F460905
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 537 | 340 | 488 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10938026|Ga0105241_109380261 |
| Length | 202 |
| Sequence | MRGPAAPSASLSELPPWIETVRAAGEVEKRSMSKRIVAAFAVTVAAALPATDAAQARPEMVPVRSAEYSPGTIVVRTGERHLYLILDSGHAMRYPVGVGKAGKQWAGVTRIEGKYQNPAWSPPSEVKRDKPSIPDMIPGGSPRNPMGVAAMTLAGGEYAIHGTNVPGSVGGFVSYGCIRMLNADITDLYGRVGVGTTVVVTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 7 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 8 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 9 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 10 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 11 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 12 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 13 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 14 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 15 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 16 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 17 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 18 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 19 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 20 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 21 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 22 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 23 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 24 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 25 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 26 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 27 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 28 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 29 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 30 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 31 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 32 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 33 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 34 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 35 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 36 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 37 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 38 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 39 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 40 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 41 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 121 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 122 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 123 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 126 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 170 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 182 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 188 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 297 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 298 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 311 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 325 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 331 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 332 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 335 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 336 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 337 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 338 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 339 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 340 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.64 |
| Metatranscriptomes | 0.75 |
| Isolates | 8.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.15 |
| Nodule | 6.15 |
| Rhizoplane | 11.55 |
| Rhizosphere | 67.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10006540 | 3300003659 | Bacteria | 2444 |
| 2 | Ga0058862_12548500 | 3300004803 | Bacteria | 759 |
| 3 | Ga0070683_100117757 | 3300005329 | Bacteria | 2508 |
| 4 | Ga0070670_100272627 | 3300005331 | Bacteria | 1477 |
| 5 | Ga0068868_100054743 | 3300005338 | Bacteria | 3145 |
| 6 | Ga0070691_10213807 | 3300005341 | Bacteria | 1018 |
| 7 | Ga0070671_100289945 | 3300005355 | Bacteria | 1393 |
| 8 | Ga0070674_100056596 | 3300005356 | Bacteria | 2720 |
| 9 | Ga0070673_100496749 | 3300005364 | Bacteria | 1103 |
| 10 | Ga0070688_100397101 | 3300005365 | Bacteria | 1020 |
| 11 | Ga0070714_100985552 | 3300005435 | Bacteria | 820 |
| 12 | Ga0070713_100126962 | 3300005436 | Bacteria | 2245 |
| 13 | Ga0070713_100863065 | 3300005436 | Bacteria | 869 |
| 14 | Ga0070713_101011778 | 3300005436 | Bacteria | 802 |
| 15 | Ga0070711_100087568 | 3300005439 | Bacteria | 2236 |
| 16 | Ga0070663_100022584 | 3300005455 | Bacteria | 4208 |
| 17 | Ga0070678_100061795 | 3300005456 | Bacteria | 2762 |
| 18 | Ga0070681_10059978 | 3300005458 | Bacteria | 3783 |
| 19 | Ga0070681_10110277 | 3300005458 | Bacteria | 2691 |
| 20 | Ga0070685_10472771 | 3300005466 | Bacteria | 882 |
| 21 | Ga0070679_100237787 | 3300005530 | Bacteria | 1780 |
| 22 | Ga0070684_100026464 | 3300005535 | Bacteria | 4888 |
| 23 | Ga0070684_100046817 | 3300005535 | Bacteria | 3748 |
| 24 | Ga0070684_100433992 | 3300005535 | Bacteria | 1213 |
| 25 | Ga0070697_100009632 | 3300005536 | Bacteria | 7546 |
| 26 | Ga0070665_100298515 | 3300005548 | Bacteria | 1613 |
| 27 | Ga0070665_100735143 | 3300005548 | Bacteria | 1000 |
| 28 | Ga0070665_101008173 | 3300005548 | Bacteria | 845 |
| 29 | Ga0068855_100688531 | 3300005563 | Bacteria | 1095 |
| 30 | Ga0070664_100053295 | 3300005564 | Bacteria | 3428 |
| 31 | Ga0068857_100015885 | 3300005577 | Bacteria | 6590 |
| 32 | Ga0068857_100620809 | 3300005577 | Bacteria | 1023 |
| 33 | Ga0068852_100298753 | 3300005616 | Bacteria | 1558 |
| 34 | Ga0068864_100049859 | 3300005618 | Bacteria | 3602 |
| 35 | Ga0068864_100381847 | 3300005618 | Bacteria | 1335 |
| 36 | Ga0068866_10057490 | 3300005718 | Bacteria | 2005 |
| 37 | Ga0068858_100391621 | 3300005842 | Bacteria | 1334 |
| 38 | Ga0068858_100451568 | 3300005842 | Bacteria | 1239 |
| 39 | Ga0081455_10036290 | 3300005937 | Bacteria | 4391 |
| 40 | Ga0081455_10072677 | 3300005937 | Bacteria | 2847 |
| 41 | Ga0081538_10109783 | 3300005981 | Bacteria | 1358 |
| 42 | Ga0081540_1005846 | 3300005983 | Bacteria | 9098 |
| 43 | Ga0081540_1006380 | 3300005983 | Bacteria | 8601 |
| 44 | Ga0081540_1085626 | 3300005983 | Bacteria | 1403 |
| 45 | Ga0070717_10019833 | 3300006028 | Bacteria | 5279 |
| 46 | Ga0075368_10119775 | 3300006042 | Bacteria | 1089 |
| 47 | Ga0075368_10151203 | 3300006042 | Bacteria | 970 |
| 48 | Ga0075368_10205443 | 3300006042 | Bacteria | 834 |
| 49 | Ga0075363_100262362 | 3300006048 | Bacteria | 997 |
| 50 | Ga0075364_10186728 | 3300006051 | Bacteria | 1404 |
| 51 | Ga0070716_100427153 | 3300006173 | Bacteria | 960 |
| 52 | Ga0070712_100444132 | 3300006175 | Bacteria | 1079 |
| 53 | Ga0075362_10060148 | 3300006177 | Bacteria | 1717 |
| 54 | Ga0075367_10155653 | 3300006178 | Bacteria | 1420 |
| 55 | Ga0075367_10165113 | 3300006178 | Unclassified | 1378 |
| 56 | Ga0075369_10238599 | 3300006186 | Bacteria | 843 |
| 57 | Ga0075366_10029827 | 3300006195 | Bacteria | 3205 |
| 58 | Ga0097621_100447086 | 3300006237 | Bacteria | 1164 |
| 59 | Ga0075370_10151650 | 3300006353 | Bacteria | 1358 |
| 60 | Ga0075370_10221759 | 3300006353 | Bacteria | 1118 |
| 61 | Ga0068871_100420181 | 3300006358 | Bacteria | 1194 |
| 62 | Ga0075428_100329369 | 3300006844 | Bacteria | 1640 |
| 63 | Ga0075431_100996279 | 3300006847 | Bacteria | 805 |
| 64 | Ga0075433_10783824 | 3300006852 | Bacteria | 833 |
| 65 | Ga0075434_100072244 | 3300006871 | Bacteria | 3443 |
| 66 | Ga0068865_100040260 | 3300006881 | Bacteria | 3174 |
| 67 | Ga0068865_100749460 | 3300006881 | Bacteria | 839 |
| 68 | Ga0099794_10033882 | 3300007265 | Bacteria | 2403 |
| 69 | Ga0105240_10004777 | 3300009093 | Bacteria | 20435 |
| 70 | Ga0105240_10117059 | 3300009093 | Bacteria | 3214 |
| 71 | Ga0105240_10271507 | 3300009093 | Bacteria | 1952 |
| 72 | Ga0111539_10061817 | 3300009094 | Bacteria | 4436 |
| 73 | Ga0105245_10007604 | 3300009098 | Bacteria | 9488 |
| 74 | Ga0105245_12298231 | 3300009098 | Bacteria | 593 |
| 75 | Ga0105247_10234261 | 3300009101 | Bacteria | 1248 |
| 76 | Ga0105247_10396629 | 3300009101 | Bacteria | 982 |
| 77 | Ga0114129_10040520 | 3300009147 | Bacteria | 6566 |
| 78 | Ga0114129_10566230 | 3300009147 | Bacteria | 1476 |
| 79 | Ga0105243_10291740 | 3300009148 | Bacteria | 1474 |
| 80 | Ga0105243_11150138 | 3300009148 | Bacteria | 787 |
| 81 | Ga0105241_10938026 | 3300009174 | Bacteria | 806 |
| 82 | Ga0105248_10221213 | 3300009177 | Bacteria | 2131 |
| 83 | Ga0105237_10016029 | 3300009545 | Bacteria | 7794 |
| 84 | Ga0105237_10070886 | 3300009545 | Bacteria | 3481 |
| 85 | Ga0105237_10434858 | 3300009545 | Bacteria | 1318 |
| 86 | Ga0105237_10643937 | 3300009545 | Bacteria | 1067 |
| 87 | Ga0105238_10037927 | 3300009551 | Bacteria | 4897 |
| 88 | Ga0105238_10587329 | 3300009551 | Bacteria | 1121 |
| 89 | Ga0105249_10199315 | 3300009553 | Bacteria | 1958 |
| 90 | Ga0105239_10016959 | 3300010375 | Bacteria | 8050 |
| 91 | Ga0105239_10132102 | 3300010375 | Bacteria | 2778 |
| 92 | Ga0105239_10871800 | 3300010375 | Bacteria | 1033 |
