048 Ga0075362_1000004818 170
240 3300006178 Ga0075367_10000060 Ga0075367_100000606 170
241 3300006178 Ga0075367_10000121 Ga0075367_100001212 170
242 3300006186 Ga0075369_10000658 Ga0075369_100006586 170
243 3300006195 Ga0075366_10023707 Ga0075366_100237073 170
244 3300006353 Ga0075370_10007829 Ga0075370_100078295 170
245 3300006353 Ga0075370_10053931 Ga0075370_100539313 170
246 3300006948 Ga0099826_10191341 Ga0099826_101913412 170
247 3300009011 Ga0105251_10113816 Ga0105251_101138162 170
248 3300009093 Ga0105240_10008865 Ga0105240_100088659 170
249 3300009093 Ga0105240_10016433 Ga0105240_1001643311 170
250 3300009093 Ga0105240_10514901 Ga0105240_105149012 170
251 3300009174 Ga0105241_10010587 Ga0105241_100105873 170
252 3300009177 Ga0105248_10050467 Ga0105248_100504674 170
253 3300009545 Ga0105237_10021790 Ga0105237_100217902 170
254 3300009551 Ga0105238_10210568 Ga0105238_102105682 170
255 3300009551 Ga0105238_11479457 Ga0105238_114794571 170
256 3300009553 Ga0105249_10386795 Ga0105249_103867952 170
257 3300009978 Ga0105148_100031 Ga0105148_10003110 170
258 3300010375 Ga0105239_10001630 Ga0105239_1000163019 170
259 3300011119 Ga0105246_11339301 Ga0105246_113393011 170
260 3300013102 Ga0157371_10076545 Ga0157371_100765451 170
261 3300013104 Ga0157370_10046826 Ga0157370_100468261 170
262 3300013104 Ga0157370_10664947 Ga0157370_106649471 170
263 3300013105 Ga0157369_10064755 Ga0157369_100647556 170
264 3300013105 Ga0157369_10252886 Ga0157369_102528861 170
265 3300013296 Ga0157374_10721522 Ga0157374_107215221 170
266 3300013297 Ga0157378_10001980 Ga0157378_1000198012 170
267 3300013307 Ga0157372_10432581 Ga0157372_104325812 170
268 3300013308 Ga0157375_11041419 Ga0157375_110414192 170
269 3300014326 Ga0157380_10013963 Ga0157380_100139637 170
270 3300017792 Ga0163161_10170207 Ga0163161_101702074 170
271 3300020070 Ga0206356_11335779 Ga0206356_113357791 170
272 3300020075 Ga0206349_1066120 Ga0206349_10661201 170
273 3300020076 Ga0206355_1538906 Ga0206355_15389061 170
274 3300020077 Ga0206351_10972283 Ga0206351_109722831 170
275 3300020078 Ga0206352_10880385 Ga0206352_108803852 170
276 3300020081 Ga0206354_11150845 Ga0206354_111508451 170
277 3300020610 Ga0154015_1405376 Ga0154015_14053761 170
278 3300025229 Ga0209147_100926 Ga0209147_1009269 170
279 3300025229 Ga0209147_101263 Ga0209147_1012635 170
280 3300025245 Ga0207425_1000073 Ga0207425_100007388 170
281 3300025245 Ga0207425_1000095 Ga0207425_100009530 170
282 3300025245 Ga0207425_1012800 Ga0207425_10128002 170
283 3300025258 Ga0209129_1000435 Ga0209129_10004358 170
284 3300025258 Ga0209129_1001494 Ga0209129_10014944 170
285 3300025263 Ga0209565_1000008 Ga0209565_1000008450 170
286 3300025263 Ga0209565_1000206 Ga0209565_100020647 170
287 3300025263 Ga0209565_1026100 Ga0209565_10261001 170
288 3300025273 Ga0209673_1006714 Ga0209673_10067142 170
289 3300025273 Ga0209673_1028751 Ga0209673_10287512 170
290 3300025291 Ga0209675_1021346 Ga0209675_10213461 170
291 3300025292 Ga0209676_1000588 Ga0209676_100058838 170
292 3300025292 Ga0209676_1001454 Ga0209676_100145418 170
293 3300025294 Ga0209025_1000202 Ga0209025_10002029 170
294 3300025294 Ga0209025_1000421 Ga0209025_100042130 170
295 3300025295 Ga0209564_1001476 Ga0209564_10014767 170
296 3300025295 Ga0209564_1006959 Ga0209564_10069591 170