| 93 | Ga0105239_11653313 | 3300010375 | Bacteria | 741 |
| 94 | Ga0105246_10009574 | 3300011119 | Bacteria | 5970 |
| 95 | Ga0105246_10401546 | 3300011119 | Bacteria | 1138 |
| 96 | Ga0157370_10847209 | 3300013104 | Bacteria | 831 |
| 97 | Ga0157369_10005521 | 3300013105 | Bacteria | 14687 |
| 98 | Ga0157369_10014138 | 3300013105 | Bacteria | 9020 |
| 99 | Ga0157369_10767653 | 3300013105 | Bacteria | 991 |
| 100 | Ga0157374_10012776 | 3300013296 | Bacteria | 7315 |
| 101 | Ga0157378_10127170 | 3300013297 | Bacteria | 2355 |
| 102 | Ga0157378_10421480 | 3300013297 | Bacteria | 1319 |
| 103 | Ga0163162_10180203 | 3300013306 | Bacteria | 2239 |
| 104 | Ga0163162_10909708 | 3300013306 | Bacteria | 993 |
| 105 | Ga0157372_10154991 | 3300013307 | Bacteria | 2646 |
| 106 | Ga0157375_10046704 | 3300013308 | Bacteria | 4224 |
| 107 | Ga0157375_10225589 | 3300013308 | Bacteria | 2033 |
| 108 | Ga0163163_10046231 | 3300014325 | Bacteria | 4276 |
| 109 | Ga0163163_10116449 | 3300014325 | Bacteria | 2704 |
| 110 | Ga0163163_10438918 | 3300014325 | Bacteria | 1365 |
| 111 | Ga0157380_10177981 | 3300014326 | Bacteria | 1866 |
| 112 | Ga0182008_10137409 | 3300014497 | Bacteria | 1221 |
| 113 | Ga0157377_10174220 | 3300014745 | Bacteria | 1348 |
| 114 | Ga0157377_10442590 | 3300014745 | Bacteria | 895 |
| 115 | Ga0157379_10129317 | 3300014968 | Bacteria | 2272 |
| 116 | Ga0157379_10860016 | 3300014968 | Bacteria | 858 |
| 117 | Ga0157376_10086000 | 3300014969 | Bacteria | 2710 |
| 118 | Ga0163161_10250534 | 3300017792 | Bacteria | 1380 |
| 119 | Ga0163161_10279951 | 3300017792 | Bacteria | 1308 |
| 120 | Ga0206356_10358370 | 3300020070 | Bacteria | 1945 |
| 121 | Ga0206350_10285734 | 3300020080 | Bacteria | 1568 |
| 122 | Ga0206353_10072688 | 3300020082 | Bacteria | 1138 |
| 123 | Ga0214544_1000016 | 3300021320 | Bacteria | 204278 |
| 124 | Ga0214542_1000016 | 3300021321 | Bacteria | 210332 |
| 125 | Ga0214545_1000008 | 3300021324 | Bacteria | 215190 |
| 126 | Ga0214543_1000043 | 3300021327 | Bacteria | 160517 |
| 127 | Ga0213876_10133952 | 3300021384 | Bacteria | 1318 |
| 128 | Ga0213876_10145727 | 3300021384 | Bacteria | 1259 |
| 129 | Ga0213875_10213735 | 3300021388 | Bacteria | 908 |
| 130 | Ga0209233_1007665 | 3300025261 | Bacteria | 3400 |
| 131 | Ga0207656_10189801 | 3300025321 | Bacteria | 989 |
| 132 | Ga0207642_10394644 | 3300025899 | Bacteria | 826 |
| 133 | Ga0207647_10084686 | 3300025904 | Bacteria | 1897 |
| 134 | Ga0207699_10673462 | 3300025906 | Bacteria | 756 |
| 135 | Ga0207707_10001318 | 3300025912 | Bacteria | 23068 |
| 136 | Ga0207695_10086938 | 3300025913 | Bacteria | 3151 |
| 137 | Ga0207695_10502936 | 3300025913 | Bacteria | 1094 |
| 138 | Ga0207671_10017495 | 3300025914 | Bacteria | 5524 |
| 139 | Ga0207671_10049535 | 3300025914 | Bacteria | 3110 |
| 140 | Ga0207693_10087142 | 3300025915 | Bacteria | 2446 |
| 141 | Ga0207693_10268901 | 3300025915 | Bacteria | 1336 |
| 142 | Ga0207693_10396874 | 3300025915 | Bacteria | 1078 |
| 143 | Ga0207693_10439698 | 3300025915 | Bacteria | 1019 |
| 144 | Ga0207693_10895137 | 3300025915 | Bacteria | 681 |
| 145 | Ga0207663_10170237 | 3300025916 | Bacteria | 1546 |
| 146 | Ga0207660_10026100 | 3300025917 | Bacteria | 3975 |
| 147 | Ga0207660_10432847 | 3300025917 | Bacteria | 1062 |
| 148 | Ga0207649_10167723 | 3300025920 | Bacteria | 1527 |
| 149 | Ga0207652_10199492 | 3300025921 | Bacteria | 1801 |
| 150 | Ga0207652_11365954 | 3300025921 | Bacteria | 612 |
| 151 | Ga0207694_10045602 | 3300025924 | Bacteria | 3386 |
| 152 | Ga0207694_10393263 | 3300025924 | Bacteria | 1152 |
| 153 | Ga0207650_10021414 | 3300025925 | Bacteria | 4569 |
| 154 | Ga0207650_10275214 | 3300025925 | Bacteria | 1369 |
| 155 | Ga0207687_10477164 | 3300025927 | Bacteria | 1038 |
| 156 | Ga0207700_10009234 | 3300025928 | Bacteria | 6151 |
| 157 | Ga0207700_10754248 | 3300025928 | Bacteria | 870 |
| 158 | Ga0207664_10367938 | 3300025929 | Bacteria | 1275 |
| 159 | Ga0207664_10628266 | 3300025929 | Bacteria | 965 |
| 160 | Ga0207664_10851947 | 3300025929 | Bacteria | 819 |
| 161 | Ga0207644_10445899 | 3300025931 | Bacteria | 1063 |
| 162 | Ga0207706_10646145 | 3300025933 | Bacteria | 906 |
| 163 | Ga0207669_10783651 | 3300025937 | Bacteria | 789 |
| 164 | Ga0207704_10067493 | 3300025938 | Bacteria | 2250 |
| 165 | Ga0207691_10183872 | 3300025940 | Bacteria | 1825 |
| 166 | Ga0207711_10230505 | 3300025941 | Bacteria | 1696 |
| 167 | Ga0207689_10036180 | 3300025942 | Bacteria | 4099 |
| 168 | Ga0207689_10168988 | 3300025942 | Bacteria | 1802 |
| 169 | Ga0207661_10007310 | 3300025944 | Bacteria | 7855 |
| 170 | Ga0207679_10284619 | 3300025945 | Bacteria | 1419 |
| 171 | Ga0207679_10511856 | 3300025945 | Bacteria | 1072 |
| 172 | Ga0207667_10769184 | 3300025949 | Bacteria | 961 |
| 173 | Ga0207651_11036537 | 3300025960 | Bacteria | 734 |
| 174 | Ga0207668_10175217 | 3300025972 | Bacteria | 1686 |
| 175 | Ga0207658_10091936 | 3300025986 | Bacteria | 2356 |
| 176 | Ga0207658_11191289 | 3300025986 | Bacteria | 696 |
| 177 | Ga0207677_10334152 | 3300026023 | Bacteria | 1264 |
| 178 | Ga0207703_10189493 | 3300026035 | Bacteria | 1820 |
| 179 | Ga0207639_10082707 | 3300026041 | Bacteria | 2546 |
| 180 | Ga0207678_10037290 | 3300026067 | Bacteria | 4228 |
| 181 | Ga0207702_10172071 | 3300026078 | Bacteria | 1987 |
| 182 | Ga0207641_10116887 | 3300026088 | Bacteria | 2374 |
| 183 | Ga0207641_10642096 | 3300026088 | Bacteria | 1042 |
| 184 | Ga0207676_10037254 | 3300026095 | Bacteria | 3705 |
| 185 | Ga0207676_10608791 | 3300026095 | Bacteria | 1050 |
| 186 | Ga0207676_11121149 | 3300026095 | Bacteria | 778 |
| 187 | Ga0207674_10047136 | 3300026116 | Bacteria | 4420 |
| 188 | Ga0207683_10046084 | 3300026121 | Bacteria | 3814 |
| 189 | Ga0207683_10072440 | 3300026121 | Bacteria | 3047 |
| 190 | Ga0207683_10631589 | 3300026121 | Bacteria | 992 |
| 191 | Ga0207698_10058070 | 3300026142 | Bacteria | 2996 |
| 192 | Ga0268266_10095308 | 3300028379 | Bacteria | 2614 |
| 193 | Ga0268266_10595924 | 3300028379 | Bacteria | 1061 |
| 194 | Ga0268266_11396159 | 3300028379 | Bacteria | 676 |
| 195 | Ga0268264_10345843 | 3300028381 | Bacteria | 1414 |
| 196 | Ga0307517_10000175 | 3300028786 | Bacteria | 105567 |
| 197 | Ga0307515_10045637 | 3300028794 | Bacteria | 6724 |
| 198 | Ga0307515_10079464 | 3300028794 | Bacteria | 4296 |
| 199 | Ga0265340_10012058 | 3300031247 | Bacteria | 4571 |
| 200 | Ga0307513_10344352 | 3300031456 | Bacteria | 1240 |
| 201 | Ga0307513_10374903 | 3300031456 | Bacteria | 1164 |
| 202 | Ga0307508_10218291 | 3300031616 | Bacteria | 1507 |
| 203 | Ga0265314_10157267 | 3300031711 | Bacteria | 1387 |
| 204 | Ga0307516_10447801 | 3300031730 | Bacteria | 948 |
| 205 | Ga0307516_10491528 | 3300031730 | Bacteria | 882 |
| 206 | Ga0307405_10167975 | 3300031731 | Bacteria | 1562 |
| 207 | Ga0307405_10191184 | 3300031731 | Bacteria | 1479 |
| 208 | Ga0307406_10433196 | 3300031901 | Bacteria | 1051 |
| 209 | Ga0307416_100654075 | 3300032002 | Bacteria | 1136 |
| 210 | Ga0307415_100051373 | 3300032126 | Bacteria | 2797 |
| 211 | Ga0307510_10289574 | 3300033180 | Bacteria | 1104 |
| 212 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 213 | Ga0373948_0049480 | 3300034817 | Bacteria | 900 |
| 214 | Ga0373928_0188040 | 3300035084 | Bacteria | 590 |
| 215 | Ga0373934_0167492 | 3300035086 | Bacteria | 902 |
| 216 | Ga0373944_0067745 | 3300035089 | Bacteria | 1157 |
| 217 | Ga0373949_0039414 | 3300035090 | Bacteria | 1157 |
| 218 | Ga0373952_0064488 | 3300035092 | Bacteria | 903 |
| 219 | Ga0373952_0163027 | 3300035092 | Bacteria | 633 |
| 220 | Ga0373923_0014521 | 3300035111 | Bacteria | 2960 |
| 221 | Ga0373923_0015288 | 3300035111 | Bacteria | 2895 |
| 222 | Ga0373923_0094060 | 3300035111 | Bacteria | 1314 |
| 223 | Ga0373936_0004680 | 3300035113 | Bacteria | 5175 |
| 224 | Ga0373936_0122131 | 3300035113 | Bacteria | 1113 |
| 225 | Ga0373945_0343015 | 3300035116 | Bacteria | 646 |
| 226 | Ga0373953_0049383 | 3300035117 | Unclassified | 1697 |
| 227 | Ga0373957_0095581 | 3300035120 | Unclassified | 1185 |
| 228 | Ga0373957_0138937 | 3300035120 | Bacteria | 992 |
| 229 | Ga0373943_0009067 | 3300035170 | Bacteria | 4460 |
| 230 | Ga0373943_0031307 | 3300035170 | Bacteria | 2524 |
| 231 | Ga0373946_0008136 | 3300035171 | Bacteria | 3849 |
| 232 | Ga0373955_0191509 | 3300035172 | Bacteria | 1216 |
| 233 | Ga0373955_0198651 | 3300035172 | Bacteria | 1193 |
| 234 | Ga0373961_0138864 | 3300035241 | Bacteria | 820 |
| 235 | Ga0373924_0006576 | 3300035410 | Bacteria | 4168 |
| 236 | Ga0373924_0026539 | 3300035410 | Bacteria | 2298 |
| 237 | Ga0373931_0028873 | 3300035691 | Bacteria | 2843 |
| 238 | Ga0373931_0608671 | 3300035691 | Unclassified | 715 |
| 239 | Ga0373935_0000500 | 3300035692 | Bacteria | 20245 |
| 240 | Ga0373935_0022952 | 3300035692 | Bacteria | 3831 |
| 241 | Ga0373935_0320200 | 3300035692 | Bacteria | 1100 |
| 242 | Ga0373935_0706208 | 3300035692 | Bacteria | 742 |
| 243 | Ga0373927_0000337 | 3300035695 | Bacteria | 36861 |
| 244 | Ga0373927_0092084 | 3300035695 | Bacteria | 1969 |
| 245 | Ga0373933_0002403 | 3300035724 | Bacteria | 10560 |
| 246 | Ga0373933_0139110 | 3300035724 | Bacteria | 1532 |
| 247 | Ga0373933_0203226 | 3300035724 | Bacteria | 1268 |
| 248 | Ga0373947_0001596 | 3300035725 | Bacteria | 13905 |
| 249 | Ga0373947_0081228 | 3300035725 | Bacteria | 2007 |
| 250 | Ga0373947_0107828 | 3300035725 | Bacteria | 1756 |
| 251 | Ga0373947_0118537 | 3300035725 | Bacteria | 1680 |
| 252 | Ga0373947_0254668 | 3300035725 | Bacteria | 1162 |
| 253 | Ga0373937_0001983 | 3300036401 | Bacteria | 17123 |
| 254 | Ga0373937_0006754 | 3300036401 | Bacteria | 9902 |
| 255 | Ga0373925_0002178 | 3300037068 | Bacteria | 15945 |
| 256 | Ga0373925_0028292 | 3300037068 | Bacteria | 4107 |
| 257 | Ga0373925_0130610 | 3300037068 | Bacteria | 1958 |
| 258 | Ga0373925_0133301 | 3300037068 | Bacteria | 1939 |
| 259 | Ga0373925_0294967 | 3300037068 | Unclassified | 1308 |
| 260 | Ga0395900_0005446 | 3300037418 | Bacteria | 13337 |
| 261 | Ga0395898_0027897 | 3300037466 | Bacteria | 5662 |
| 262 | Ga0395905_0018997 | 3300037471 | Bacteria | 6517 |
| 263 | Ga0395905_0155779 | 3300037471 | Bacteria | 2149 |
| 264 | Ga0436364_0842905 | 3300037853 | Bacteria | 1415 |
| 265 | Ga0436364_1290935 | 3300037853 | Bacteria | 889 |
| 266 | Ga0395901_0243888 | 3300038443 | Bacteria | 1873 |
| 267 | Ga0436365_0005537 | 3300039437 | Bacteria | 4679 |
| 268 | Ga0436365_0719884 | 3300039437 | Bacteria | 2782 |
| 269 | Ga0436360_0581218 | 3300039438 | Bacteria | 709 |
| 270 | Ga0436361_0406703 | 3300039447 | Bacteria | 1046 |
| 271 | Ga0436363_0484192 | 3300039450 | Bacteria | 1233 |
| 272 | Ga0451793_1242619 | 3300041452 | Bacteria | 920 |
| 273 | Ga0451853_3130839 | 3300041512 | Bacteria | 2037 |
| 274 | Ga0466969_0101819 | 3300044656 | Bacteria | 1351 |
| 275 | Ga0466972_0000107 | 3300044658 | Bacteria | 71873 |
| 276 | Ga0466972_0037535 | 3300044658 | Bacteria | 2368 |
| 277 | Ga0466972_0075192 | 3300044658 | Bacteria | 1610 |
| 278 | Ga0466965_0069700 | 3300044683 | Bacteria | 1767 |
| 279 | Ga0466966_0356384 | 3300044684 | Bacteria | 879 |
| 280 | Ga0466961_0197223 | 3300044693 | Bacteria | 1246 |
| 281 | Ga0466971_0114410 | 3300044719 | Bacteria | 1246 |
| 282 | Ga0466968_0048898 | 3300044735 | Bacteria | 1800 |
| 283 | Ga0466968_0139117 | 3300044735 | Bacteria | 1109 |
| 284 | Ga0466968_0276529 | 3300044735 | Bacteria | 803 |
| 285 | Ga0466970_0032219 | 3300044765 | Bacteria | 2769 |
| 286 | Ga0466957_0056717 | 3300044842 | Bacteria | 2396 |
| 287 | Ga0466960_0012111 | 3300044901 | Bacteria | 3630 |
| 288 | Ga0466959_0067109 | 3300045049 | Bacteria | 2601 |
| 289 | Ga0466967_0030343 | 3300045976 | Bacteria | 4536 |
| 290 | Ga0495592_0018632 | 3300046454 | Bacteria | 5283 |
| 291 | Ga0495603_0002718 | 3300046455 | Bacteria | 10429 |
| 292 | Ga0495603_0618175 | 3300046455 | Bacteria | 620 |
| 293 | Ga0495590_0167088 | 3300046457 | Bacteria | 801 |
| 294 | Ga0495629_0000727 | 3300046459 | Bacteria | 26728 |
| 295 | Ga0495629_0051911 | 3300046459 | Bacteria | 2869 |
| 296 | Ga0495629_0543880 | 3300046459 | Bacteria | 780 |
| 297 | Ga0495629_0739630 | 3300046459 | Bacteria | 651 |
| 298 | Ga0495638_0322226 | 3300046460 | Bacteria | 825 |
| 299 | Ga0495641_0004166 | 3300046461 | Bacteria | 10395 |
| 300 | Ga0495651_0000661 | 3300046462 | Bacteria | 26738 |
| 301 | Ga0495580_0000246 | 3300046472 | Bacteria | 43076 |
| 302 | Ga0495580_0012045 | 3300046472 | Bacteria | 6658 |
| 303 | Ga0495582_0000494 | 3300046473 | Bacteria | 21572 |
| 304 | Ga0495582_0028272 | 3300046473 | Bacteria | 3077 |
| 305 | Ga0495582_0077162 | 3300046473 | Bacteria | 1848 |
| 306 | Ga0495582_0214810 | 3300046473 | Bacteria | 1100 |
| 307 | Ga0495605_0217053 | 3300046474 | Bacteria | 828 |
| 308 | Ga0495639_0000119 | 3300046475 | Bacteria | 39930 |
| 309 | Ga0495639_0006327 | 3300046475 | Bacteria | 5089 |
| 310 | Ga0495639_0319549 | 3300046475 | Bacteria | 776 |
| 311 | Ga0495662_0001142 | 3300046476 | Bacteria | 13095 |
| 312 | Ga0495662_0144246 | 3300046476 | Bacteria | 1172 |
| 313 | Ga0495664_0025257 | 3300046477 | Bacteria | 3458 |
| 314 | Ga0495664_0049070 | 3300046477 | Bacteria | 2506 |
| 315 | Ga0495664_0106632 | 3300046477 | Bacteria | 1689 |
| 316 | Ga0495594_0004003 | 3300046499 | Bacteria | 7579 |
| 317 | Ga0495608_0016190 | 3300046511 | Bacteria | 5159 |
| 318 | Ga0495618_0083133 | 3300046514 | Bacteria | 2045 |
| 319 | Ga0495628_0017937 | 3300046516 | Bacteria | 5874 |
| 320 | Ga0495630_0111067 | 3300046517 | Bacteria | 2076 |
| 321 | Ga0495630_0263073 | 3300046517 | Bacteria | 1318 |
| 322 | Ga0495630_0523216 | 3300046517 | Bacteria | 909 |
| 323 | Ga0495630_0674105 | 3300046517 | Bacteria | 791 |
| 324 | Ga0495632_0198769 | 3300046519 | Bacteria | 914 |
| 325 | Ga0495666_0012738 | 3300046526 | Bacteria | 4192 |
| 326 | Ga0495666_0053467 | 3300046526 | Bacteria | 1938 |
| 327 | Ga0495652_0032064 | 3300046529 | Bacteria | 4597 |
| 328 | Ga0495665_0000251 | 3300046531 | Bacteria | 26959 |
| 329 | Ga0495665_0029705 | 3300046531 | Bacteria | 2928 |
| 330 | Ga0495640_0014321 | 3300046533 | Bacteria | 6004 |
| 331 | Ga0495640_0142418 | 3300046533 | Bacteria | 1545 |
| 332 | Ga0495640_0205294 | 3300046533 | Bacteria | 1247 |
| 333 | Ga0495586_0127261 | 3300046535 | Bacteria | 1425 |
| 334 | Ga0495587_0000339 | 3300046536 | Bacteria | 33290 |
| 335 | Ga0495597_0278889 | 3300046542 | Bacteria | 651 |
| 336 | Ga0495645_0007915 | 3300046543 | Bacteria | 7397 |
| 337 | Ga0495622_0032065 | 3300046557 | Bacteria | 2453 |
| 338 | Ga0495667_0013822 | 3300046559 | Bacteria | 5452 |
| 339 | Ga0495667_0218418 | 3300046559 | Bacteria | 1217 |
| 340 | Ga0495656_0465270 | 3300046615 | Bacteria | 667 |
| 341 | Ga0495634_0000886 | 3300046642 | Bacteria | 28754 |
| 342 | Ga0495634_0088946 | 3300046642 | Bacteria | 2008 |
| 343 | Ga0495635_0001208 | 3300046663 | Bacteria | 17261 |
| 344 | Ga0495635_0001322 | 3300046663 | Bacteria | 16499 |
| 345 | Ga0495588_0037029 | 3300046674 | Bacteria | 2477 |
| 346 | Ga0495588_0108811 | 3300046674 | Bacteria | 1459 |
| 347 | Ga0495657_0198144 | 3300046675 | Bacteria | 1225 |
| 348 | Ga0495657_0319908 | 3300046675 | Unclassified | 922 |
| 349 | Ga0495599_0211033 | 3300046678 | Bacteria | 1190 |
| 350 | Ga0495599_0236690 | 3300046678 | Bacteria | 1114 |
| 351 | Ga0495646_0002747 | 3300046680 | Bacteria | 10876 |
| 352 | Ga0495646_0003823 | 3300046680 | Bacteria | 9410 |
| 353 | Ga0495647_0000085 | 3300046681 | Bacteria | 22908 |
| 354 | Ga0495647_0058975 | 3300046681 | Bacteria | 1510 |
| 355 | Ga0495658_0000135 | 3300046683 | Bacteria | 40991 |
| 356 | Ga0495613_0529770 | 3300046689 | Bacteria | 790 |
| 357 | Ga0495624_0000144 | 3300046690 | Bacteria | 51509 |
| 358 | Ga0495624_0119526 | 3300046690 | Bacteria | 1619 |
| 359 | Ga0495600_0238847 | 3300046809 | Bacteria | 1158 |
| 360 | Ga0495581_0000421 | 3300047315 | Bacteria | 21445 |
| 361 | Ga0495581_0427317 | 3300047315 | Bacteria | 772 |
| 362 | Ga0495604_0110337 | 3300047317 | Bacteria | 2007 |
| 363 | Ga0495604_0247268 | 3300047317 | Bacteria | 1217 |
| 364 | Ga0495674_0001274 | 3300047319 | Bacteria | 24483 |
| 365 | Ga0495674_0286397 | 3300047319 | Bacteria | 1349 |
| 366 | Ga0495674_0483917 | 3300047319 | Bacteria | 991 |
| 367 | Ga0495676_0007487 | 3300047321 | Bacteria | 10015 |
| 368 | Ga0495676_0207212 | 3300047321 | Bacteria | 1359 |
| 369 | Ga0495680_0009805 | 3300047322 | Bacteria | 8589 |
| 370 | Ga0495680_0202615 | 3300047322 | Bacteria | 1423 |
| 371 | Ga0495675_0004040 | 3300047444 | Bacteria | 8892 |
| 372 | Ga0495684_0134276 | 3300047471 | Bacteria | 1857 |
| 373 | Ga0495684_0498897 | 3300047471 | Bacteria | 837 |
| 374 | Ga0495593_0000007 | 3300047673 | Bacteria | 87657 |
| 375 | Ga0495602_0033867 | 3300048088 | Bacteria | 4786 |
| 376 | Ga0495614_0007215 | 3300048089 | Bacteria | 4953 |
| 377 | Ga0496100_0114824 | 3300048903 | Bacteria | 1876 |
| 378 | Ga0496101_0002295 | 3300048904 | Bacteria | 11691 |
| 379 | Ga0496101_0028524 | 3300048904 | Bacteria | 3897 |
| 380 | Ga0496101_0400037 | 3300048904 | Bacteria | 1081 |
| 381 | Ga0496102_0003496 | 3300048905 | Bacteria | 13323 |
| 382 | Ga0496102_0051167 | 3300048905 | Bacteria | 3763 |
| 383 | Ga0496102_0477595 | 3300048905 | Bacteria | 1168 |
| 384 | Ga0496102_0922133 | 3300048905 | Bacteria | 795 |
| 385 | Ga0496103_0005524 | 3300048906 | Bacteria | 7563 |
| 386 | Ga0496104_0000517 | 3300048907 | Bacteria | 33033 |
| 387 | Ga0496104_0012015 | 3300048907 | Bacteria | 7770 |
| 388 | Ga0496104_0053180 | 3300048907 | Bacteria | 3825 |
| 389 | Ga0496104_0179338 | 3300048907 | Bacteria | 2028 |
| 390 | Ga0496105_0012456 | 3300048908 | Bacteria | 6733 |
| 391 | Ga0496105_0026588 | 3300048908 | Bacteria | 4722 |
| 392 | Ga0496105_0040580 | 3300048908 | Bacteria | 3837 |
| 393 | Ga0496105_0094038 | 3300048908 | Bacteria | 2475 |
| 394 | Ga0496106_0004144 | 3300048909 | Bacteria | 10806 |
| 395 | Ga0496106_0076702 | 3300048909 | Bacteria | 2562 |
| 396 | Ga0496106_0361266 | 3300048909 | Bacteria | 1166 |
| 397 | Ga0496106_1038362 | 3300048909 | Bacteria | 644 |
| 398 | Ga0496107_0007336 | 3300048910 | Bacteria | 7602 |
| 399 | Ga0496107_0137567 | 3300048910 | Bacteria | 1805 |
| 400 | Ga0496107_0200679 | 3300048910 | Bacteria | 1482 |
| 401 | Ga0496108_0002968 | 3300048911 | Bacteria | 13629 |