297 3300025297 Ga0209758_1000019 Ga0209758_1000019138 170
298 3300025297 Ga0209758_1000242 Ga0209758_100024288 170
299 3300025297 Ga0209758_1002052 Ga0209758_10020529 170
300 3300025297 Ga0209758_1021546 Ga0209758_10215462 170
301 3300025298 Ga0209050_1000001 Ga0209050_10000011179 170
302 3300025298 Ga0209050_1000619 Ga0209050_100061936 170
303 3300025298 Ga0209050_1003221 Ga0209050_10032213 170
304 3300025298 Ga0209050_1006051 Ga0209050_10060514 170
305 3300025299 Ga0209256_1000009 Ga0209256_1000009421 170
306 3300025299 Ga0209256_1000010 Ga0209256_1000010345 170
307 3300025302 Ga0207426_1059224 Ga0207426_10592242 170
308 3300025303 Ga0209051_1000193 Ga0209051_100019354 170
309 3300025303 Ga0209051_1003122 Ga0209051_100312212 170
310 3300025303 Ga0209051_1035551 Ga0209051_10355511 170
311 3300025304 Ga0209257_1000551 Ga0209257_100055119 170
312 3300025304 Ga0209257_1001533 Ga0209257_10015337 170
313 3300025304 Ga0209257_1001950 Ga0209257_100195018 170
314 3300025304 Ga0209257_1005579 Ga0209257_10055795 170
315 3300025304 Ga0209257_1008081 Ga0209257_10080813 170
316 3300025304 Ga0209257_1084734 Ga0209257_10847341 170
317 3300025321 Ga0207656_10120580 Ga0207656_101205802 170
318 3300025904 Ga0207647_10039943 Ga0207647_100399433 170
319 3300025909 Ga0207705_10051672 Ga0207705_100516724 170
320 3300025911 Ga0207654_10212672 Ga0207654_102126723 170
321 3300025913 Ga0207695_10012916 Ga0207695_100129165 170
322 3300025913 Ga0207695_10058776 Ga0207695_100587762 170
323 3300025914 Ga0207671_10004540 Ga0207671_100045402 170
324 3300025914 Ga0207671_10256428 Ga0207671_102564283 170
325 3300025919 Ga0207657_10016794 Ga0207657_100167947 170
326 3300025923 Ga0207681_10019166 Ga0207681_100191665 170
327 3300025923 Ga0207681_10039619 Ga0207681_100396192 170
328 3300025924 Ga0207694_10085891 Ga0207694_100858914 170
329 3300025925 Ga0207650_10015123 Ga0207650_100151232 170
330 3300025932 Ga0207690_10073383 Ga0207690_100733831 170
331 3300025941 Ga0207711_10139966 Ga0207711_101399662 170
332 3300025941 Ga0207711_10249746 Ga0207711_102497463 170
333 3300025949 Ga0207667_10105802 Ga0207667_101058023 170
334 3300025961 Ga0207712_10828726 Ga0207712_108287262 170
335 3300025972 Ga0207668_10001714 Ga0207668_1000171412 170
336 3300025972 Ga0207668_10038877 Ga0207668_100388774 170
337 3300025972 Ga0207668_10079978 Ga0207668_100799782 170
338 3300025981 Ga0207640_10012692 Ga0207640_100126926 170
339 3300025981 Ga0207640_10924260 Ga0207640_109242601 170
340 3300025986 Ga0207658_10000279 Ga0207658_1000027921 170
341 3300026041 Ga0207639_10001103 Ga0207639_100011033 170
342 3300026041 Ga0207639_10207004 Ga0207639_102070042 170
343 3300026041 Ga0207639_10325529 Ga0207639_103255292 170
344 3300026067 Ga0207678_10013773 Ga0207678_100137734 170
345 3300026067 Ga0207678_10143631 Ga0207678_101436312 170
346 3300026078 Ga0207702_10031905 Ga0207702_100319053 170
347 3300026088 Ga0207641_10011272 Ga0207641_100112723 170
348 3300026095 Ga0207676_10557578 Ga0207676_105575782 170
349 3300026142 Ga0207698_10027801 Ga0207698_100278013 170
350 3300026142 Ga0207698_10031490 Ga0207698_100314906 170
351 3300027312 Ga0209371_1042637 Ga0209371_10426372 170
352 3300027666 Ga0209282_1205568 Ga0209282_12055682 170
353 3300027866 Ga0209813_10000018 Ga0209813_1000001815 170