| 402 | Ga0496108_0009442 | 3300048911 | Bacteria | 7900 |
| 403 | Ga0496108_0012940 | 3300048911 | Bacteria | 6799 |
| 404 | Ga0496108_0060642 | 3300048911 | Bacteria | 3183 |
| 405 | Ga0496108_0260464 | 3300048911 | Bacteria | 1509 |
| 406 | Ga0496109_0000536 | 3300048912 | Bacteria | 32149 |
| 407 | Ga0496109_0003252 | 3300048912 | Bacteria | 13541 |
| 408 | Ga0496109_0033178 | 3300048912 | Bacteria | 4643 |
| 409 | Ga0496109_0118817 | 3300048912 | Bacteria | 2461 |
| 410 | Ga0496110_0007869 | 3300048913 | Bacteria | 8537 |
| 411 | Ga0496110_0011070 | 3300048913 | Bacteria | 7365 |
| 412 | Ga0496110_0027358 | 3300048913 | Bacteria | 4888 |
| 413 | Ga0496110_0067035 | 3300048913 | Bacteria | 3175 |
| 414 | Ga0496111_0072677 | 3300048914 | Bacteria | 2503 |
| 415 | Ga0496111_0094051 | 3300048914 | Bacteria | 2198 |
| 416 | Ga0496111_0114599 | 3300048914 | Bacteria | 1987 |
| 417 | Ga0496111_0210701 | 3300048914 | Bacteria | 1443 |
| 418 | Ga0496111_0475346 | 3300048914 | Bacteria | 921 |
| 419 | Ga0496112_0001698 | 3300048915 | Bacteria | 17181 |
| 420 | Ga0496112_0003481 | 3300048915 | Bacteria | 13031 |
| 421 | Ga0496112_0014567 | 3300048915 | Bacteria | 7304 |
| 422 | Ga0496112_0199848 | 3300048915 | Bacteria | 1959 |
| 423 | Ga0496112_0308339 | 3300048915 | Bacteria | 1528 |
| 424 | Ga0496113_0010612 | 3300048916 | Bacteria | 6099 |
| 425 | Ga0496113_0013241 | 3300048916 | Bacteria | 5579 |
| 426 | Ga0496113_0027340 | 3300048916 | Bacteria | 4089 |
| 427 | Ga0496113_0045387 | 3300048916 | Bacteria | 3259 |
| 428 | Ga0496114_0184123 | 3300048917 | Bacteria | 1825 |
| 429 | Ga0496114_0281834 | 3300048917 | Bacteria | 1465 |
| 430 | Ga0496114_0717827 | 3300048917 | Bacteria | 876 |
| 431 | Ga0496115_0028722 | 3300048918 | Bacteria | 4361 |
| 432 | Ga0496115_0067108 | 3300048918 | Bacteria | 2900 |
| 433 | Ga0496115_0171375 | 3300048918 | Bacteria | 1795 |
| 434 | Ga0496115_0279350 | 3300048918 | Bacteria | 1371 |
| 435 | Ga0496115_0555467 | 3300048918 | Bacteria | 917 |
| 436 | Ga0496115_0940651 | 3300048918 | Bacteria | 664 |
| 437 | Ga0496121_0152242 | 3300048924 | Bacteria | 1701 |
| 438 | Ga0496121_0410993 | 3300048924 | Bacteria | 883 |
| 439 | Ga0496124_0182051 | 3300048927 | Bacteria | 1616 |
| 440 | Ga0496125_0615532 | 3300048928 | Bacteria | 590 |
| 441 | Ga0496126_0025186 | 3300048929 | Bacteria | 5729 |
| 442 | Ga0496126_0064106 | 3300048929 | Bacteria | 3292 |
| 443 | Ga0496126_0210930 | 3300048929 | Bacteria | 1635 |
| 444 | Ga0496126_0410754 | 3300048929 | Bacteria | 1096 |
| 445 | Ga0501047_0277439 | 3300049581 | Bacteria | 1521 |
| 446 | Ga0501048_0557762 | 3300049582 | Bacteria | 822 |
| 447 | Ga0501070_0033822 | 3300049586 | Bacteria | 4278 |
| 448 | Ga0501073_0184349 | 3300049589 | Bacteria | 1445 |
| 449 | Ga0501074_0007921 | 3300049590 | Bacteria | 7695 |
| 450 | Ga0501079_0489170 | 3300049741 | Bacteria | 967 |
| 451 | Ga0501080_0018158 | 3300049742 | Bacteria | 6510 |
| 452 | Ga0501044_0045151 | 3300049823 | Bacteria | 4568 |
| 453 | nmdc:mga03n38_270632_c1 | 3300050490 | Bacteria | 903 |
| 454 | nmdc:mga03n38_89108_c1 | 3300050490 | Bacteria | 1465 |
| 455 | nmdc:mga00v17_234830_c1 | 3300050491 | Bacteria | 1188 |
| 456 | nmdc:mga0yw44_163726_c1 | 3300050492 | Bacteria | 1457 |
| 457 | nmdc:mga0k408_478422_c1 | 3300050493 | Bacteria | 739 |
| 458 | nmdc:mga06z11_160093_c1 | 3300050494 | Bacteria | 1286 |
| 459 | nmdc:mga06z11_504044_c1 | 3300050494 | Bacteria | 733 |
| 460 | nmdc:mga06z11_77885_c1 | 3300050494 | Bacteria | 1771 |
| 461 | nmdc:mga04h51_67672_c1 | 3300050495 | Bacteria | 1239 |
| 462 | nmdc:mga07m45_144624_c1 | 3300050496 | Bacteria | 1378 |
| 463 | nmdc:mga05p37_66227_c1 | 3300050507 | Bacteria | 4443 |
| 464 | nmdc:mga05p37_809986_c1 | 3300050507 | Bacteria | 1023 |
| 465 | nmdc:mga09592_354023_c1 | 3300050508 | Bacteria | 1270 |
| 466 | nmdc:mga06r32_124457_c1 | 3300050510 | Bacteria | 2545 |
| 467 | nmdc:mga06r32_455502_c1 | 3300050510 | Bacteria | 1259 |
| 468 | nmdc:mga0n895_42430_c1 | 3300050512 | Bacteria | 4425 |
| 469 | Ga0495601_0111850 | 3300053077 | Bacteria | 1769 |
| 470 | Ga0495601_0181981 | 3300053077 | Bacteria | 1374 |
| 471 | Ga0495601_0225372 | 3300053077 | Bacteria | 1224 |
| 472 | Ga0495612_0002910 | 3300053078 | Bacteria | 7099 |
| 473 | Ga0495612_0028993 | 3300053078 | Bacteria | 2228 |
| 474 | Ga0495655_0037605 | 3300053083 | Bacteria | 1217 |
| 475 | Ga0495595_0018541 | 3300053084 | Bacteria | 3008 |
| 476 | Ga0495619_0275360 | 3300053085 | Bacteria | 1166 |
| 477 | Ga0495619_0603168 | 3300053085 | Bacteria | 751 |
| 478 | Ga0500566_0008515 | 3300053094 | Bacteria | 6065 |
| 479 | Ga0500595_024041 | 3300053119 | Bacteria | 2131 |
| 480 | Ga0500608_008620 | 3300053122 | Bacteria | 4297 |
| 481 | Ga0500559_0000244 | 3300053136 | Bacteria | 42994 |
| 482 | Ga0500603_036500 | 3300053150 | Bacteria | 1293 |
| 483 | Ga0500627_0078212 | 3300053158 | Bacteria | 1472 |
| 484 | Ga0500638_005746 | 3300053162 | Bacteria | 4987 |
| 485 | Ga0500639_010041 | 3300053163 | Bacteria | 4954 |
| 486 | Ga0500636_0182396 | 3300053177 | Bacteria | 1126 |
| 487 | Ga0500661_001701 | 3300055283 | Bacteria | 4140 |
| 488 | Ga0466962_0120391 | 3300061719 | Bacteria | 1266 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025915 | Ga0207693_10439698 | Ga0207693_104396982 | 151 |
| 2 | 3300048904 | Ga0496101_0400037 | Ga0496101_0400037_467_1018 | 158 |
| 3 | 3300048907 | Ga0496104_0053180 | Ga0496104_0053180_2598_3149 | 158 |
| 4 | 3300048911 | Ga0496108_0260464 | Ga0496108_0260464_293_865 | 158 |
| 5 | 3300048918 | Ga0496115_0555467 | Ga0496115_0555467_343_894 | 158 |
| 6 | 3300048914 | Ga0496111_0475346 | Ga0496111_0475346_153_704 | 159 |
| 7 | 3300035172 | Ga0373955_0191509 | Ga0373955_0191509_147_668 | 160 |
| 8 | 3300035724 | Ga0373933_0139110 | Ga0373933_0139110_93_614 | 160 |
| 9 | 3300036401 | Ga0373937_0006754 | Ga0373937_0006754_6311_6832 | 160 |
| 10 | 3300047471 | Ga0495684_0498897 | Ga0495684_0498897_282_803 | 160 |
| 11 | 3300006178 | Ga0075367_10165113 | Ga0075367_101651132 | 161 |
| 12 | 3300006871 | Ga0075434_100072244 | Ga0075434_1000722443 | 161 |
| 13 | 3300050494 | nmdc:mga06z11_77885_c1 | nmdc:mga06z11_77885_c1_178_726 | 161 |
| 14 | 3300050512 | nmdc:mga0n895_42430_c1 | nmdc:mga0n895_42430_c1_2491_3000 | 161 |
| 15 | 3300050491 | nmdc:mga00v17_234830_c1 | nmdc:mga00v17_234830_c1_475_978 | 162 |
| 16 | 3300037471 | Ga0395905_0018997 | Ga0395905_0018997_2914_3405 | 163 |
| 17 | 3300048917 | Ga0496114_0717827 | Ga0496114_0717827_230_799 | 163 |
| 18 | 3300050493 | nmdc:mga0k408_478422_c1 | nmdc:mga0k408_478422_c1_14_505 | 163 |
| 19 | 3300050496 | nmdc:mga07m45_144624_c1 | nmdc:mga07m45_144624_c1_576_1067 | 163 |
| 20 | 3300053158 | Ga0500627_0078212 | Ga0500627_0078212_544_1050 | 163 |
| 21 | 3300005983 | Ga0081540_1005846 | Ga0081540_10058467 | 164 |
| 22 | 3300048929 | Ga0496126_0025186 | Ga0496126_0025186_3706_4203 | 164 |
| 23 | iso_pu_bacteria | 2524023210 | 2524469518 | 164 |
| 24 | iso_pu_bacteria | 8056681323 | 8056686580 | 164 |
| 25 | 3300049581 | Ga0501047_0277439 | Ga0501047_0277439_163_678 | 165 |
| 26 | 3300049582 | Ga0501048_0557762 | Ga0501048_0557762_131_646 | 165 |
| 27 | 3300049586 | Ga0501070_0033822 | Ga0501070_0033822_371_886 | 165 |
| 28 | 3300049589 | Ga0501073_0184349 | Ga0501073_0184349_812_1327 | 165 |
| 29 | 3300049590 | Ga0501074_0007921 | Ga0501074_0007921_2055_2570 | 165 |
| 30 | 3300049741 | Ga0501079_0489170 | Ga0501079_0489170_428_943 | 165 |
| 31 | 3300049742 | Ga0501080_0018158 | Ga0501080_0018158_3160_3675 | 165 |
| 32 | 3300049823 | Ga0501044_0045151 | Ga0501044_0045151_1297_1812 | 165 |
| 33 | 3300005364 | Ga0070673_100496749 | Ga0070673_1004967492 | 166 |
| 34 | 3300005535 | Ga0070684_100433992 | Ga0070684_1004339921 | 166 |
| 35 | 3300005618 | Ga0068864_100381847 | Ga0068864_1003818472 | 166 |
| 36 | 3300005842 | Ga0068858_100391621 | Ga0068858_1003916212 | 166 |
| 37 | 3300006844 | Ga0075428_100329369 | Ga0075428_1003293692 | 166 |
| 38 | 3300006847 | Ga0075431_100996279 | Ga0075431_1009962792 | 166 |
| 39 | 3300009094 | Ga0111539_10061817 | Ga0111539_100618179 | 166 |
| 40 | 3300009101 | Ga0105247_10234261 | Ga0105247_102342612 | 166 |
| 41 | 3300009147 | Ga0114129_10040520 | Ga0114129_100405209 | 166 |
| 42 | 3300009147 | Ga0114129_10566230 | Ga0114129_105662302 | 166 |
| 43 | 3300009553 | Ga0105249_10199315 | Ga0105249_101993152 | 166 |
| 44 | 3300011119 | Ga0105246_10401546 | Ga0105246_104015462 | 166 |
| 45 | 3300014325 | Ga0163163_10046231 | Ga0163163_100462313 | 166 |
| 46 | 3300014968 | Ga0157379_10860016 | Ga0157379_108600161 | 166 |
| 47 | 3300025925 | Ga0207650_10021414 | Ga0207650_100214143 | 166 |
| 48 | 3300025945 | Ga0207679_10284619 | Ga0207679_102846191 | 166 |
| 49 | 3300025960 | Ga0207651_11036537 | Ga0207651_110365371 | 166 |
| 50 | 3300026095 | Ga0207676_10608791 | Ga0207676_106087912 | 166 |
| 51 | 3300035092 | Ga0373952_0163027 | Ga0373952_0163027_65_577 | 166 |
| 52 | 3300035241 | Ga0373961_0138864 | Ga0373961_0138864_32_544 | 166 |
| 53 | 3300035691 | Ga0373931_0608671 | Ga0373931_0608671_64_576 | 166 |
| 54 | 3300035725 | Ga0373947_0118537 | Ga0373947_0118537_1052_1564 | 166 |
| 55 | 3300046473 | Ga0495582_0214810 | Ga0495582_0214810_530_1042 | 166 |
| 56 | 3300046517 | Ga0495630_0263073 | Ga0495630_0263073_686_1198 | 166 |
| 57 | 3300046533 | Ga0495640_0142418 | Ga0495640_0142418_1008_1520 | 166 |
| 58 | 3300047319 | Ga0495674_0286397 | Ga0495674_0286397_592_1104 | 166 |
| 59 | 3300048904 | Ga0496101_0028524 | Ga0496101_0028524_944_1456 | 166 |
| 60 | 3300048907 | Ga0496104_0000517 | Ga0496104_0000517_21153_21665 | 166 |
| 61 | 3300048908 | Ga0496105_0026588 | Ga0496105_0026588_4152_4664 | 166 |
| 62 | 3300048909 | Ga0496106_0361266 | Ga0496106_0361266_285_797 | 166 |
| 63 | 3300048910 | Ga0496107_0137567 | Ga0496107_0137567_499_1011 | 166 |
| 64 | 3300048911 | Ga0496108_0002968 | Ga0496108_0002968_1522_2034 | 166 |
| 65 | 3300048912 | Ga0496109_0000536 | Ga0496109_0000536_479_991 | 166 |
| 66 | 3300048913 | Ga0496110_0027358 | Ga0496110_0027358_535_1047 | 166 |
| 67 | 3300048914 | Ga0496111_0210701 | Ga0496111_0210701_106_618 | 166 |
| 68 | 3300048915 | Ga0496112_0001698 | Ga0496112_0001698_5273_5785 | 166 |
| 69 | 3300048916 | Ga0496113_0027340 | Ga0496113_0027340_1501_2013 | 166 |
| 70 | 3300050507 | nmdc:mga05p37_66227_c1 | nmdc:mga05p37_66227_c1_1260_1772 | 166 |
| 71 | 3300050507 | nmdc:mga05p37_809986_c1 | nmdc:mga05p37_809986_c1_468_968 | 166 |
| 72 | 3300050510 | nmdc:mga06r32_124457_c1 | nmdc:mga06r32_124457_c1_570_1082 | 166 |
| 73 | 3300005937 | Ga0081455_10072677 | Ga0081455_100726773 | 167 |
| 74 | 3300005981 | Ga0081538_10109783 | Ga0081538_101097832 | 167 |
| 75 | 3300006042 | Ga0075368_10205443 | Ga0075368_102054431 | 167 |
| 76 | 3300006051 | Ga0075364_10186728 | Ga0075364_101867281 | 167 |
| 77 | 3300006177 | Ga0075362_10060148 | Ga0075362_100601482 | 167 |
| 78 | 3300006178 | Ga0075367_10155653 | Ga0075367_101556531 | 167 |
| 79 | 3300006186 | Ga0075369_10238599 | Ga0075369_102385991 | 167 |
| 80 | 3300050494 | nmdc:mga06z11_160093_c1 | nmdc:mga06z11_160093_c1_512_1042 | 167 |
| 81 | 3300050495 | nmdc:mga04h51_67672_c1 | nmdc:mga04h51_67672_c1_86_616 | 167 |
| 82 | 3300050508 | nmdc:mga09592_354023_c1 | nmdc:mga09592_354023_c1_627_1145 | 167 |
| 83 | 3300050510 | nmdc:mga06r32_455502_c1 | nmdc:mga06r32_455502_c1_42_560 | 167 |
| 84 | iso_pu_bacteria | 2513237096 | 2513660821 | 167 |
| 85 | iso_pu_bacteria | 2513237098 | 2513675083 | 167 |
| 86 | iso_pu_bacteria | 2513237137 | 2513860882 | 167 |
| 87 | iso_pu_bacteria | 2513237145 | 2513922557 | 167 |
| 88 | iso_pu_bacteria | 2517572143 | 2517888904 | 167 |
| 89 | iso_pu_bacteria | 2524023228 | 2524536984 | 167 |
| 90 | iso_pu_bacteria | 2617270741 | 2617373812 | 167 |
| 91 | iso_pu_bacteria | 2667528175 | 2671122510 | 167 |
| 92 | iso_pu_bacteria | 2728368998 | 2728755050 | 167 |
| 93 | iso_pu_bacteria | 2791355197 | 2793074023 | 167 |
| 94 | iso_pu_bacteria | 2824679649 | 2824686541 | 167 |
| 95 | iso_pu_bacteria | 2824746037 | 2824748645 | 167 |
| 96 | iso_pu_bacteria | 2842038055 | 2842043452 | 167 |
| 97 | iso_pu_bacteria | 2842045827 | 2842052558 | 167 |
| 98 | iso_pu_bacteria | 2844315083 | 2844315393 | 167 |
| 99 | iso_pu_bacteria | 2874620515 | 2874624845 | 167 |
| 100 | iso_pu_bacteria | 2885374607 | 2885377496 | 167 |
| 101 | iso_pu_bacteria | 2885383462 | 2885388897 | 167 |
| 102 | iso_pu_bacteria | 2903727486 | 2903732252 | 167 |
| 103 | iso_pu_bacteria | 2903748898 | 2903752088 | 167 |
| 104 | iso_pu_bacteria | 2903768456 | 2903771811 | 167 |
| 105 | iso_pu_bacteria | 2904666416 | 2904670200 | 167 |
| 106 | iso_pu_bacteria | 2904690495 | 2904691138 | 167 |
| 107 | iso_pu_bacteria | 2904699407 | 2904708612 | 167 |
| 108 | iso_pu_bacteria | 2906602504 | 2906604331 | 167 |
| 109 | iso_pu_bacteria | 2906610324 | 2906613932 | 167 |
| 110 | iso_pu_bacteria | 2906635258 | 2906637569 | 167 |
| 111 | iso_pu_bacteria | 2906660503 | 2906668780 | 167 |
| 112 | iso_pu_bacteria | 2908739725 | 2908747507 | 167 |
| 113 | iso_pu_bacteria | 2908756301 | 2908756532 | 167 |
| 114 | iso_pu_bacteria | 2908775508 | 2908776329 | 167 |
| 115 | iso_pu_bacteria | 2922393267 | 2922394291 | 167 |
| 116 | iso_pu_bacteria | 2922425934 | 2922434160 | 167 |
| 117 | iso_pu_bacteria | 2935630451 | 2935637077 | 167 |
| 118 | iso_pu_bacteria | 2941507105 | 2941513656 | 167 |
| 119 | iso_pu_bacteria | 2941515067 | 2941521619 | 167 |
| 120 | iso_pu_bacteria | 2941523033 | 2941529432 | 167 |
| 121 | iso_pu_bacteria | 3005474847 | 3005475130 | 167 |
| 122 | iso_pu_bacteria | 3005483717 | 3005489018 | 167 |
| 123 | iso_pu_bacteria | 3005587118 | 3005591572 | 167 |
| 124 | iso_pu_bacteria | 3005718088 | 3005718358 | 167 |
| 125 | iso_pu_bacteria | 8006926726 | 8006933256 | 167 |
| 126 | iso_pu_bacteria | 8006933436 | 8006936161 | 167 |
| 127 | iso_pu_bacteria | 8006973647 | 8006976107 | 167 |
| 128 | iso_pu_bacteria | 8019555841 | 8019562499 | 167 |
| 129 | iso_pu_bacteria | 8019565922 | 8019572573 | 167 |
| 130 | iso_pu_bacteria | 8056689827 | 8056691010 | 167 |
| 131 | 3300006852 | Ga0075433_10783824 | Ga0075433_107838241 | 168 |
| 132 | 3300025915 | Ga0207693_10268901 | Ga0207693_102689012 | 168 |
| 133 | 3300031247 | Ga0265340_10012058 | Ga0265340_100120582 | 168 |
| 134 | 3300031711 | Ga0265314_10157267 | Ga0265314_101572672 | 168 |
| 135 | 3300035111 | Ga0373923_0014521 | Ga0373923_0014521_2216_2728 | 168 |
| 136 | 3300035117 | Ga0373953_0049383 | Ga0373953_0049383_1161_1673 | 168 |
| 137 | 3300035120 | Ga0373957_0095581 | Ga0373957_0095581_281_793 | 168 |
| 138 | 3300035410 | Ga0373924_0006576 | Ga0373924_0006576_3448_3960 | 168 |
| 139 | 3300035724 | Ga0373933_0002403 | Ga0373933_0002403_1995_2501 | 168 |
| 140 | 3300036401 | Ga0373937_0001983 | Ga0373937_0001983_6249_6761 | 168 |
| 141 | 3300037068 | Ga0373925_0294967 | Ga0373925_0294967_277_789 | 168 |
| 142 | 3300046454 | Ga0495592_0018632 | Ga0495592_0018632_3324_3836 | 168 |
| 143 | 3300046462 | Ga0495651_0000661 | Ga0495651_0000661_1545_2057 | 168 |
| 144 | 3300046511 | Ga0495608_0016190 | Ga0495608_0016190_4282_4794 | 168 |
| 145 | 3300046536 | Ga0495587_0000339 | Ga0495587_0000339_27708_28220 | 168 |
| 146 | 3300046663 | Ga0495635_0001322 | Ga0495635_0001322_15955_16467 | 168 |
| 147 | 3300046675 | Ga0495657_0319908 | Ga0495657_0319908_47_559 | 168 |
| 148 | 3300046680 | Ga0495646_0002747 | Ga0495646_0002747_5104_5616 | 168 |
| 149 | 3300047322 | Ga0495680_0009805 | Ga0495680_0009805_5114_5626 | 168 |
| 150 | 3300047444 | Ga0495675_0004040 | Ga0495675_0004040_1016_1528 | 168 |
| 151 | 3300048088 | Ga0495602_0033867 | Ga0495602_0033867_429_941 | 168 |
| 152 | 3300048905 | Ga0496102_0477595 | Ga0496102_0477595_636_1148 | 168 |
| 153 | 3300048907 | Ga0496104_0012015 | Ga0496104_0012015_6914_7420 | 168 |
| 154 | 3300048911 | Ga0496108_0060642 | Ga0496108_0060642_2415_2921 | 168 |
| 155 | 3300048915 | Ga0496112_0199848 | Ga0496112_0199848_19_531 | 168 |
| 156 | 3300048915 | Ga0496112_0308339 | Ga0496112_0308339_250_762 | 168 |
| 157 | 3300048918 | Ga0496115_0028722 | Ga0496115_0028722_2638_3144 | 168 |
| 158 | 3300053078 | Ga0495612_0002910 | Ga0495612_0002910_4776_5288 | 168 |
| 159 | 3300053084 | Ga0495595_0018541 | Ga0495595_0018541_603_1115 | 168 |
| 160 | 3300006042 | Ga0075368_10151203 | Ga0075368_101512031 | 169 |
| 161 | 3300006195 | Ga0075366_10029827 | Ga0075366_100298272 | 169 |
| 162 | 3300006353 | Ga0075370_10151650 | Ga0075370_101516502 | 169 |
| 163 | 3300009093 | Ga0105240_10004777 | Ga0105240_1000477713 | 169 |
| 164 | 3300025261 | Ga0209233_1007665 | Ga0209233_10076653 | 169 |
| 165 | 3300026121 | Ga0207683_10631589 | Ga0207683_106315891 | 169 |
| 166 | 3300033442 | Ga0315911_1000008 | Ga0315911_1000008246 | 169 |
| 167 | 3300039450 | Ga0436363_0484192 | Ga0436363_0484192_578_1087 | 169 |
| 168 | 3300044658 | Ga0466972_0075192 | Ga0466972_0075192_742_1251 | 169 |
| 169 | 3300046455 | Ga0495603_0618175 | Ga0495603_0618175_68_583 | 169 |
| 170 | 3300048929 | Ga0496126_0210930 | Ga0496126_0210930_47_556 | 169 |
| 171 | 3300004803 | Ga0058862_12548500 | Ga0058862_125485001 | 170 |
| 172 | 3300005331 | Ga0070670_100272627 | Ga0070670_1002726272 | 170 |
| 173 | 3300005338 | Ga0068868_100054743 | Ga0068868_1000547434 | 170 |
| 174 | 3300005341 | Ga0070691_10213807 | Ga0070691_102138071 | 170 |
| 175 | 3300005355 | Ga0070671_100289945 | Ga0070671_1002899451 | 170 |
| 176 | 3300005356 | Ga0070674_100056596 | Ga0070674_1000565963 | 170 |
| 177 | 3300005365 | Ga0070688_100397101 | Ga0070688_1003971011 | 170 |
| 178 | 3300005436 | Ga0070713_100126962 | Ga0070713_1001269622 | 170 |
| 179 | 3300005436 | Ga0070713_100863065 | Ga0070713_1008630651 | 170 |
| 180 | 3300005455 | Ga0070663_100022584 | Ga0070663_1000225842 | 170 |
| 181 | 3300005456 | Ga0070678_100061795 | Ga0070678_1000617953 | 170 |
| 182 | 3300005466 | Ga0070685_10472771 | Ga0070685_104727712 | 170 |
| 183 | 3300005535 | Ga0070684_100046817 | Ga0070684_1000468172 | 170 |
| 184 | 3300005536 | Ga0070697_100009632 | Ga0070697_1000096321 | 170 |
| 185 | 3300005548 | Ga0070665_100298515 | Ga0070665_1002985151 | 170 |
| 186 | 3300005548 | Ga0070665_100735143 | Ga0070665_1007351431 | 170 |
| 187 | 3300005548 | Ga0070665_101008173 | Ga0070665_1010081732 | 170 |