354 3300027866 Ga0209813_10000070 Ga0209813_1000007021 170
355 3300028379 Ga0268266_10004104 Ga0268266_100041042 170
356 3300028380 Ga0268265_10249775 Ga0268265_102497752 170
357 3300028380 Ga0268265_10602618 Ga0268265_106026181 170
358 3300028381 Ga0268264_10000337 Ga0268264_1000033754 170
359 3300028381 Ga0268264_11223732 Ga0268264_112237322 170
360 3300030500 Ga0268256_1048230 Ga0268256_10482301 170
361 3300031548 Ga0307408_100049519 Ga0307408_1000495191 170
362 3300031731 Ga0307405_10045470 Ga0307405_100454702 170
363 3300031731 Ga0307405_10230287 Ga0307405_102302873 170
364 3300031731 Ga0307405_10457219 Ga0307405_104572192 170
365 3300031824 Ga0307413_10028648 Ga0307413_100286482 170
366 3300031824 Ga0307413_10217660 Ga0307413_102176601 170
367 3300031824 Ga0307413_10382340 Ga0307413_103823402 170
368 3300031824 Ga0307413_10610252 Ga0307413_106102522 170
369 3300031852 Ga0307410_10147209 Ga0307410_101472092 170
370 3300031901 Ga0307406_10150356 Ga0307406_101503562 170
371 3300031903 Ga0307407_10227774 Ga0307407_102277743 170
372 3300031911 Ga0307412_10044068 Ga0307412_100440682 170
373 3300031911 Ga0307412_10055930 Ga0307412_100559303 170
374 3300031911 Ga0307412_10989597 Ga0307412_109895971 170
375 3300031911 Ga0307412_11333108 Ga0307412_113331081 170
376 3300031995 Ga0307409_100269579 Ga0307409_1002695792 170
377 3300031995 Ga0307409_100722406 Ga0307409_1007224061 170
378 3300032002 Ga0307416_100115728 Ga0307416_1001157282 170
379 3300032002 Ga0307416_100183320 Ga0307416_1001833202 170
380 3300032002 Ga0307416_101727726 Ga0307416_1017277261 170
381 3300032004 Ga0307414_10071381 Ga0307414_100713812 170
382 3300032004 Ga0307414_10894099 Ga0307414_108940992 170
383 3300032005 Ga0307411_10118637 Ga0307411_101186372 170
384 3300032005 Ga0307411_10254232 Ga0307411_102542323 170
385 3300032005 Ga0307411_10615948 Ga0307411_106159481 170
386 3300032005 Ga0307411_11004862 Ga0307411_110048621 170
387 3300038705 Ga0237819_01265 Ga0237819_01265_6045_6557 170
388 3300041404 Ga0439436_0025403 Ga0439436_0025403_341_853 170
389 3300041406 Ga0439439_0040776 Ga0439439_0040776_561_1073 170
390 3300041410 Ga0439461_0000552 Ga0439461_0000552_598_1110 170
391 3300041410 Ga0439461_0049546 Ga0439461_0049546_107_619 170
392 3300041413 Ga0439465_0000182 Ga0439465_0000182_3575_4087 170
393 3300041413 Ga0439465_0001027 Ga0439465_0001027_3143_3655 170
394 3300041452 Ga0451793_0250625 Ga0451793_0250625_225_737 170
395 3300041460 Ga0451802_1705853 Ga0451802_1705853_219_731 170
396 3300041509 Ga0451843_1101219 Ga0451843_1101219_77_589 170
397 3300041997 Ga0439431_0001452 Ga0439431_0001452_4316_4828 170
398 3300041997 Ga0439431_0005865 Ga0439431_0005865_1085_1597 170
399 3300042004 Ga0439445_0012307 Ga0439445_0012307_1255_1767 170
400 3300042004 Ga0439445_0012778 Ga0439445_0012778_97_609 170
401 3300042004 Ga0439445_0022655 Ga0439445_0022655_521_1033 170
402 3300042006 Ga0439432_000375 Ga0439432_000375_3497_4009 170
403 3300042007 Ga0439449_0038369 Ga0439449_0038369_207_719 170
404 3300042010 Ga0439452_062964 Ga0439452_062964_264_776 170
405 3300042014 Ga0439457_042048 Ga0439457_042048_248_760 170
406 3300042015 Ga0439462_0002527 Ga0439462_0002527_3130_3642 170
407 3300042015 Ga0439462_0013022 Ga0439462_0013022_839_1351 170