| 188 | 3300005563 | Ga0068855_100688531 | Ga0068855_1006885311 | 170 |
| 189 | 3300005564 | Ga0070664_100053295 | Ga0070664_1000532953 | 170 |
| 190 | 3300005618 | Ga0068864_100049859 | Ga0068864_1000498592 | 170 |
| 191 | 3300005718 | Ga0068866_10057490 | Ga0068866_100574901 | 170 |
| 192 | 3300005842 | Ga0068858_100451568 | Ga0068858_1004515681 | 170 |
| 193 | 3300005983 | Ga0081540_1085626 | Ga0081540_10856262 | 170 |
| 194 | 3300006028 | Ga0070717_10019833 | Ga0070717_100198333 | 170 |
| 195 | 3300006042 | Ga0075368_10119775 | Ga0075368_101197751 | 170 |
| 196 | 3300006048 | Ga0075363_100262362 | Ga0075363_1002623621 | 170 |
| 197 | 3300006175 | Ga0070712_100444132 | Ga0070712_1004441321 | 170 |
| 198 | 3300006237 | Ga0097621_100447086 | Ga0097621_1004470862 | 170 |
| 199 | 3300006353 | Ga0075370_10221759 | Ga0075370_102217591 | 170 |
| 200 | 3300006358 | Ga0068871_100420181 | Ga0068871_1004201811 | 170 |
| 201 | 3300006881 | Ga0068865_100040260 | Ga0068865_1000402604 | 170 |
| 202 | 3300006881 | Ga0068865_100749460 | Ga0068865_1007494601 | 170 |
| 203 | 3300007265 | Ga0099794_10033882 | Ga0099794_100338823 | 170 |
| 204 | 3300009093 | Ga0105240_10117059 | Ga0105240_101170592 | 170 |
| 205 | 3300009098 | Ga0105245_10007604 | Ga0105245_100076044 | 170 |
| 206 | 3300009098 | Ga0105245_12298231 | Ga0105245_122982311 | 170 |
| 207 | 3300009101 | Ga0105247_10396629 | Ga0105247_103966291 | 170 |
| 208 | 3300009148 | Ga0105243_10291740 | Ga0105243_102917402 | 170 |
| 209 | 3300009148 | Ga0105243_11150138 | Ga0105243_111501381 | 170 |
| 210 | 3300009177 | Ga0105248_10221213 | Ga0105248_102212133 | 170 |
| 211 | 3300009545 | Ga0105237_10016029 | Ga0105237_100160296 | 170 |
| 212 | 3300009545 | Ga0105237_10070886 | Ga0105237_100708863 | 170 |
| 213 | 3300009545 | Ga0105237_10434858 | Ga0105237_104348582 | 170 |
| 214 | 3300009545 | Ga0105237_10643937 | Ga0105237_106439372 | 170 |
| 215 | 3300009551 | Ga0105238_10037927 | Ga0105238_100379274 | 170 |
| 216 | 3300009551 | Ga0105238_10587329 | Ga0105238_105873291 | 170 |
| 217 | 3300010375 | Ga0105239_10016959 | Ga0105239_100169593 | 170 |
| 218 | 3300010375 | Ga0105239_10132102 | Ga0105239_101321024 | 170 |
| 219 | 3300011119 | Ga0105246_10009574 | Ga0105246_100095742 | 170 |
| 220 | 3300013105 | Ga0157369_10005521 | Ga0157369_100055213 | 170 |
| 221 | 3300013105 | Ga0157369_10014138 | Ga0157369_100141387 | 170 |
| 222 | 3300013296 | Ga0157374_10012776 | Ga0157374_100127762 | 170 |
| 223 | 3300013297 | Ga0157378_10127170 | Ga0157378_101271702 | 170 |
| 224 | 3300013297 | Ga0157378_10421480 | Ga0157378_104214801 | 170 |
| 225 | 3300013306 | Ga0163162_10180203 | Ga0163162_101802032 | 170 |
| 226 | 3300013306 | Ga0163162_10909708 | Ga0163162_109097081 | 170 |
| 227 | 3300013307 | Ga0157372_10154991 | Ga0157372_101549913 | 170 |
| 228 | 3300013308 | Ga0157375_10046704 | Ga0157375_100467045 | 170 |
| 229 | 3300013308 | Ga0157375_10225589 | Ga0157375_102255892 | 170 |
| 230 | 3300014325 | Ga0163163_10116449 | Ga0163163_101164491 | 170 |
| 231 | 3300014325 | Ga0163163_10438918 | Ga0163163_104389181 | 170 |
| 232 | 3300014326 | Ga0157380_10177981 | Ga0157380_101779812 | 170 |
| 233 | 3300014745 | Ga0157377_10174220 | Ga0157377_101742201 | 170 |
| 234 | 3300014745 | Ga0157377_10442590 | Ga0157377_104425901 | 170 |
| 235 | 3300014968 | Ga0157379_10129317 | Ga0157379_101293174 | 170 |
| 236 | 3300014969 | Ga0157376_10086000 | Ga0157376_100860004 | 170 |
| 237 | 3300017792 | Ga0163161_10250534 | Ga0163161_102505342 | 170 |
| 238 | 3300017792 | Ga0163161_10279951 | Ga0163161_102799512 | 170 |
| 239 | 3300020070 | Ga0206356_10358370 | Ga0206356_103583703 | 170 |
| 240 | 3300020080 | Ga0206350_10285734 | Ga0206350_102857342 | 170 |
| 241 | 3300020082 | Ga0206353_10072688 | Ga0206353_100726881 | 170 |
| 242 | 3300021384 | Ga0213876_10145727 | Ga0213876_101457272 | 170 |
| 243 | 3300021388 | Ga0213875_10213735 | Ga0213875_102137351 | 170 |
| 244 | 3300025321 | Ga0207656_10189801 | Ga0207656_101898012 | 170 |
| 245 | 3300025899 | Ga0207642_10394644 | Ga0207642_103946441 | 170 |
| 246 | 3300025904 | Ga0207647_10084686 | Ga0207647_100846862 | 170 |
| 247 | 3300025913 | Ga0207695_10086938 | Ga0207695_100869384 | 170 |
| 248 | 3300025914 | Ga0207671_10017495 | Ga0207671_100174952 | 170 |
| 249 | 3300025914 | Ga0207671_10049535 | Ga0207671_100495352 | 170 |
| 250 | 3300025915 | Ga0207693_10087142 | Ga0207693_100871423 | 170 |
| 251 | 3300025915 | Ga0207693_10396874 | Ga0207693_103968741 | 170 |
| 252 | 3300025915 | Ga0207693_10895137 | Ga0207693_108951371 | 170 |
| 253 | 3300025917 | Ga0207660_10432847 | Ga0207660_104328471 | 170 |
| 254 | 3300025920 | Ga0207649_10167723 | Ga0207649_101677233 | 170 |
| 255 | 3300025921 | Ga0207652_11365954 | Ga0207652_113659541 | 170 |
| 256 | 3300025924 | Ga0207694_10045602 | Ga0207694_100456022 | 170 |
| 257 | 3300025924 | Ga0207694_10393263 | Ga0207694_103932631 | 170 |
| 258 | 3300025925 | Ga0207650_10275214 | Ga0207650_102752142 | 170 |
| 259 | 3300025927 | Ga0207687_10477164 | Ga0207687_104771642 | 170 |
| 260 | 3300025928 | Ga0207700_10009234 | Ga0207700_100092345 | 170 |
| 261 | 3300025928 | Ga0207700_10754248 | Ga0207700_107542481 | 170 |
| 262 | 3300025929 | Ga0207664_10851947 | Ga0207664_108519471 | 170 |
| 263 | 3300025931 | Ga0207644_10445899 | Ga0207644_104458992 | 170 |
| 264 | 3300025933 | Ga0207706_10646145 | Ga0207706_106461451 | 170 |
| 265 | 3300025937 | Ga0207669_10783651 | Ga0207669_107836511 | 170 |
| 266 | 3300025938 | Ga0207704_10067493 | Ga0207704_100674934 | 170 |
| 267 | 3300025940 | Ga0207691_10183872 | Ga0207691_101838722 | 170 |
| 268 | 3300025941 | Ga0207711_10230505 | Ga0207711_102305054 | 170 |
| 269 | 3300025942 | Ga0207689_10036180 | Ga0207689_100361803 | 170 |
| 270 | 3300025942 | Ga0207689_10168988 | Ga0207689_101689882 | 170 |
| 271 | 3300025945 | Ga0207679_10511856 | Ga0207679_105118562 | 170 |
| 272 | 3300025949 | Ga0207667_10769184 | Ga0207667_107691841 | 170 |
| 273 | 3300025972 | Ga0207668_10175217 | Ga0207668_101752173 | 170 |
| 274 | 3300025986 | Ga0207658_10091936 | Ga0207658_100919362 | 170 |
| 275 | 3300025986 | Ga0207658_11191289 | Ga0207658_111912891 | 170 |
| 276 | 3300026023 | Ga0207677_10334152 | Ga0207677_103341523 | 170 |
| 277 | 3300026035 | Ga0207703_10189493 | Ga0207703_101894932 | 170 |
| 278 | 3300026041 | Ga0207639_10082707 | Ga0207639_100827072 | 170 |
| 279 | 3300026067 | Ga0207678_10037290 | Ga0207678_100372902 | 170 |
| 280 | 3300026078 | Ga0207702_10172071 | Ga0207702_101720713 | 170 |
| 281 | 3300026088 | Ga0207641_10116887 | Ga0207641_101168871 | 170 |
| 282 | 3300026088 | Ga0207641_10642096 | Ga0207641_106420962 | 170 |
| 283 | 3300026095 | Ga0207676_10037254 | Ga0207676_100372543 | 170 |
| 284 | 3300026095 | Ga0207676_11121149 | Ga0207676_111211491 | 170 |
| 285 | 3300026121 | Ga0207683_10046084 | Ga0207683_100460846 | 170 |
| 286 | 3300026121 | Ga0207683_10072440 | Ga0207683_100724401 | 170 |
| 287 | 3300026142 | Ga0207698_10058070 | Ga0207698_100580704 | 170 |
| 288 | 3300028379 | Ga0268266_10095308 | Ga0268266_100953083 | 170 |
| 289 | 3300028379 | Ga0268266_10595924 | Ga0268266_105959241 | 170 |
| 290 | 3300028379 | Ga0268266_11396159 | Ga0268266_113961591 | 170 |
| 291 | 3300028381 | Ga0268264_10345843 | Ga0268264_103458432 | 170 |
| 292 | 3300028786 | Ga0307517_10000175 | Ga0307517_100001755 | 170 |
| 293 | 3300028794 | Ga0307515_10045637 | Ga0307515_100456372 | 170 |
| 294 | 3300028794 | Ga0307515_10079464 | Ga0307515_100794644 | 170 |
| 295 | 3300031456 | Ga0307513_10344352 | Ga0307513_103443522 | 170 |
| 296 | 3300031456 | Ga0307513_10374903 | Ga0307513_103749031 | 170 |
| 297 | 3300031730 | Ga0307516_10447801 | Ga0307516_104478011 | 170 |
| 298 | 3300031730 | Ga0307516_10491528 | Ga0307516_104915281 | 170 |
| 299 | 3300031731 | Ga0307405_10167975 | Ga0307405_101679752 | 170 |
| 300 | 3300031731 | Ga0307405_10191184 | Ga0307405_101911841 | 170 |
| 301 | 3300031901 | Ga0307406_10433196 | Ga0307406_104331961 | 170 |
| 302 | 3300032002 | Ga0307416_100654075 | Ga0307416_1006540752 | 170 |
| 303 | 3300032126 | Ga0307415_100051373 | Ga0307415_1000513732 | 170 |
| 304 | 3300033180 | Ga0307510_10289574 | Ga0307510_102895741 | 170 |
| 305 | 3300034817 | Ga0373948_0049480 | Ga0373948_0049480_103_615 | 170 |
| 306 | 3300035084 | Ga0373928_0188040 | Ga0373928_0188040_38_550 | 170 |
| 307 | 3300035089 | Ga0373944_0067745 | Ga0373944_0067745_601_1113 | 170 |
| 308 | 3300035090 | Ga0373949_0039414 | Ga0373949_0039414_300_812 | 170 |
| 309 | 3300035092 | Ga0373952_0064488 | Ga0373952_0064488_126_638 | 170 |
| 310 | 3300035111 | Ga0373923_0094060 | Ga0373923_0094060_143_721 | 170 |
| 311 | 3300035113 | Ga0373936_0004680 | Ga0373936_0004680_675_1253 | 170 |
| 312 | 3300035120 | Ga0373957_0138937 | Ga0373957_0138937_339_917 | 170 |
| 313 | 3300035170 | Ga0373943_0009067 | Ga0373943_0009067_3564_4076 | 170 |
| 314 | 3300035170 | Ga0373943_0031307 | Ga0373943_0031307_246_824 | 170 |
| 315 | 3300035171 | Ga0373946_0008136 | Ga0373946_0008136_3120_3698 | 170 |
| 316 | 3300035410 | Ga0373924_0026539 | Ga0373924_0026539_34_612 | 170 |
| 317 | 3300035691 | Ga0373931_0028873 | Ga0373931_0028873_962_1474 | 170 |
| 318 | 3300035692 | Ga0373935_0000500 | Ga0373935_0000500_2712_3290 | 170 |
| 319 | 3300035692 | Ga0373935_0320200 | Ga0373935_0320200_259_771 | 170 |
| 320 | 3300035692 | Ga0373935_0706208 | Ga0373935_0706208_101_613 | 170 |
| 321 | 3300035695 | Ga0373927_0000337 | Ga0373927_0000337_22521_23099 | 170 |
| 322 | 3300035695 | Ga0373927_0092084 | Ga0373927_0092084_1366_1878 | 170 |
| 323 | 3300035725 | Ga0373947_0001596 | Ga0373947_0001596_11732_12310 | 170 |
| 324 | 3300035725 | Ga0373947_0081228 | Ga0373947_0081228_758_1270 | 170 |
| 325 | 3300035725 | Ga0373947_0254668 | Ga0373947_0254668_386_898 | 170 |
| 326 | 3300037068 | Ga0373925_0002178 | Ga0373925_0002178_4180_4758 | 170 |
| 327 | 3300037068 | Ga0373925_0028292 | Ga0373925_0028292_2638_3150 | 170 |
| 328 | 3300037068 | Ga0373925_0130610 | Ga0373925_0130610_212_724 | 170 |
| 329 | 3300037068 | Ga0373925_0133301 | Ga0373925_0133301_1153_1665 | 170 |
| 330 | 3300037418 | Ga0395900_0005446 | Ga0395900_0005446_3384_3896 | 170 |
| 331 | 3300037466 | Ga0395898_0027897 | Ga0395898_0027897_3056_3568 | 170 |
| 332 | 3300037471 | Ga0395905_0155779 | Ga0395905_0155779_827_1339 | 170 |
| 333 | 3300037853 | Ga0436364_0842905 | Ga0436364_0842905_799_1311 | 170 |
| 334 | 3300037853 | Ga0436364_1290935 | Ga0436364_1290935_150_662 | 170 |
| 335 | 3300038443 | Ga0395901_0243888 | Ga0395901_0243888_1007_1519 | 170 |
| 336 | 3300039437 | Ga0436365_0005537 | Ga0436365_0005537_3243_3755 | 170 |
| 337 | 3300039438 | Ga0436360_0581218 | Ga0436360_0581218_12_524 | 170 |
| 338 | 3300041452 | Ga0451793_1242619 | Ga0451793_1242619_142_654 | 170 |
| 339 | 3300041512 | Ga0451853_3130839 | Ga0451853_3130839_207_719 | 170 |
| 340 | 3300046455 | Ga0495603_0002718 | Ga0495603_0002718_5892_6470 | 170 |
| 341 | 3300046457 | Ga0495590_0167088 | Ga0495590_0167088_134_646 | 170 |
| 342 | 3300046459 | Ga0495629_0000727 | Ga0495629_0000727_4362_4940 | 170 |
| 343 | 3300046459 | Ga0495629_0543880 | Ga0495629_0543880_179_691 | 170 |
| 344 | 3300046459 | Ga0495629_0739630 | Ga0495629_0739630_116_628 | 170 |
| 345 | 3300046460 | Ga0495638_0322226 | Ga0495638_0322226_41_553 | 170 |
| 346 | 3300046461 | Ga0495641_0004166 | Ga0495641_0004166_5571_6149 | 170 |
| 347 | 3300046472 | Ga0495580_0000246 | Ga0495580_0000246_5541_6119 | 170 |
| 348 | 3300046473 | Ga0495582_0000494 | Ga0495582_0000494_14018_14596 | 170 |
| 349 | 3300046473 | Ga0495582_0077162 | Ga0495582_0077162_1199_1711 | 170 |
| 350 | 3300046474 | Ga0495605_0217053 | Ga0495605_0217053_227_739 | 170 |
| 351 | 3300046475 | Ga0495639_0000119 | Ga0495639_0000119_17334_17912 | 170 |
| 352 | 3300046475 | Ga0495639_0319549 | Ga0495639_0319549_46_597 | 170 |
| 353 | 3300046476 | Ga0495662_0001142 | Ga0495662_0001142_1332_1910 | 170 |
| 354 | 3300046477 | Ga0495664_0025257 | Ga0495664_0025257_946_1524 | 170 |
| 355 | 3300046499 | Ga0495594_0004003 | Ga0495594_0004003_4986_5564 | 170 |
| 356 | 3300046516 | Ga0495628_0017937 | Ga0495628_0017937_1458_2036 | 170 |
| 357 | 3300046517 | Ga0495630_0523216 | Ga0495630_0523216_130_708 | 170 |
| 358 | 3300046517 | Ga0495630_0674105 | Ga0495630_0674105_197_709 | 170 |
| 359 | 3300046519 | Ga0495632_0198769 | Ga0495632_0198769_218_730 | 170 |
| 360 | 3300046526 | Ga0495666_0012738 | Ga0495666_0012738_2773_3351 | 170 |
| 361 | 3300046529 | Ga0495652_0032064 | Ga0495652_0032064_3317_3895 | 170 |
| 362 | 3300046531 | Ga0495665_0000251 | Ga0495665_0000251_4364_4942 | 170 |
| 363 | 3300046533 | Ga0495640_0014321 | Ga0495640_0014321_487_1065 | 170 |
| 364 | 3300046542 | Ga0495597_0278889 | Ga0495597_0278889_13_525 | 170 |
| 365 | 3300046557 | Ga0495622_0032065 | Ga0495622_0032065_931_1509 | 170 |
| 366 | 3300046559 | Ga0495667_0218418 | Ga0495667_0218418_69_647 | 170 |
| 367 | 3300046615 | Ga0495656_0465270 | Ga0495656_0465270_39_551 | 170 |
| 368 | 3300046642 | Ga0495634_0000886 | Ga0495634_0000886_12870_13448 | 170 |
| 369 | 3300046663 | Ga0495635_0001208 | Ga0495635_0001208_12499_13077 | 170 |
| 370 | 3300046674 | Ga0495588_0037029 | Ga0495588_0037029_1146_1724 | 170 |
| 371 | 3300046674 | Ga0495588_0108811 | Ga0495588_0108811_800_1312 | 170 |
| 372 | 3300046675 | Ga0495657_0198144 | Ga0495657_0198144_517_1095 | 170 |
| 373 | 3300046678 | Ga0495599_0211033 | Ga0495599_0211033_72_650 | 170 |
| 374 | 3300046680 | Ga0495646_0003823 | Ga0495646_0003823_7567_8145 | 170 |
| 375 | 3300046681 | Ga0495647_0000085 | Ga0495647_0000085_5256_5834 | 170 |
| 376 | 3300046683 | Ga0495658_0000135 | Ga0495658_0000135_18527_19105 | 170 |
| 377 | 3300046690 | Ga0495624_0000144 | Ga0495624_0000144_30220_30798 | 170 |
| 378 | 3300046690 | Ga0495624_0119526 | Ga0495624_0119526_480_992 | 170 |
| 379 | 3300046809 | Ga0495600_0238847 | Ga0495600_0238847_121_699 | 170 |
| 380 | 3300047315 | Ga0495581_0000421 | Ga0495581_0000421_13891_14469 | 170 |
| 381 | 3300047315 | Ga0495581_0427317 | Ga0495581_0427317_83_595 | 170 |
| 382 | 3300047317 | Ga0495604_0247268 | Ga0495604_0247268_536_1114 | 170 |
| 383 | 3300047319 | Ga0495674_0001274 | Ga0495674_0001274_21864_22442 | 170 |
| 384 | 3300047321 | Ga0495676_0007487 | Ga0495676_0007487_837_1415 | 170 |
| 385 | 3300047321 | Ga0495676_0207212 | Ga0495676_0207212_211_723 | 170 |
| 386 | 3300047322 | Ga0495680_0202615 | Ga0495680_0202615_564_1142 | 170 |
| 387 | 3300047471 | Ga0495684_0134276 | Ga0495684_0134276_200_778 | 170 |
| 388 | 3300047673 | Ga0495593_0000007 | Ga0495593_0000007_21008_21586 | 170 |
| 389 | 3300048089 | Ga0495614_0007215 | Ga0495614_0007215_2636_3214 | 170 |
| 390 | 3300048903 | Ga0496100_0114824 | Ga0496100_0114824_1318_1830 | 170 |
| 391 | 3300048904 | Ga0496101_0002295 | Ga0496101_0002295_10667_11179 | 170 |
| 392 | 3300048905 | Ga0496102_0003496 | Ga0496102_0003496_3647_4159 | 170 |
| 393 | 3300048905 | Ga0496102_0051167 | Ga0496102_0051167_1956_2468 | 170 |
| 394 | 3300048906 | Ga0496103_0005524 | Ga0496103_0005524_6508_7020 | 170 |
| 395 | 3300048907 | Ga0496104_0179338 | Ga0496104_0179338_1327_1839 | 170 |
| 396 | 3300048908 | Ga0496105_0012456 | Ga0496105_0012456_5355_5867 | 170 |
| 397 | 3300048908 | Ga0496105_0040580 | Ga0496105_0040580_3302_3814 | 170 |
| 398 | 3300048908 | Ga0496105_0094038 | Ga0496105_0094038_28_540 | 170 |
| 399 | 3300048909 | Ga0496106_0004144 | Ga0496106_0004144_2105_2629 | 170 |
| 400 | 3300048909 | Ga0496106_0076702 | Ga0496106_0076702_1050_1562 | 170 |
| 401 | 3300048909 | Ga0496106_1038362 | Ga0496106_1038362_37_564 | 170 |
| 402 | 3300048910 | Ga0496107_0007336 | Ga0496107_0007336_6926_7438 | 170 |
| 403 | 3300048910 | Ga0496107_0200679 | Ga0496107_0200679_842_1354 | 170 |
| 404 | 3300048911 | Ga0496108_0009442 | Ga0496108_0009442_493_1005 | 170 |
| 405 | 3300048911 | Ga0496108_0012940 | Ga0496108_0012940_1899_2423 | 170 |
| 406 | 3300048912 | Ga0496109_0003252 | Ga0496109_0003252_10142_10666 | 170 |
| 407 | 3300048912 | Ga0496109_0033178 | Ga0496109_0033178_217_729 | 170 |
| 408 | 3300048912 | Ga0496109_0118817 | Ga0496109_0118817_115_627 | 170 |
| 409 | 3300048913 | Ga0496110_0007869 | Ga0496110_0007869_3136_3660 | 170 |
| 410 | 3300048913 | Ga0496110_0011070 | Ga0496110_0011070_1664_2176 | 170 |
| 411 | 3300048913 | Ga0496110_0067035 | Ga0496110_0067035_513_1025 | 170 |
| 412 | 3300048914 | Ga0496111_0072677 | Ga0496111_0072677_1937_2449 | 170 |
| 413 | 3300048914 | Ga0496111_0094051 | Ga0496111_0094051_806_1330 | 170 |
| 414 | 3300048914 | Ga0496111_0114599 | Ga0496111_0114599_1039_1551 | 170 |
| 415 | 3300048915 | Ga0496112_0003481 | Ga0496112_0003481_3125_3649 | 170 |
| 416 | 3300048915 | Ga0496112_0014567 | Ga0496112_0014567_2140_2652 | 170 |
| 417 | 3300048916 | Ga0496113_0010612 | Ga0496113_0010612_1294_1806 | 170 |
| 418 | 3300048916 | Ga0496113_0013241 | Ga0496113_0013241_182_706 | 170 |
| 419 | 3300048916 | Ga0496113_0045387 | Ga0496113_0045387_1335_1847 | 170 |
| 420 | 3300048917 | Ga0496114_0281834 | Ga0496114_0281834_547_1059 | 170 |
| 421 | 3300048918 | Ga0496115_0067108 | Ga0496115_0067108_1319_1831 | 170 |
| 422 | 3300048918 | Ga0496115_0171375 | Ga0496115_0171375_327_851 | 170 |
| 423 | 3300048918 | Ga0496115_0279350 | Ga0496115_0279350_478_990 | 170 |
| 424 | 3300048918 | Ga0496115_0940651 | Ga0496115_0940651_37_549 | 170 |
| 425 | 3300048924 | Ga0496121_0152242 | Ga0496121_0152242_1116_1628 | 170 |
| 426 | 3300048927 | Ga0496124_0182051 | Ga0496124_0182051_743_1255 | 170 |
| 427 | 3300048928 | Ga0496125_0615532 | Ga0496125_0615532_10_537 | 170 |
| 428 | 3300048929 | Ga0496126_0410754 | Ga0496126_0410754_156_887 | 170 |
| 429 | 3300050490 | nmdc:mga03n38_270632_c1 | nmdc:mga03n38_270632_c1_85_597 | 170 |
| 430 | 3300050492 | nmdc:mga0yw44_163726_c1 | nmdc:mga0yw44_163726_c1_56_568 | 170 |
| 431 | 3300050494 | nmdc:mga06z11_504044_c1 | nmdc:mga06z11_504044_c1_191_703 | 170 |
| 432 | 3300053077 | Ga0495601_0111850 | Ga0495601_0111850_1206_1718 | 170 |
| 433 | 3300053077 | Ga0495601_0181981 | Ga0495601_0181981_123_635 | 170 |
| 434 | 3300053083 | Ga0495655_0037605 | Ga0495655_0037605_477_989 | 170 |
| 435 | 3300053085 | Ga0495619_0275360 | Ga0495619_0275360_602_1114 | 170 |
| 436 | 3300053094 | Ga0500566_0008515 | Ga0500566_0008515_246_773 | 170 |
| 437 | 3300053119 | Ga0500595_024041 | Ga0500595_024041_1517_2044 | 170 |