408 3300042116 Ga0450912_001740 Ga0450912_001740_324_836 170
409 3300042122 Ga0450920_025405 Ga0450920_025405_562_1074 170
410 3300042134 Ga0450898_114462 Ga0450898_114462_21_533 170
411 3300042156 Ga0439446_0068365 Ga0439446_0068365_481_993 170
412 3300042435 Ga0439434_0000263 Ga0439434_0000263_3289_3801 170
413 3300042435 Ga0439434_0009302 Ga0439434_0009302_145_657 170
414 3300046452 Ga0495617_129675 Ga0495617_129675_90_605 170
415 3300046453 Ga0495627_053212 Ga0495627_053212_533_1132 170
416 3300046453 Ga0495627_126914 Ga0495627_126914_141_653 170
417 3300046460 Ga0495638_0086228 Ga0495638_0086228_777_1292 170
418 3300046471 Ga0495650_0096049 Ga0495650_0096049_37_549 170
419 3300046506 Ga0495583_0000054 Ga0495583_0000054_12728_13240 170
420 3300046506 Ga0495583_0000236 Ga0495583_0000236_27319_27834 170
421 3300046507 Ga0495606_0002566 Ga0495606_0002566_3328_3840 170
422 3300046507 Ga0495606_0067017 Ga0495606_0067017_1378_1890 170
423 3300046512 Ga0495610_0001035 Ga0495610_0001035_19290_19889 170
424 3300046513 Ga0495616_0000066 Ga0495616_0000066_28762_29274 170
425 3300046519 Ga0495632_0000722 Ga0495632_0000722_18688_19203 170
426 3300046520 Ga0495637_0000036 Ga0495637_0000036_107963_108475 170
427 3300046522 Ga0495643_0000037 Ga0495643_0000037_224320_224832 170
428 3300046524 Ga0495648_0011837 Ga0495648_0011837_4356_4955 170
429 3300046525 Ga0495663_0000001 Ga0495663_0000001_531264_531776 170
430 3300046525 Ga0495663_0122722 Ga0495663_0122722_218_817 170
431 3300046530 Ga0495654_0000418 Ga0495654_0000418_5671_6186 170
432 3300046537 Ga0495598_0040021 Ga0495598_0040021_604_1116 170
433 3300046539 Ga0495621_0166950 Ga0495621_0166950_183_698 170
434 3300046558 Ga0495633_0000179 Ga0495633_0000179_28719_29231 170
435 3300046558 Ga0495633_0045861 Ga0495633_0045861_472_987 170
436 3300046558 Ga0495633_0073804 Ga0495633_0073804_46_606 170
437 3300046558 Ga0495633_0125959 Ga0495633_0125959_374_886 170
438 3300046616 Ga0495668_0002154 Ga0495668_0002154_675_1190 170
439 3300046616 Ga0495668_0023152 Ga0495668_0023152_106_618 170
440 3300046660 Ga0495625_0178734 Ga0495625_0178734_581_1093 170
441 3300046691 Ga0495670_0000034 Ga0495670_0000034_22484_22996 170
442 3300046692 Ga0495671_0000004 Ga0495671_0000004_131454_132014 170
443 3300046692 Ga0495671_0000025 Ga0495671_0000025_12857_13369 170
444 3300046692 Ga0495671_0000045 Ga0495671_0000045_133820_134335 170
445 3300046692 Ga0495671_0020076 Ga0495671_0020076_2404_2916 170
446 3300047469 Ga0495673_0000021 Ga0495673_0000021_131454_132014 170
447 3300047469 Ga0495673_0000063 Ga0495673_0000063_140339_140854 170
448 3300047469 Ga0495673_0094367 Ga0495673_0094367_299_811 170
449 3300047470 Ga0495681_0000036 Ga0495681_0000036_59582_60181 170
450 3300047472 Ga0495686_0000245 Ga0495686_0000245_84691_85203 170
451 3300047472 Ga0495686_0001354 Ga0495686_0001354_15847_16359 170
452 3300047472 Ga0495686_0001864 Ga0495686_0001864_5967_6566 170
453 3300047472 Ga0495686_0260660 Ga0495686_0260660_48_560 170
454 3300048904 Ga0496101_0653397 Ga0496101_0653397_185_700 170
455 3300048911 Ga0496108_0003893 Ga0496108_0003893_487_1002 170
456 3300048912 Ga0496109_0070619 Ga0496109_0070619_354_926 170
457 3300048914 Ga0496111_0269522 Ga0496111_0269522_283_798 170
458 3300048916 Ga0496113_0031380 Ga0496113_0031380_1894_2406 170
459 3300048919 Ga0496116_0024603 Ga0496116_0024603_3506_4018 170
460 3300048920 Ga0496117_0005672 Ga0496117_0005672_10640_11152 170
461 3300048920 Ga0496117_0086754 Ga0496117_0086754_1405_1917 170
462 3300048921 Ga0496118_0003499 Ga0496118_0003499_2586_3098 170
463 3300048921 Ga0496118_0019597 Ga0496118_0019597_2120_2632 170
464 3300048921 Ga0496118_0031285 Ga0496118_0031285_1841_2353 170
465 3300048921 Ga0496118_0173579 Ga0496118_0173579_752_1264 170
466 3300048921 Ga0496118_0187908 Ga0496118_0187908_24_536 170
467 3300048922 Ga0496119_0261067 Ga0496119_0261067_14_526 170
468 3300048923 Ga0496120_0110482 Ga0496120_0110482_76_588 170
469 3300048923 Ga0496120_0290027 Ga0496120_0290027_77_589 170
470 3300048924 Ga0496121_0000980 Ga0496121_0000980_27816_28445 170
471 3300048924 Ga0496121_0002091 Ga0496121_0002091_3099_3611 170
472 3300048924 Ga0496121_0005584 Ga0496121_0005584_1289_1804 170
473 3300048924 Ga0496121_0028465 Ga0496121_0028465_4158_4670 170
474 3300048925 Ga0496122_0267232 Ga0496122_0267232_21_533 170
475 3300048925 Ga0496122_0375015 Ga0496122_0375015_156_668 170
476 3300048925 Ga0496122_0478206 Ga0496122_0478206_27_539 170
477 3300048926 Ga0496123_0229462 Ga0496123_0229462_156_668 170
478 3300048926 Ga0496123_0255524 Ga0496123_0255524_281_793 170
479 3300048926 Ga0496123_0333982 Ga0496123_0333982_169_684 170
480 3300048927 Ga0496124_0007774 Ga0496124_0007774_9584_10213 170
481 3300048927 Ga0496124_0028123 Ga0496124_0028123_983_1495 170
482 3300048927 Ga0496124_0047335 Ga0496124_0047335_401_916 170
483 3300048927 Ga0496124_0152327 Ga0496124_0152327_1115_1627 170
484 3300048928 Ga0496125_0015761 Ga0496125_0015761_769_1398 170
485 3300048928 Ga0496125_0026092 Ga0496125_0026092_2303_2815 170
486 3300048928 Ga0496125_0031310 Ga0496125_0031310_4077_4589 170
487 3300048928 Ga0496125_0156750 Ga0496125_0156750_602_1174 170
488 3300048928 Ga0496125_0253650 Ga0496125_0253650_481_993 170
489 3300048929 Ga0496126_0057729 Ga0496126_0057729_1661_2173 170
490 3300048929 Ga0496126_0292503 Ga0496126_0292503_591_1103 170
491 3300049551 Ga0501335_004394 Ga0501335_004394_295_807 170
492 3300049579 Ga0501043_0013634 Ga0501043_0013634_887_1402 170
493 3300049653 Ga0501206_010182 Ga0501206_010182_530_1042 170
494 3300049658 Ga0501211_001557 Ga0501211_001557_1088_1600 170
495 3300049663 Ga0501223_000084 Ga0501223_000084_26713_27231 170
496 3300049669 Ga0501235_099629 Ga0501235_099629_158_670 170
497 3300049674 Ga0501242_032367 Ga0501242_032367_17_529 170
498 3300049684 Ga0501255_009650 Ga0501255_009650_525_1037 170
499 3300049704 Ga0501221_029127 Ga0501221_029127_469_1053 170
500 3300049705 Ga0501225_0000044 Ga0501225_0000044_22228_22746 170
501 3300049705 Ga0501225_0000352 Ga0501225_0000352_12945_13457 170
502 3300049705 Ga0501225_0019805 Ga0501225_0019805_812_1324 170
503 3300049777 Ga0501281_02702 Ga0501281_02702_585_1097 170
504 3300050489 nmdc:mga03683_45_c1 nmdc:mga03683_45_c1_38673_39269 170
505 3300050490 nmdc:mga03n38_24821_c1 nmdc:mga03n38_24821_c1_56_568 170
506 3300050490 nmdc:mga03n38_2_c1 nmdc:mga03n38_2_c1_57409_58005 170
507 3300050491 nmdc:mga00v17_20_c1 nmdc:mga00v17_20_c1_57409_58005 170
508 3300050493 nmdc:mga0k408_19280_c1 nmdc:mga0k408_19280_c1_2037_2633 170
509 3300050494 nmdc:mga06z11_29_c1 nmdc:mga06z11_29_c1_19494_20090 170
510 3300050494 nmdc:mga06z11_88_c1 nmdc:mga06z11_88_c1_21915_22427 170
511 3300050495 nmdc:mga04h51_51_c1 nmdc:mga04h51_51_c1_19494_20090 170
512 3300050495 nmdc:mga04h51_68_c1 nmdc:mga04h51_68_c1_10683_11195 170
513 3300050496 nmdc:mga07m45_22189_c1 nmdc:mga07m45_22189_c1_2398_2910 170
514 3300050496 nmdc:mga07m45_24_c1 nmdc:mga07m45_24_c1_57409_58005 170
515 3300050516 nmdc:mga0sz30_160_c1 nmdc:mga0sz30_160_c1_23308_23904 170
516 3300053087 Ga0500643_000226 Ga0500643_000226_29930_30442 170
517 3300053087 Ga0500643_000244 Ga0500643_000244_19895_20407 170
518 3300053087 Ga0500643_002018 Ga0500643_002018_1278_1790 170
519 3300053087 Ga0500643_002028 Ga0500643_002028_2390_2902 170
520 3300053096 Ga0500641_0002276 Ga0500641_0002276_2869_3381 170
521 3300053098 Ga0500650_0160476 Ga0500650_0160476_445_1002 170
522 3300053104 Ga0500556_0224731 Ga0500556_0224731_174_686 170
523 3300053134 Ga0500658_0000261 Ga0500658_0000261_23684_24196 170
524 3300053136 Ga0500559_0002494 Ga0500559_0002494_3777_4289 170
525 3300053139 Ga0500568_0077195 Ga0500568_0077195_317_829 170
526 3300053139 Ga0500568_0120288 Ga0500568_0120288_401_916 170
527 3300053142 Ga0500577_0047417 Ga0500577_0047417_1056_1568 170
528 3300053151 Ga0500604_0003011 Ga0500604_0003011_774_1286 170
529 3300053153 Ga0500616_0014942 Ga0500616_0014942_664_1176 170
530 3300053156 Ga0500622_0271135 Ga0500622_0271135_123_656 170
531 3300053158 Ga0500627_0000174 Ga0500627_0000174_1142_1654 170
532 3300053158 Ga0500627_0000816 Ga0500627_0000816_1996_2511 170
533 3300053158 Ga0500627_0263600 Ga0500627_0263600_203_715 170
534 3300053730 Ga0500645_000299 Ga0500645_000299_6961_7473 170
535 3300053730 Ga0500645_001285 Ga0500645_001285_3141_3653 170
536 3300055283 Ga0500661_000080 Ga0500661_000080_3235_3747 170
537 3300059604 Ga0587098_009775 Ga0587098_009775_408_920 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01814

Hemerythrin

Hemerythrin HHE cation binding domain

47

158

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.7988 8 157
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.7417 8 157
3waq-assembly1.cif.gz_A hemerythrin-like domain of dcrh i119e mutant (met) 0.7091 13 131
4xpw-assembly1.cif.gz_A crystal structures of leu114f mutant 0.6468 1 130
4xpx-assembly1.cif.gz_A crystal structure of hemerythrin:wild-type 0.6443 1 130
ID Description Score Start End Superfamily
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8763 5 145 1.20.120.520
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8482 5 145 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7721 8 144 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7575 8 144 1.20.120.520
af_Q5N7H0_149_347_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.6659 12 154 1.20.120.520
ID Description Score Start End GO Terms
AF-A0A521SMD0-F1-model_v4 deleted 0.994 42 170
AF-A0A519KSD0-F1-model_v4 Hemerythrin domain-containing protein 0.9934 8 134
AF-G2IL40-F1-model_v4 Hemerythrin-like domain-containing protein 0.9907 1 170
AF-A0A6G7ZDW5-F1-model_v4 Hemerythrin domain-containing protein 0.9904 8 168
AF-A0A7W7F7Q7-F1-model_v4 Hemerythrin-like domain-containing protein 0.9898 5 170

Feature Viewer

pLDDT pTM Quality
95.79 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map