| 438 | 3300053122 | Ga0500608_008620 | Ga0500608_008620_2512_3024 | 170 |
| 439 | 3300053136 | Ga0500559_0000244 | Ga0500559_0000244_38132_38656 | 170 |
| 440 | 3300053150 | Ga0500603_036500 | Ga0500603_036500_140_667 | 170 |
| 441 | 3300053162 | Ga0500638_005746 | Ga0500638_005746_764_1291 | 170 |
| 442 | 3300053163 | Ga0500639_010041 | Ga0500639_010041_3755_4279 | 170 |
| 443 | 3300053177 | Ga0500636_0182396 | Ga0500636_0182396_493_1017 | 170 |
| 444 | 3300055283 | Ga0500661_001701 | Ga0500661_001701_2564_3091 | 170 |
| 445 | 3300003659 | JGI25404J52841_10006540 | JGI25404J52841_100065402 | 171 |
| 446 | 3300005329 | Ga0070683_100117757 | Ga0070683_1001177573 | 171 |
| 447 | 3300005435 | Ga0070714_100985552 | Ga0070714_1009855521 | 171 |
| 448 | 3300005436 | Ga0070713_101011778 | Ga0070713_1010117782 | 171 |
| 449 | 3300005439 | Ga0070711_100087568 | Ga0070711_1000875681 | 171 |
| 450 | 3300005458 | Ga0070681_10059978 | Ga0070681_100599782 | 171 |
| 451 | 3300005458 | Ga0070681_10110277 | Ga0070681_101102772 | 171 |
| 452 | 3300005530 | Ga0070679_100237787 | Ga0070679_1002377872 | 171 |
| 453 | 3300005535 | Ga0070684_100026464 | Ga0070684_1000264642 | 171 |
| 454 | 3300005577 | Ga0068857_100015885 | Ga0068857_1000158854 | 171 |
| 455 | 3300005577 | Ga0068857_100620809 | Ga0068857_1006208092 | 171 |
| 456 | 3300005616 | Ga0068852_100298753 | Ga0068852_1002987531 | 171 |
| 457 | 3300005937 | Ga0081455_10036290 | Ga0081455_100362904 | 171 |
| 458 | 3300005983 | Ga0081540_1006380 | Ga0081540_10063804 | 171 |
| 459 | 3300006173 | Ga0070716_100427153 | Ga0070716_1004271532 | 171 |
| 460 | 3300009093 | Ga0105240_10271507 | Ga0105240_102715073 | 171 |
| 461 | 3300009174 | Ga0105241_10938026 | Ga0105241_109380261 | 171 |
| 462 | 3300010375 | Ga0105239_10871800 | Ga0105239_108718002 | 171 |
| 463 | 3300010375 | Ga0105239_11653313 | Ga0105239_116533131 | 171 |
| 464 | 3300013104 | Ga0157370_10847209 | Ga0157370_108472091 | 171 |
| 465 | 3300013105 | Ga0157369_10767653 | Ga0157369_107676532 | 171 |
| 466 | 3300014497 | Ga0182008_10137409 | Ga0182008_101374092 | 171 |
| 467 | 3300021320 | Ga0214544_1000016 | Ga0214544_1000016120 | 171 |
| 468 | 3300021321 | Ga0214542_1000016 | Ga0214542_100001682 | 171 |
| 469 | 3300021324 | Ga0214545_1000008 | Ga0214545_100000888 | 171 |
| 470 | 3300021327 | Ga0214543_1000043 | Ga0214543_100004338 | 171 |
| 471 | 3300021384 | Ga0213876_10133952 | Ga0213876_101339522 | 171 |
| 472 | 3300025906 | Ga0207699_10673462 | Ga0207699_106734621 | 171 |
| 473 | 3300025912 | Ga0207707_10001318 | Ga0207707_1000131821 | 171 |
| 474 | 3300025913 | Ga0207695_10502936 | Ga0207695_105029362 | 171 |
| 475 | 3300025916 | Ga0207663_10170237 | Ga0207663_101702371 | 171 |
| 476 | 3300025917 | Ga0207660_10026100 | Ga0207660_100261003 | 171 |
| 477 | 3300025921 | Ga0207652_10199492 | Ga0207652_101994922 | 171 |
| 478 | 3300025929 | Ga0207664_10367938 | Ga0207664_103679381 | 171 |
| 479 | 3300025929 | Ga0207664_10628266 | Ga0207664_106282662 | 171 |
| 480 | 3300025944 | Ga0207661_10007310 | Ga0207661_100073104 | 171 |
| 481 | 3300026116 | Ga0207674_10047136 | Ga0207674_100471364 | 171 |
| 482 | 3300031616 | Ga0307508_10218291 | Ga0307508_102182912 | 171 |
| 483 | 3300035086 | Ga0373934_0167492 | Ga0373934_0167492_98_613 | 171 |
| 484 | 3300035111 | Ga0373923_0015288 | Ga0373923_0015288_1925_2440 | 171 |
| 485 | 3300035113 | Ga0373936_0122131 | Ga0373936_0122131_301_816 | 171 |
| 486 | 3300035116 | Ga0373945_0343015 | Ga0373945_0343015_20_535 | 171 |
| 487 | 3300035172 | Ga0373955_0198651 | Ga0373955_0198651_173_688 | 171 |
| 488 | 3300035692 | Ga0373935_0022952 | Ga0373935_0022952_3282_3797 | 171 |
| 489 | 3300035724 | Ga0373933_0203226 | Ga0373933_0203226_302_817 | 171 |
| 490 | 3300035725 | Ga0373947_0107828 | Ga0373947_0107828_1144_1659 | 171 |
| 491 | 3300039437 | Ga0436365_0719884 | Ga0436365_0719884_575_1099 | 171 |
| 492 | 3300039447 | Ga0436361_0406703 | Ga0436361_0406703_53_568 | 171 |
| 493 | 3300044656 | Ga0466969_0101819 | Ga0466969_0101819_791_1306 | 171 |
| 494 | 3300044658 | Ga0466972_0000107 | Ga0466972_0000107_33220_33735 | 171 |
| 495 | 3300044658 | Ga0466972_0037535 | Ga0466972_0037535_1703_2218 | 171 |
| 496 | 3300044683 | Ga0466965_0069700 | Ga0466965_0069700_711_1226 | 171 |
| 497 | 3300044684 | Ga0466966_0356384 | Ga0466966_0356384_154_669 | 171 |
| 498 | 3300044693 | Ga0466961_0197223 | Ga0466961_0197223_508_1023 | 171 |
| 499 | 3300044719 | Ga0466971_0114410 | Ga0466971_0114410_36_551 | 171 |
| 500 | 3300044735 | Ga0466968_0048898 | Ga0466968_0048898_1030_1545 | 171 |
| 501 | 3300044735 | Ga0466968_0139117 | Ga0466968_0139117_309_824 | 171 |
| 502 | 3300044735 | Ga0466968_0276529 | Ga0466968_0276529_180_695 | 171 |
| 503 | 3300044765 | Ga0466970_0032219 | Ga0466970_0032219_166_681 | 171 |
| 504 | 3300044842 | Ga0466957_0056717 | Ga0466957_0056717_473_988 | 171 |
| 505 | 3300044901 | Ga0466960_0012111 | Ga0466960_0012111_2732_3247 | 171 |
| 506 | 3300045049 | Ga0466959_0067109 | Ga0466959_0067109_1736_2251 | 171 |
| 507 | 3300045976 | Ga0466967_0030343 | Ga0466967_0030343_3883_4398 | 171 |
| 508 | 3300046459 | Ga0495629_0051911 | Ga0495629_0051911_113_628 | 171 |
| 509 | 3300046472 | Ga0495580_0012045 | Ga0495580_0012045_457_972 | 171 |
| 510 | 3300046473 | Ga0495582_0028272 | Ga0495582_0028272_2194_2709 | 171 |
| 511 | 3300046475 | Ga0495639_0006327 | Ga0495639_0006327_69_584 | 171 |
| 512 | 3300046476 | Ga0495662_0144246 | Ga0495662_0144246_119_634 | 171 |
| 513 | 3300046477 | Ga0495664_0049070 | Ga0495664_0049070_578_1093 | 171 |
| 514 | 3300046477 | Ga0495664_0106632 | Ga0495664_0106632_464_979 | 171 |
| 515 | 3300046514 | Ga0495618_0083133 | Ga0495618_0083133_1282_1797 | 171 |
| 516 | 3300046517 | Ga0495630_0111067 | Ga0495630_0111067_198_713 | 171 |
| 517 | 3300046526 | Ga0495666_0053467 | Ga0495666_0053467_960_1475 | 171 |
| 518 | 3300046531 | Ga0495665_0029705 | Ga0495665_0029705_87_602 | 171 |
| 519 | 3300046533 | Ga0495640_0205294 | Ga0495640_0205294_82_597 | 171 |
| 520 | 3300046535 | Ga0495586_0127261 | Ga0495586_0127261_570_1085 | 171 |
| 521 | 3300046543 | Ga0495645_0007915 | Ga0495645_0007915_749_1264 | 171 |
| 522 | 3300046559 | Ga0495667_0013822 | Ga0495667_0013822_219_734 | 171 |
| 523 | 3300046642 | Ga0495634_0088946 | Ga0495634_0088946_397_912 | 171 |
| 524 | 3300046678 | Ga0495599_0236690 | Ga0495599_0236690_131_646 | 171 |
| 525 | 3300046681 | Ga0495647_0058975 | Ga0495647_0058975_829_1344 | 171 |
| 526 | 3300046689 | Ga0495613_0529770 | Ga0495613_0529770_109_624 | 171 |
| 527 | 3300047317 | Ga0495604_0110337 | Ga0495604_0110337_662_1177 | 171 |
| 528 | 3300047319 | Ga0495674_0483917 | Ga0495674_0483917_179_694 | 171 |
| 529 | 3300048905 | Ga0496102_0922133 | Ga0496102_0922133_12_527 | 171 |
| 530 | 3300048917 | Ga0496114_0184123 | Ga0496114_0184123_807_1562 | 171 |
| 531 | 3300048924 | Ga0496121_0410993 | Ga0496121_0410993_87_602 | 171 |
| 532 | 3300048929 | Ga0496126_0064106 | Ga0496126_0064106_259_780 | 171 |
| 533 | 3300050490 | nmdc:mga03n38_89108_c1 | nmdc:mga03n38_89108_c1_274_789 | 171 |
| 534 | 3300053077 | Ga0495601_0225372 | Ga0495601_0225372_282_797 | 171 |
| 535 | 3300053078 | Ga0495612_0028993 | Ga0495612_0028993_1544_2059 | 171 |
| 536 | 3300053085 | Ga0495619_0603168 | Ga0495619_0603168_152_667 | 171 |
| 537 | 3300061719 | Ga0466962_0120391 | Ga0466962_0120391_467_982 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2mtz-assembly1.cif.gz_A | haddock model of bacillus subtilis l,d-transpeptidase in complex with a peptidoglycan hexamuropeptide | 0.874 | 41 | 168 |
| 4lzh-assembly1.cif.gz_A | l,d-transpeptidase from klebsiella pneumoniae | 0.8643 | 36 | 169 |
| 4a1i-assembly1.cif.gz_A | ykud from b.subtilis | 0.848 | 34 | 171 |
| 2hkl-assembly3.cif.gz_C | crystal structure of enterococcus faecium l,d-transpeptidase c442s mutant | 0.8171 | 38 | 170 |
| 6fj1-assembly2.cif.gz_B | structure of the ldtfm-avibactam carbamoyl enzyme | 0.8168 | 37 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4a1iC02 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.9261 | 41 | 171 | 2.40.440.10 |
| af_P75954_98_241_2.40.440.10 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8716 | 37 | 170 | 2.40.440.10 |
| 4a1iC02 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8504 | 41 | 171 | 2.40.440.10 |
| 5uwvD03 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.815 | 41 | 171 | 2.40.440.10 |
| af_P75954_98_241_2.40.440.10 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.809 | 37 | 170 | 2.40.440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849TQI1-F1-model_v4 | L,D-transpeptidase | 0.9624 | 42 | 170 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A7L5Y2S1-F1-model_v4 | L,D-transpeptidase | 0.9594 | 44 | 171 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A1Q3K6S1-F1-model_v4 | L,D-TPase catalytic domain-containing protein | 0.9592 | 27 | 170 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A7G6U4F9-F1-model_v4 | L,D-transpeptidase | 0.9571 | 30 | 170 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A537RM67-F1-model_v4 | L,D-transpeptidase | 0.9567 | 27 | 170 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar