F460905

General Info

Members Datasets Scaffolds Average Seq Length
537 340 488 172

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10938026|Ga0105241_109380261
Length 202
Sequence MRGPAAPSASLSELPPWIETVRAAGEVEKRSMSKRIVAAFAVTVAAALPATDAAQARPEMVPVRSAEYSPGTIVVRTGERHLYLILDSGHAMRYPVGVGKAGKQWAGVTRIEGKYQNPAWSPPSEVKRDKPSIPDMIPGGSPRNPMGVAAMTLAGGEYAIHGTNVPGSVGGFVSYGCIRMLNADITDLYGRVGVGTTVVVTR

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
11 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
12 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
13 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
14 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
15 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
16 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
17 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
18 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
19 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
20 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
21 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
22 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
23 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
24 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
25 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
26 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
27 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
28 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
29 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
30 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
31 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
32 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
33 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
34 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
35 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
36 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
37 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
38 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
39 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
40 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
121 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
122 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
123 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
322 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
323 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
324 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
325 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
326 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
327 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
328 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
329 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
330 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
331 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
332 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
335 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
336 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
337 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
338 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
339 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
340 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.64
Metatranscriptomes 0.75
Isolates 8.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 6.15
Rhizoplane 11.55
Rhizosphere 67.6
Stem 0
Stem Tuber 0
Unclassified 8.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10006540 3300003659 Bacteria 2444
2 Ga0058862_12548500 3300004803 Bacteria 759
3 Ga0070683_100117757 3300005329 Bacteria 2508
4 Ga0070670_100272627 3300005331 Bacteria 1477
5 Ga0068868_100054743 3300005338 Bacteria 3145
6 Ga0070691_10213807 3300005341 Bacteria 1018
7 Ga0070671_100289945 3300005355 Bacteria 1393
8 Ga0070674_100056596 3300005356 Bacteria 2720
9 Ga0070673_100496749 3300005364 Bacteria 1103
10 Ga0070688_100397101 3300005365 Bacteria 1020
11 Ga0070714_100985552 3300005435 Bacteria 820
12 Ga0070713_100126962 3300005436 Bacteria 2245
13 Ga0070713_100863065 3300005436 Bacteria 869
14 Ga0070713_101011778 3300005436 Bacteria 802
15 Ga0070711_100087568 3300005439 Bacteria 2236
16 Ga0070663_100022584 3300005455 Bacteria 4208
17 Ga0070678_100061795 3300005456 Bacteria 2762
18 Ga0070681_10059978 3300005458 Bacteria 3783
19 Ga0070681_10110277 3300005458 Bacteria 2691
20 Ga0070685_10472771 3300005466 Bacteria 882
21 Ga0070679_100237787 3300005530 Bacteria 1780
22 Ga0070684_100026464 3300005535 Bacteria 4888
23 Ga0070684_100046817 3300005535 Bacteria 3748
24 Ga0070684_100433992 3300005535 Bacteria 1213
25 Ga0070697_100009632 3300005536 Bacteria 7546
26 Ga0070665_100298515 3300005548 Bacteria 1613
27 Ga0070665_100735143 3300005548 Bacteria 1000
28 Ga0070665_101008173 3300005548 Bacteria 845
29 Ga0068855_100688531 3300005563 Bacteria 1095
30 Ga0070664_100053295 3300005564 Bacteria 3428
31 Ga0068857_100015885 3300005577 Bacteria 6590
32 Ga0068857_100620809 3300005577 Bacteria 1023
33 Ga0068852_100298753 3300005616 Bacteria 1558
34 Ga0068864_100049859 3300005618 Bacteria 3602
35 Ga0068864_100381847 3300005618 Bacteria 1335
36 Ga0068866_10057490 3300005718 Bacteria 2005
37 Ga0068858_100391621 3300005842 Bacteria 1334
38 Ga0068858_100451568 3300005842 Bacteria 1239
39 Ga0081455_10036290 3300005937 Bacteria 4391
40 Ga0081455_10072677 3300005937 Bacteria 2847
41 Ga0081538_10109783 3300005981 Bacteria 1358
42 Ga0081540_1005846 3300005983 Bacteria 9098
43 Ga0081540_1006380 3300005983 Bacteria 8601
44 Ga0081540_1085626 3300005983 Bacteria 1403
45 Ga0070717_10019833 3300006028 Bacteria 5279
46 Ga0075368_10119775 3300006042 Bacteria 1089
47 Ga0075368_10151203 3300006042 Bacteria 970
48 Ga0075368_10205443 3300006042 Bacteria 834
49 Ga0075363_100262362 3300006048 Bacteria 997
50 Ga0075364_10186728 3300006051 Bacteria 1404
51 Ga0070716_100427153 3300006173 Bacteria 960
52 Ga0070712_100444132 3300006175 Bacteria 1079
53 Ga0075362_10060148 3300006177 Bacteria 1717
54 Ga0075367_10155653 3300006178 Bacteria 1420
55 Ga0075367_10165113 3300006178 Unclassified 1378
56 Ga0075369_10238599 3300006186 Bacteria 843
57 Ga0075366_10029827 3300006195 Bacteria 3205
58 Ga0097621_100447086 3300006237 Bacteria 1164
59 Ga0075370_10151650 3300006353 Bacteria 1358
60 Ga0075370_10221759 3300006353 Bacteria 1118
61 Ga0068871_100420181 3300006358 Bacteria 1194
62 Ga0075428_100329369 3300006844 Bacteria 1640
63 Ga0075431_100996279 3300006847 Bacteria 805
64 Ga0075433_10783824 3300006852 Bacteria 833
65 Ga0075434_100072244 3300006871 Bacteria 3443
66 Ga0068865_100040260 3300006881 Bacteria 3174
67 Ga0068865_100749460 3300006881 Bacteria 839
68 Ga0099794_10033882 3300007265 Bacteria 2403
69 Ga0105240_10004777 3300009093 Bacteria 20435
70 Ga0105240_10117059 3300009093 Bacteria 3214
71 Ga0105240_10271507 3300009093 Bacteria 1952
72 Ga0111539_10061817 3300009094 Bacteria 4436
73 Ga0105245_10007604 3300009098 Bacteria 9488
74 Ga0105245_12298231 3300009098 Bacteria 593
75 Ga0105247_10234261 3300009101 Bacteria 1248
76 Ga0105247_10396629 3300009101 Bacteria 982
77 Ga0114129_10040520 3300009147 Bacteria 6566
78 Ga0114129_10566230 3300009147 Bacteria 1476
79 Ga0105243_10291740 3300009148 Bacteria 1474
80 Ga0105243_11150138 3300009148 Bacteria 787
81 Ga0105241_10938026 3300009174 Bacteria 806
82 Ga0105248_10221213 3300009177 Bacteria 2131
83 Ga0105237_10016029 3300009545 Bacteria 7794
84 Ga0105237_10070886 3300009545 Bacteria 3481
85 Ga0105237_10434858 3300009545 Bacteria 1318
86 Ga0105237_10643937 3300009545 Bacteria 1067
87 Ga0105238_10037927 3300009551 Bacteria 4897
88 Ga0105238_10587329 3300009551 Bacteria 1121
89 Ga0105249_10199315 3300009553 Bacteria 1958
90 Ga0105239_10016959 3300010375 Bacteria 8050
91 Ga0105239_10132102 3300010375 Bacteria 2778
92 Ga0105239_10871800 3300010375 Bacteria 1033
93 Ga0105239_11653313 3300010375 Bacteria 741
94 Ga0105246_10009574 3300011119 Bacteria 5970
95 Ga0105246_10401546 3300011119 Bacteria 1138
96 Ga0157370_10847209 3300013104 Bacteria 831
97 Ga0157369_10005521 3300013105 Bacteria 14687
98 Ga0157369_10014138 3300013105 Bacteria 9020
99 Ga0157369_10767653 3300013105 Bacteria 991
100 Ga0157374_10012776 3300013296 Bacteria 7315
101 Ga0157378_10127170 3300013297 Bacteria 2355
102 Ga0157378_10421480 3300013297 Bacteria 1319
103 Ga0163162_10180203 3300013306 Bacteria 2239
104 Ga0163162_10909708 3300013306 Bacteria 993
105 Ga0157372_10154991 3300013307 Bacteria 2646
106 Ga0157375_10046704 3300013308 Bacteria 4224
107 Ga0157375_10225589 3300013308 Bacteria 2033
108 Ga0163163_10046231 3300014325 Bacteria 4276
109 Ga0163163_10116449 3300014325 Bacteria 2704
110 Ga0163163_10438918 3300014325 Bacteria 1365
111 Ga0157380_10177981 3300014326 Bacteria 1866
112 Ga0182008_10137409 3300014497 Bacteria 1221
113 Ga0157377_10174220 3300014745 Bacteria 1348
114 Ga0157377_10442590 3300014745 Bacteria 895
115 Ga0157379_10129317 3300014968 Bacteria 2272
116 Ga0157379_10860016 3300014968 Bacteria 858
117 Ga0157376_10086000 3300014969 Bacteria 2710
118 Ga0163161_10250534 3300017792 Bacteria 1380
119 Ga0163161_10279951 3300017792 Bacteria 1308
120 Ga0206356_10358370 3300020070 Bacteria 1945
121 Ga0206350_10285734 3300020080 Bacteria 1568
122 Ga0206353_10072688 3300020082 Bacteria 1138
123 Ga0214544_1000016 3300021320 Bacteria 204278
124 Ga0214542_1000016 3300021321 Bacteria 210332
125 Ga0214545_1000008 3300021324 Bacteria 215190
126 Ga0214543_1000043 3300021327 Bacteria 160517
127 Ga0213876_10133952 3300021384 Bacteria 1318
128 Ga0213876_10145727 3300021384 Bacteria 1259
129 Ga0213875_10213735 3300021388 Bacteria 908
130 Ga0209233_1007665 3300025261 Bacteria 3400
131 Ga0207656_10189801 3300025321 Bacteria 989
132 Ga0207642_10394644 3300025899 Bacteria 826
133 Ga0207647_10084686 3300025904 Bacteria 1897
134 Ga0207699_10673462 3300025906 Bacteria 756
135 Ga0207707_10001318 3300025912 Bacteria 23068
136 Ga0207695_10086938 3300025913 Bacteria 3151
137 Ga0207695_10502936 3300025913 Bacteria 1094
138 Ga0207671_10017495 3300025914 Bacteria 5524
139 Ga0207671_10049535 3300025914 Bacteria 3110
140 Ga0207693_10087142 3300025915 Bacteria 2446
141 Ga0207693_10268901 3300025915 Bacteria 1336
142 Ga0207693_10396874 3300025915 Bacteria 1078
143 Ga0207693_10439698 3300025915 Bacteria 1019
144 Ga0207693_10895137 3300025915 Bacteria 681
145 Ga0207663_10170237 3300025916 Bacteria 1546
146 Ga0207660_10026100 3300025917 Bacteria 3975
147 Ga0207660_10432847 3300025917 Bacteria 1062
148 Ga0207649_10167723 3300025920 Bacteria 1527
149 Ga0207652_10199492 3300025921 Bacteria 1801
150 Ga0207652_11365954 3300025921 Bacteria 612
151 Ga0207694_10045602 3300025924 Bacteria 3386
152 Ga0207694_10393263 3300025924 Bacteria 1152
153 Ga0207650_10021414 3300025925 Bacteria 4569
154 Ga0207650_10275214 3300025925 Bacteria 1369
155 Ga0207687_10477164 3300025927 Bacteria 1038
156 Ga0207700_10009234 3300025928 Bacteria 6151
157 Ga0207700_10754248 3300025928 Bacteria 870
158 Ga0207664_10367938 3300025929 Bacteria 1275
159 Ga0207664_10628266 3300025929 Bacteria 965
160 Ga0207664_10851947 3300025929 Bacteria 819
161 Ga0207644_10445899 3300025931 Bacteria 1063
162 Ga0207706_10646145 3300025933 Bacteria 906
163 Ga0207669_10783651 3300025937 Bacteria 789
164 Ga0207704_10067493 3300025938 Bacteria 2250
165 Ga0207691_10183872 3300025940 Bacteria 1825
166 Ga0207711_10230505 3300025941 Bacteria 1696
167 Ga0207689_10036180 3300025942 Bacteria 4099
168 Ga0207689_10168988 3300025942 Bacteria 1802
169 Ga0207661_10007310 3300025944 Bacteria 7855
170 Ga0207679_10284619 3300025945 Bacteria 1419
171 Ga0207679_10511856 3300025945 Bacteria 1072
172 Ga0207667_10769184 3300025949 Bacteria 961
173 Ga0207651_11036537 3300025960 Bacteria 734
174 Ga0207668_10175217 3300025972 Bacteria 1686
175 Ga0207658_10091936 3300025986 Bacteria 2356
176 Ga0207658_11191289 3300025986 Bacteria 696
177 Ga0207677_10334152 3300026023 Bacteria 1264
178 Ga0207703_10189493 3300026035 Bacteria 1820
179 Ga0207639_10082707 3300026041 Bacteria 2546
180 Ga0207678_10037290 3300026067 Bacteria 4228
181 Ga0207702_10172071 3300026078 Bacteria 1987
182 Ga0207641_10116887 3300026088 Bacteria 2374
183 Ga0207641_10642096 3300026088 Bacteria 1042
184 Ga0207676_10037254 3300026095 Bacteria 3705
185 Ga0207676_10608791 3300026095 Bacteria 1050
186 Ga0207676_11121149 3300026095 Bacteria 778
187 Ga0207674_10047136 3300026116 Bacteria 4420
188 Ga0207683_10046084 3300026121 Bacteria 3814
189 Ga0207683_10072440 3300026121 Bacteria 3047
190 Ga0207683_10631589 3300026121 Bacteria 992
191 Ga0207698_10058070 3300026142 Bacteria 2996
192 Ga0268266_10095308 3300028379 Bacteria 2614
193 Ga0268266_10595924 3300028379 Bacteria 1061
194 Ga0268266_11396159 3300028379 Bacteria 676
195 Ga0268264_10345843 3300028381 Bacteria 1414
196 Ga0307517_10000175 3300028786 Bacteria 105567
197 Ga0307515_10045637 3300028794 Bacteria 6724
198 Ga0307515_10079464 3300028794 Bacteria 4296
199 Ga0265340_10012058 3300031247 Bacteria 4571
200 Ga0307513_10344352 3300031456 Bacteria 1240
201 Ga0307513_10374903 3300031456 Bacteria 1164
202 Ga0307508_10218291 3300031616 Bacteria 1507
203 Ga0265314_10157267 3300031711 Bacteria 1387
204 Ga0307516_10447801 3300031730 Bacteria 948
205 Ga0307516_10491528 3300031730 Bacteria 882
206 Ga0307405_10167975 3300031731 Bacteria 1562
207 Ga0307405_10191184 3300031731 Bacteria 1479
208 Ga0307406_10433196 3300031901 Bacteria 1051
209 Ga0307416_100654075 3300032002 Bacteria 1136
210 Ga0307415_100051373 3300032126 Bacteria 2797
211 Ga0307510_10289574 3300033180 Bacteria 1104
212 Ga0315911_1000008 3300033442 Bacteria 381285
213 Ga0373948_0049480 3300034817 Bacteria 900
214 Ga0373928_0188040 3300035084 Bacteria 590
215 Ga0373934_0167492 3300035086 Bacteria 902
216 Ga0373944_0067745 3300035089 Bacteria 1157
217 Ga0373949_0039414 3300035090 Bacteria 1157
218 Ga0373952_0064488 3300035092 Bacteria 903
219 Ga0373952_0163027 3300035092 Bacteria 633
220 Ga0373923_0014521 3300035111 Bacteria 2960
221 Ga0373923_0015288 3300035111 Bacteria 2895
222 Ga0373923_0094060 3300035111 Bacteria 1314
223 Ga0373936_0004680 3300035113 Bacteria 5175
224 Ga0373936_0122131 3300035113 Bacteria 1113
225 Ga0373945_0343015 3300035116 Bacteria 646
226 Ga0373953_0049383 3300035117 Unclassified 1697
227 Ga0373957_0095581 3300035120 Unclassified 1185
228 Ga0373957_0138937 3300035120 Bacteria 992
229 Ga0373943_0009067 3300035170 Bacteria 4460
230 Ga0373943_0031307 3300035170 Bacteria 2524
231 Ga0373946_0008136 3300035171 Bacteria 3849
232 Ga0373955_0191509 3300035172 Bacteria 1216
233 Ga0373955_0198651 3300035172 Bacteria 1193
234 Ga0373961_0138864 3300035241 Bacteria 820
235 Ga0373924_0006576 3300035410 Bacteria 4168
236 Ga0373924_0026539 3300035410 Bacteria 2298
237 Ga0373931_0028873 3300035691 Bacteria 2843
238 Ga0373931_0608671 3300035691 Unclassified 715
239 Ga0373935_0000500 3300035692 Bacteria 20245
240 Ga0373935_0022952 3300035692 Bacteria 3831
241 Ga0373935_0320200 3300035692 Bacteria 1100
242 Ga0373935_0706208 3300035692 Bacteria 742
243 Ga0373927_0000337 3300035695 Bacteria 36861
244 Ga0373927_0092084 3300035695 Bacteria 1969
245 Ga0373933_0002403 3300035724 Bacteria 10560
246 Ga0373933_0139110 3300035724 Bacteria 1532
247 Ga0373933_0203226 3300035724 Bacteria 1268
248 Ga0373947_0001596 3300035725 Bacteria 13905
249 Ga0373947_0081228 3300035725 Bacteria 2007
250 Ga0373947_0107828 3300035725 Bacteria 1756
251 Ga0373947_0118537 3300035725 Bacteria 1680
252 Ga0373947_0254668 3300035725 Bacteria 1162
253 Ga0373937_0001983 3300036401 Bacteria 17123
254 Ga0373937_0006754 3300036401 Bacteria 9902
255 Ga0373925_0002178 3300037068 Bacteria 15945
256 Ga0373925_0028292 3300037068 Bacteria 4107
257 Ga0373925_0130610 3300037068 Bacteria 1958
258 Ga0373925_0133301 3300037068 Bacteria 1939
259 Ga0373925_0294967 3300037068 Unclassified 1308
260 Ga0395900_0005446 3300037418 Bacteria 13337
261 Ga0395898_0027897 3300037466 Bacteria 5662
262 Ga0395905_0018997 3300037471 Bacteria 6517
263 Ga0395905_0155779 3300037471 Bacteria 2149
264 Ga0436364_0842905 3300037853 Bacteria 1415
265 Ga0436364_1290935 3300037853 Bacteria 889
266 Ga0395901_0243888 3300038443 Bacteria 1873
267 Ga0436365_0005537 3300039437 Bacteria 4679
268 Ga0436365_0719884 3300039437 Bacteria 2782
269 Ga0436360_0581218 3300039438 Bacteria 709
270 Ga0436361_0406703 3300039447 Bacteria 1046
271 Ga0436363_0484192 3300039450 Bacteria 1233
272 Ga0451793_1242619 3300041452 Bacteria 920
273 Ga0451853_3130839 3300041512 Bacteria 2037
274 Ga0466969_0101819 3300044656 Bacteria 1351
275 Ga0466972_0000107 3300044658 Bacteria 71873
276 Ga0466972_0037535 3300044658 Bacteria 2368
277 Ga0466972_0075192 3300044658 Bacteria 1610
278 Ga0466965_0069700 3300044683 Bacteria 1767
279 Ga0466966_0356384 3300044684 Bacteria 879
280 Ga0466961_0197223 3300044693 Bacteria 1246
281 Ga0466971_0114410 3300044719 Bacteria 1246
282 Ga0466968_0048898 3300044735 Bacteria 1800
283 Ga0466968_0139117 3300044735 Bacteria 1109
284 Ga0466968_0276529 3300044735 Bacteria 803
285 Ga0466970_0032219 3300044765 Bacteria 2769
286 Ga0466957_0056717 3300044842 Bacteria 2396
287 Ga0466960_0012111 3300044901 Bacteria 3630
288 Ga0466959_0067109 3300045049 Bacteria 2601
289 Ga0466967_0030343 3300045976 Bacteria 4536
290 Ga0495592_0018632 3300046454 Bacteria 5283
291 Ga0495603_0002718 3300046455 Bacteria 10429
292 Ga0495603_0618175 3300046455 Bacteria 620
293 Ga0495590_0167088 3300046457 Bacteria 801
294 Ga0495629_0000727 3300046459 Bacteria 26728
295 Ga0495629_0051911 3300046459 Bacteria 2869
296 Ga0495629_0543880 3300046459 Bacteria 780
297 Ga0495629_0739630 3300046459 Bacteria 651
298 Ga0495638_0322226 3300046460 Bacteria 825
299 Ga0495641_0004166 3300046461 Bacteria 10395
300 Ga0495651_0000661 3300046462 Bacteria 26738
301 Ga0495580_0000246 3300046472 Bacteria 43076
302 Ga0495580_0012045 3300046472 Bacteria 6658
303 Ga0495582_0000494 3300046473 Bacteria 21572
304 Ga0495582_0028272 3300046473 Bacteria 3077
305 Ga0495582_0077162 3300046473 Bacteria 1848
306 Ga0495582_0214810 3300046473 Bacteria 1100
307 Ga0495605_0217053 3300046474 Bacteria 828
308 Ga0495639_0000119 3300046475 Bacteria 39930
309 Ga0495639_0006327 3300046475 Bacteria 5089
310 Ga0495639_0319549 3300046475 Bacteria 776
311 Ga0495662_0001142 3300046476 Bacteria 13095
312 Ga0495662_0144246 3300046476 Bacteria 1172
313 Ga0495664_0025257 3300046477 Bacteria 3458
314 Ga0495664_0049070 3300046477 Bacteria 2506
315 Ga0495664_0106632 3300046477 Bacteria 1689
316 Ga0495594_0004003 3300046499 Bacteria 7579
317 Ga0495608_0016190 3300046511 Bacteria 5159
318 Ga0495618_0083133 3300046514 Bacteria 2045
319 Ga0495628_0017937 3300046516 Bacteria 5874
320 Ga0495630_0111067 3300046517 Bacteria 2076
321 Ga0495630_0263073 3300046517 Bacteria 1318
322 Ga0495630_0523216 3300046517 Bacteria 909
323 Ga0495630_0674105 3300046517 Bacteria 791
324 Ga0495632_0198769 3300046519 Bacteria 914
325 Ga0495666_0012738 3300046526 Bacteria 4192
326 Ga0495666_0053467 3300046526 Bacteria 1938
327 Ga0495652_0032064 3300046529 Bacteria 4597
328 Ga0495665_0000251 3300046531 Bacteria 26959
329 Ga0495665_0029705 3300046531 Bacteria 2928
330 Ga0495640_0014321 3300046533 Bacteria 6004
331 Ga0495640_0142418 3300046533 Bacteria 1545
332 Ga0495640_0205294 3300046533 Bacteria 1247
333 Ga0495586_0127261 3300046535 Bacteria 1425
334 Ga0495587_0000339 3300046536 Bacteria 33290
335 Ga0495597_0278889 3300046542 Bacteria 651
336 Ga0495645_0007915 3300046543 Bacteria 7397
337 Ga0495622_0032065 3300046557 Bacteria 2453
338 Ga0495667_0013822 3300046559 Bacteria 5452
339 Ga0495667_0218418 3300046559 Bacteria 1217
340 Ga0495656_0465270 3300046615 Bacteria 667
341 Ga0495634_0000886 3300046642 Bacteria 28754
342 Ga0495634_0088946 3300046642 Bacteria 2008
343 Ga0495635_0001208 3300046663 Bacteria 17261
344 Ga0495635_0001322 3300046663 Bacteria 16499
345 Ga0495588_0037029 3300046674 Bacteria 2477
346 Ga0495588_0108811 3300046674 Bacteria 1459
347 Ga0495657_0198144 3300046675 Bacteria 1225
348 Ga0495657_0319908 3300046675 Unclassified 922
349 Ga0495599_0211033 3300046678 Bacteria 1190
350 Ga0495599_0236690 3300046678 Bacteria 1114
351 Ga0495646_0002747 3300046680 Bacteria 10876
352 Ga0495646_0003823 3300046680 Bacteria 9410
353 Ga0495647_0000085 3300046681 Bacteria 22908
354 Ga0495647_0058975 3300046681 Bacteria 1510
355 Ga0495658_0000135 3300046683 Bacteria 40991
356 Ga0495613_0529770 3300046689 Bacteria 790
357 Ga0495624_0000144 3300046690 Bacteria 51509
358 Ga0495624_0119526 3300046690 Bacteria 1619
359 Ga0495600_0238847 3300046809 Bacteria 1158
360 Ga0495581_0000421 3300047315 Bacteria 21445
361 Ga0495581_0427317 3300047315 Bacteria 772
362 Ga0495604_0110337 3300047317 Bacteria 2007
363 Ga0495604_0247268 3300047317 Bacteria 1217
364 Ga0495674_0001274 3300047319 Bacteria 24483
365 Ga0495674_0286397 3300047319 Bacteria 1349
366 Ga0495674_0483917 3300047319 Bacteria 991
367 Ga0495676_0007487 3300047321 Bacteria 10015
368 Ga0495676_0207212 3300047321 Bacteria 1359
369 Ga0495680_0009805 3300047322 Bacteria 8589
370 Ga0495680_0202615 3300047322 Bacteria 1423
371 Ga0495675_0004040 3300047444 Bacteria 8892
372 Ga0495684_0134276 3300047471 Bacteria 1857
373 Ga0495684_0498897 3300047471 Bacteria 837
374 Ga0495593_0000007 3300047673 Bacteria 87657
375 Ga0495602_0033867 3300048088 Bacteria 4786
376 Ga0495614_0007215 3300048089 Bacteria 4953
377 Ga0496100_0114824 3300048903 Bacteria 1876
378 Ga0496101_0002295 3300048904 Bacteria 11691
379 Ga0496101_0028524 3300048904 Bacteria 3897
380 Ga0496101_0400037 3300048904 Bacteria 1081
381 Ga0496102_0003496 3300048905 Bacteria 13323
382 Ga0496102_0051167 3300048905 Bacteria 3763
383 Ga0496102_0477595 3300048905 Bacteria 1168
384 Ga0496102_0922133 3300048905 Bacteria 795
385 Ga0496103_0005524 3300048906 Bacteria 7563
386 Ga0496104_0000517 3300048907 Bacteria 33033
387 Ga0496104_0012015 3300048907 Bacteria 7770
388 Ga0496104_0053180 3300048907 Bacteria 3825
389 Ga0496104_0179338 3300048907 Bacteria 2028
390 Ga0496105_0012456 3300048908 Bacteria 6733
391 Ga0496105_0026588 3300048908 Bacteria 4722
392 Ga0496105_0040580 3300048908 Bacteria 3837
393 Ga0496105_0094038 3300048908 Bacteria 2475
394 Ga0496106_0004144 3300048909 Bacteria 10806
395 Ga0496106_0076702 3300048909 Bacteria 2562
396 Ga0496106_0361266 3300048909 Bacteria 1166
397 Ga0496106_1038362 3300048909 Bacteria 644
398 Ga0496107_0007336 3300048910 Bacteria 7602
399 Ga0496107_0137567 3300048910 Bacteria 1805
400 Ga0496107_0200679 3300048910 Bacteria 1482
401 Ga0496108_0002968 3300048911 Bacteria 13629
402 Ga0496108_0009442 3300048911 Bacteria 7900
403 Ga0496108_0012940 3300048911 Bacteria 6799
404 Ga0496108_0060642 3300048911 Bacteria 3183
405 Ga0496108_0260464 3300048911 Bacteria 1509
406 Ga0496109_0000536 3300048912 Bacteria 32149
407 Ga0496109_0003252 3300048912 Bacteria 13541
408 Ga0496109_0033178 3300048912 Bacteria 4643
409 Ga0496109_0118817 3300048912 Bacteria 2461
410 Ga0496110_0007869 3300048913 Bacteria 8537
411 Ga0496110_0011070 3300048913 Bacteria 7365
412 Ga0496110_0027358 3300048913 Bacteria 4888
413 Ga0496110_0067035 3300048913 Bacteria 3175
414 Ga0496111_0072677 3300048914 Bacteria 2503
415 Ga0496111_0094051 3300048914 Bacteria 2198
416 Ga0496111_0114599 3300048914 Bacteria 1987
417 Ga0496111_0210701 3300048914 Bacteria 1443
418 Ga0496111_0475346 3300048914 Bacteria 921
419 Ga0496112_0001698 3300048915 Bacteria 17181
420 Ga0496112_0003481 3300048915 Bacteria 13031
421 Ga0496112_0014567 3300048915 Bacteria 7304
422 Ga0496112_0199848 3300048915 Bacteria 1959
423 Ga0496112_0308339 3300048915 Bacteria 1528
424 Ga0496113_0010612 3300048916 Bacteria 6099
425 Ga0496113_0013241 3300048916 Bacteria 5579
426 Ga0496113_0027340 3300048916 Bacteria 4089
427 Ga0496113_0045387 3300048916 Bacteria 3259
428 Ga0496114_0184123 3300048917 Bacteria 1825
429 Ga0496114_0281834 3300048917 Bacteria 1465
430 Ga0496114_0717827 3300048917 Bacteria 876
431 Ga0496115_0028722 3300048918 Bacteria 4361
432 Ga0496115_0067108 3300048918 Bacteria 2900
433 Ga0496115_0171375 3300048918 Bacteria 1795
434 Ga0496115_0279350 3300048918 Bacteria 1371
435 Ga0496115_0555467 3300048918 Bacteria 917
436 Ga0496115_0940651 3300048918 Bacteria 664
437 Ga0496121_0152242 3300048924 Bacteria 1701
438 Ga0496121_0410993 3300048924 Bacteria 883
439 Ga0496124_0182051 3300048927 Bacteria 1616
440 Ga0496125_0615532 3300048928 Bacteria 590
441 Ga0496126_0025186 3300048929 Bacteria 5729
442 Ga0496126_0064106 3300048929 Bacteria 3292
443 Ga0496126_0210930 3300048929 Bacteria 1635
444 Ga0496126_0410754 3300048929 Bacteria 1096
445 Ga0501047_0277439 3300049581 Bacteria 1521
446 Ga0501048_0557762 3300049582 Bacteria 822
447 Ga0501070_0033822 3300049586 Bacteria 4278
448 Ga0501073_0184349 3300049589 Bacteria 1445
449 Ga0501074_0007921 3300049590 Bacteria 7695
450 Ga0501079_0489170 3300049741 Bacteria 967
451 Ga0501080_0018158 3300049742 Bacteria 6510
452 Ga0501044_0045151 3300049823 Bacteria 4568
453 nmdc:mga03n38_270632_c1 3300050490 Bacteria 903
454 nmdc:mga03n38_89108_c1 3300050490 Bacteria 1465
455 nmdc:mga00v17_234830_c1 3300050491 Bacteria 1188
456 nmdc:mga0yw44_163726_c1 3300050492 Bacteria 1457
457 nmdc:mga0k408_478422_c1 3300050493 Bacteria 739
458 nmdc:mga06z11_160093_c1 3300050494 Bacteria 1286
459 nmdc:mga06z11_504044_c1 3300050494 Bacteria 733
460 nmdc:mga06z11_77885_c1 3300050494 Bacteria 1771
461 nmdc:mga04h51_67672_c1 3300050495 Bacteria 1239
462 nmdc:mga07m45_144624_c1 3300050496 Bacteria 1378
463 nmdc:mga05p37_66227_c1 3300050507 Bacteria 4443
464 nmdc:mga05p37_809986_c1 3300050507 Bacteria 1023
465 nmdc:mga09592_354023_c1 3300050508 Bacteria 1270
466 nmdc:mga06r32_124457_c1 3300050510 Bacteria 2545
467 nmdc:mga06r32_455502_c1 3300050510 Bacteria 1259
468 nmdc:mga0n895_42430_c1 3300050512 Bacteria 4425
469 Ga0495601_0111850 3300053077 Bacteria 1769
470 Ga0495601_0181981 3300053077 Bacteria 1374
471 Ga0495601_0225372 3300053077 Bacteria 1224
472 Ga0495612_0002910 3300053078 Bacteria 7099
473 Ga0495612_0028993 3300053078 Bacteria 2228
474 Ga0495655_0037605 3300053083 Bacteria 1217
475 Ga0495595_0018541 3300053084 Bacteria 3008
476 Ga0495619_0275360 3300053085 Bacteria 1166
477 Ga0495619_0603168 3300053085 Bacteria 751
478 Ga0500566_0008515 3300053094 Bacteria 6065
479 Ga0500595_024041 3300053119 Bacteria 2131
480 Ga0500608_008620 3300053122 Bacteria 4297
481 Ga0500559_0000244 3300053136 Bacteria 42994
482 Ga0500603_036500 3300053150 Bacteria 1293
483 Ga0500627_0078212 3300053158 Bacteria 1472
484 Ga0500638_005746 3300053162 Bacteria 4987
485 Ga0500639_010041 3300053163 Bacteria 4954
486 Ga0500636_0182396 3300053177 Bacteria 1126
487 Ga0500661_001701 3300055283 Bacteria 4140
488 Ga0466962_0120391 3300061719 Bacteria 1266

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10439698 Ga0207693_104396982 151
2 3300048904 Ga0496101_0400037 Ga0496101_0400037_467_1018 158
3 3300048907 Ga0496104_0053180 Ga0496104_0053180_2598_3149 158
4 3300048911 Ga0496108_0260464 Ga0496108_0260464_293_865 158
5 3300048918 Ga0496115_0555467 Ga0496115_0555467_343_894 158
6 3300048914 Ga0496111_0475346 Ga0496111_0475346_153_704 159
7 3300035172 Ga0373955_0191509 Ga0373955_0191509_147_668 160
8 3300035724 Ga0373933_0139110 Ga0373933_0139110_93_614 160
9 3300036401 Ga0373937_0006754 Ga0373937_0006754_6311_6832 160
10 3300047471 Ga0495684_0498897 Ga0495684_0498897_282_803 160
11 3300006178 Ga0075367_10165113 Ga0075367_101651132 161
12 3300006871 Ga0075434_100072244 Ga0075434_1000722443 161
13 3300050494 nmdc:mga06z11_77885_c1 nmdc:mga06z11_77885_c1_178_726 161
14 3300050512 nmdc:mga0n895_42430_c1 nmdc:mga0n895_42430_c1_2491_3000 161
15 3300050491 nmdc:mga00v17_234830_c1 nmdc:mga00v17_234830_c1_475_978 162
16 3300037471 Ga0395905_0018997 Ga0395905_0018997_2914_3405 163
17 3300048917 Ga0496114_0717827 Ga0496114_0717827_230_799 163
18 3300050493 nmdc:mga0k408_478422_c1 nmdc:mga0k408_478422_c1_14_505 163
19 3300050496 nmdc:mga07m45_144624_c1 nmdc:mga07m45_144624_c1_576_1067 163
20 3300053158 Ga0500627_0078212 Ga0500627_0078212_544_1050 163
21 3300005983 Ga0081540_1005846 Ga0081540_10058467 164
22 3300048929 Ga0496126_0025186 Ga0496126_0025186_3706_4203 164
23 iso_pu_bacteria 2524023210 2524469518 164
24 iso_pu_bacteria 8056681323 8056686580 164
25 3300049581 Ga0501047_0277439 Ga0501047_0277439_163_678 165
26 3300049582 Ga0501048_0557762 Ga0501048_0557762_131_646 165
27 3300049586 Ga0501070_0033822 Ga0501070_0033822_371_886 165
28 3300049589 Ga0501073_0184349 Ga0501073_0184349_812_1327 165
29 3300049590 Ga0501074_0007921 Ga0501074_0007921_2055_2570 165
30 3300049741 Ga0501079_0489170 Ga0501079_0489170_428_943 165
31 3300049742 Ga0501080_0018158 Ga0501080_0018158_3160_3675 165
32 3300049823 Ga0501044_0045151 Ga0501044_0045151_1297_1812 165
33 3300005364 Ga0070673_100496749 Ga0070673_1004967492 166
34 3300005535 Ga0070684_100433992 Ga0070684_1004339921 166
35 3300005618 Ga0068864_100381847 Ga0068864_1003818472 166
36 3300005842 Ga0068858_100391621 Ga0068858_1003916212 166
37 3300006844 Ga0075428_100329369 Ga0075428_1003293692 166
38 3300006847 Ga0075431_100996279 Ga0075431_1009962792 166
39 3300009094 Ga0111539_10061817 Ga0111539_100618179 166
40 3300009101 Ga0105247_10234261 Ga0105247_102342612 166
41 3300009147 Ga0114129_10040520 Ga0114129_100405209 166
42 3300009147 Ga0114129_10566230 Ga0114129_105662302 166
43 3300009553 Ga0105249_10199315 Ga0105249_101993152 166
44 3300011119 Ga0105246_10401546 Ga0105246_104015462 166
45 3300014325 Ga0163163_10046231 Ga0163163_100462313 166
46 3300014968 Ga0157379_10860016 Ga0157379_108600161 166
47 3300025925 Ga0207650_10021414 Ga0207650_100214143 166
48 3300025945 Ga0207679_10284619 Ga0207679_102846191 166
49 3300025960 Ga0207651_11036537 Ga0207651_110365371 166
50 3300026095 Ga0207676_10608791 Ga0207676_106087912 166
51 3300035092 Ga0373952_0163027 Ga0373952_0163027_65_577 166
52 3300035241 Ga0373961_0138864 Ga0373961_0138864_32_544 166
53 3300035691 Ga0373931_0608671 Ga0373931_0608671_64_576 166
54 3300035725 Ga0373947_0118537 Ga0373947_0118537_1052_1564 166
55 3300046473 Ga0495582_0214810 Ga0495582_0214810_530_1042 166
56 3300046517 Ga0495630_0263073 Ga0495630_0263073_686_1198 166
57 3300046533 Ga0495640_0142418 Ga0495640_0142418_1008_1520 166
58 3300047319 Ga0495674_0286397 Ga0495674_0286397_592_1104 166
59 3300048904 Ga0496101_0028524 Ga0496101_0028524_944_1456 166
60 3300048907 Ga0496104_0000517 Ga0496104_0000517_21153_21665 166
61 3300048908 Ga0496105_0026588 Ga0496105_0026588_4152_4664 166
62 3300048909 Ga0496106_0361266 Ga0496106_0361266_285_797 166
63 3300048910 Ga0496107_0137567 Ga0496107_0137567_499_1011 166
64 3300048911 Ga0496108_0002968 Ga0496108_0002968_1522_2034 166
65 3300048912 Ga0496109_0000536 Ga0496109_0000536_479_991 166
66 3300048913 Ga0496110_0027358 Ga0496110_0027358_535_1047 166
67 3300048914 Ga0496111_0210701 Ga0496111_0210701_106_618 166
68 3300048915 Ga0496112_0001698 Ga0496112_0001698_5273_5785 166
69 3300048916 Ga0496113_0027340 Ga0496113_0027340_1501_2013 166
70 3300050507 nmdc:mga05p37_66227_c1 nmdc:mga05p37_66227_c1_1260_1772 166
71 3300050507 nmdc:mga05p37_809986_c1 nmdc:mga05p37_809986_c1_468_968 166
72 3300050510 nmdc:mga06r32_124457_c1 nmdc:mga06r32_124457_c1_570_1082 166
73 3300005937 Ga0081455_10072677 Ga0081455_100726773 167
74 3300005981 Ga0081538_10109783 Ga0081538_101097832 167
75 3300006042 Ga0075368_10205443 Ga0075368_102054431 167
76 3300006051 Ga0075364_10186728 Ga0075364_101867281 167
77 3300006177 Ga0075362_10060148 Ga0075362_100601482 167
78 3300006178 Ga0075367_10155653 Ga0075367_101556531 167
79 3300006186 Ga0075369_10238599 Ga0075369_102385991 167
80 3300050494 nmdc:mga06z11_160093_c1 nmdc:mga06z11_160093_c1_512_1042 167
81 3300050495 nmdc:mga04h51_67672_c1 nmdc:mga04h51_67672_c1_86_616 167
82 3300050508 nmdc:mga09592_354023_c1 nmdc:mga09592_354023_c1_627_1145 167
83 3300050510 nmdc:mga06r32_455502_c1 nmdc:mga06r32_455502_c1_42_560 167
84 iso_pu_bacteria 2513237096 2513660821 167
85 iso_pu_bacteria 2513237098 2513675083 167
86 iso_pu_bacteria 2513237137 2513860882 167
87 iso_pu_bacteria 2513237145 2513922557 167
88 iso_pu_bacteria 2517572143 2517888904 167
89 iso_pu_bacteria 2524023228 2524536984 167
90 iso_pu_bacteria 2617270741 2617373812 167
91 iso_pu_bacteria 2667528175 2671122510 167
92 iso_pu_bacteria 2728368998 2728755050 167
93 iso_pu_bacteria 2791355197 2793074023 167
94 iso_pu_bacteria 2824679649 2824686541 167
95 iso_pu_bacteria 2824746037 2824748645 167
96 iso_pu_bacteria 2842038055 2842043452 167
97 iso_pu_bacteria 2842045827 2842052558 167
98 iso_pu_bacteria 2844315083 2844315393 167
99 iso_pu_bacteria 2874620515 2874624845 167
100 iso_pu_bacteria 2885374607 2885377496 167
101 iso_pu_bacteria 2885383462 2885388897 167
102 iso_pu_bacteria 2903727486 2903732252 167
103 iso_pu_bacteria 2903748898 2903752088 167
104 iso_pu_bacteria 2903768456 2903771811 167
105 iso_pu_bacteria 2904666416 2904670200 167
106 iso_pu_bacteria 2904690495 2904691138 167
107 iso_pu_bacteria 2904699407 2904708612 167
108 iso_pu_bacteria 2906602504 2906604331 167
109 iso_pu_bacteria 2906610324 2906613932 167
110 iso_pu_bacteria 2906635258 2906637569 167
111 iso_pu_bacteria 2906660503 2906668780 167
112 iso_pu_bacteria 2908739725 2908747507 167
113 iso_pu_bacteria 2908756301 2908756532 167
114 iso_pu_bacteria 2908775508 2908776329 167
115 iso_pu_bacteria 2922393267 2922394291 167
116 iso_pu_bacteria 2922425934 2922434160 167
117 iso_pu_bacteria 2935630451 2935637077 167
118 iso_pu_bacteria 2941507105 2941513656 167
119 iso_pu_bacteria 2941515067 2941521619 167
120 iso_pu_bacteria 2941523033 2941529432 167
121 iso_pu_bacteria 3005474847 3005475130 167
122 iso_pu_bacteria 3005483717 3005489018 167
123 iso_pu_bacteria 3005587118 3005591572 167
124 iso_pu_bacteria 3005718088 3005718358 167
125 iso_pu_bacteria 8006926726 8006933256 167
126 iso_pu_bacteria 8006933436 8006936161 167
127 iso_pu_bacteria 8006973647 8006976107 167
128 iso_pu_bacteria 8019555841 8019562499 167
129 iso_pu_bacteria 8019565922 8019572573 167
130 iso_pu_bacteria 8056689827 8056691010 167
131 3300006852 Ga0075433_10783824 Ga0075433_107838241 168
132 3300025915 Ga0207693_10268901 Ga0207693_102689012 168
133 3300031247 Ga0265340_10012058 Ga0265340_100120582 168
134 3300031711 Ga0265314_10157267 Ga0265314_101572672 168
135 3300035111 Ga0373923_0014521 Ga0373923_0014521_2216_2728 168
136 3300035117 Ga0373953_0049383 Ga0373953_0049383_1161_1673 168
137 3300035120 Ga0373957_0095581 Ga0373957_0095581_281_793 168
138 3300035410 Ga0373924_0006576 Ga0373924_0006576_3448_3960 168
139 3300035724 Ga0373933_0002403 Ga0373933_0002403_1995_2501 168
140 3300036401 Ga0373937_0001983 Ga0373937_0001983_6249_6761 168
141 3300037068 Ga0373925_0294967 Ga0373925_0294967_277_789 168
142 3300046454 Ga0495592_0018632 Ga0495592_0018632_3324_3836 168
143 3300046462 Ga0495651_0000661 Ga0495651_0000661_1545_2057 168
144 3300046511 Ga0495608_0016190 Ga0495608_0016190_4282_4794 168
145 3300046536 Ga0495587_0000339 Ga0495587_0000339_27708_28220 168
146 3300046663 Ga0495635_0001322 Ga0495635_0001322_15955_16467 168
147 3300046675 Ga0495657_0319908 Ga0495657_0319908_47_559 168
148 3300046680 Ga0495646_0002747 Ga0495646_0002747_5104_5616 168
149 3300047322 Ga0495680_0009805 Ga0495680_0009805_5114_5626 168
150 3300047444 Ga0495675_0004040 Ga0495675_0004040_1016_1528 168
151 3300048088 Ga0495602_0033867 Ga0495602_0033867_429_941 168
152 3300048905 Ga0496102_0477595 Ga0496102_0477595_636_1148 168
153 3300048907 Ga0496104_0012015 Ga0496104_0012015_6914_7420 168
154 3300048911 Ga0496108_0060642 Ga0496108_0060642_2415_2921 168
155 3300048915 Ga0496112_0199848 Ga0496112_0199848_19_531 168
156 3300048915 Ga0496112_0308339 Ga0496112_0308339_250_762 168
157 3300048918 Ga0496115_0028722 Ga0496115_0028722_2638_3144 168
158 3300053078 Ga0495612_0002910 Ga0495612_0002910_4776_5288 168
159 3300053084 Ga0495595_0018541 Ga0495595_0018541_603_1115 168
160 3300006042 Ga0075368_10151203 Ga0075368_101512031 169
161 3300006195 Ga0075366_10029827 Ga0075366_100298272 169
162 3300006353 Ga0075370_10151650 Ga0075370_101516502 169
163 3300009093 Ga0105240_10004777 Ga0105240_1000477713 169
164 3300025261 Ga0209233_1007665 Ga0209233_10076653 169
165 3300026121 Ga0207683_10631589 Ga0207683_106315891 169
166 3300033442 Ga0315911_1000008 Ga0315911_1000008246 169
167 3300039450 Ga0436363_0484192 Ga0436363_0484192_578_1087 169
168 3300044658 Ga0466972_0075192 Ga0466972_0075192_742_1251 169
169 3300046455 Ga0495603_0618175 Ga0495603_0618175_68_583 169
170 3300048929 Ga0496126_0210930 Ga0496126_0210930_47_556 169
171 3300004803 Ga0058862_12548500 Ga0058862_125485001 170
172 3300005331 Ga0070670_100272627 Ga0070670_1002726272 170
173 3300005338 Ga0068868_100054743 Ga0068868_1000547434 170
174 3300005341 Ga0070691_10213807 Ga0070691_102138071 170
175 3300005355 Ga0070671_100289945 Ga0070671_1002899451 170
176 3300005356 Ga0070674_100056596 Ga0070674_1000565963 170
177 3300005365 Ga0070688_100397101 Ga0070688_1003971011 170
178 3300005436 Ga0070713_100126962 Ga0070713_1001269622 170
179 3300005436 Ga0070713_100863065 Ga0070713_1008630651 170
180 3300005455 Ga0070663_100022584 Ga0070663_1000225842 170
181 3300005456 Ga0070678_100061795 Ga0070678_1000617953 170
182 3300005466 Ga0070685_10472771 Ga0070685_104727712 170
183 3300005535 Ga0070684_100046817 Ga0070684_1000468172 170
184 3300005536 Ga0070697_100009632 Ga0070697_1000096321 170
185 3300005548 Ga0070665_100298515 Ga0070665_1002985151 170
186 3300005548 Ga0070665_100735143 Ga0070665_1007351431 170
187 3300005548 Ga0070665_101008173 Ga0070665_1010081732 170
188 3300005563 Ga0068855_100688531 Ga0068855_1006885311 170
189 3300005564 Ga0070664_100053295 Ga0070664_1000532953 170
190 3300005618 Ga0068864_100049859 Ga0068864_1000498592 170
191 3300005718 Ga0068866_10057490 Ga0068866_100574901 170
192 3300005842 Ga0068858_100451568 Ga0068858_1004515681 170
193 3300005983 Ga0081540_1085626 Ga0081540_10856262 170
194 3300006028 Ga0070717_10019833 Ga0070717_100198333 170
195 3300006042 Ga0075368_10119775 Ga0075368_101197751 170
196 3300006048 Ga0075363_100262362 Ga0075363_1002623621 170
197 3300006175 Ga0070712_100444132 Ga0070712_1004441321 170
198 3300006237 Ga0097621_100447086 Ga0097621_1004470862 170
199 3300006353 Ga0075370_10221759 Ga0075370_102217591 170
200 3300006358 Ga0068871_100420181 Ga0068871_1004201811 170
201 3300006881 Ga0068865_100040260 Ga0068865_1000402604 170
202 3300006881 Ga0068865_100749460 Ga0068865_1007494601 170
203 3300007265 Ga0099794_10033882 Ga0099794_100338823 170
204 3300009093 Ga0105240_10117059 Ga0105240_101170592 170
205 3300009098 Ga0105245_10007604 Ga0105245_100076044 170
206 3300009098 Ga0105245_12298231 Ga0105245_122982311 170
207 3300009101 Ga0105247_10396629 Ga0105247_103966291 170
208 3300009148 Ga0105243_10291740 Ga0105243_102917402 170
209 3300009148 Ga0105243_11150138 Ga0105243_111501381 170
210 3300009177 Ga0105248_10221213 Ga0105248_102212133 170
211 3300009545 Ga0105237_10016029 Ga0105237_100160296 170
212 3300009545 Ga0105237_10070886 Ga0105237_100708863 170
213 3300009545 Ga0105237_10434858 Ga0105237_104348582 170
214 3300009545 Ga0105237_10643937 Ga0105237_106439372 170
215 3300009551 Ga0105238_10037927 Ga0105238_100379274 170
216 3300009551 Ga0105238_10587329 Ga0105238_105873291 170
217 3300010375 Ga0105239_10016959 Ga0105239_100169593 170
218 3300010375 Ga0105239_10132102 Ga0105239_101321024 170
219 3300011119 Ga0105246_10009574 Ga0105246_100095742 170
220 3300013105 Ga0157369_10005521 Ga0157369_100055213 170
221 3300013105 Ga0157369_10014138 Ga0157369_100141387 170
222 3300013296 Ga0157374_10012776 Ga0157374_100127762 170
223 3300013297 Ga0157378_10127170 Ga0157378_101271702 170
224 3300013297 Ga0157378_10421480 Ga0157378_104214801 170
225 3300013306 Ga0163162_10180203 Ga0163162_101802032 170
226 3300013306 Ga0163162_10909708 Ga0163162_109097081 170
227 3300013307 Ga0157372_10154991 Ga0157372_101549913 170
228 3300013308 Ga0157375_10046704 Ga0157375_100467045 170
229 3300013308 Ga0157375_10225589 Ga0157375_102255892 170
230 3300014325 Ga0163163_10116449 Ga0163163_101164491 170
231 3300014325 Ga0163163_10438918 Ga0163163_104389181 170
232 3300014326 Ga0157380_10177981 Ga0157380_101779812 170
233 3300014745 Ga0157377_10174220 Ga0157377_101742201 170
234 3300014745 Ga0157377_10442590 Ga0157377_104425901 170
235 3300014968 Ga0157379_10129317 Ga0157379_101293174 170
236 3300014969 Ga0157376_10086000 Ga0157376_100860004 170
237 3300017792 Ga0163161_10250534 Ga0163161_102505342 170
238 3300017792 Ga0163161_10279951 Ga0163161_102799512 170
239 3300020070 Ga0206356_10358370 Ga0206356_103583703 170
240 3300020080 Ga0206350_10285734 Ga0206350_102857342 170
241 3300020082 Ga0206353_10072688 Ga0206353_100726881 170
242 3300021384 Ga0213876_10145727 Ga0213876_101457272 170
243 3300021388 Ga0213875_10213735 Ga0213875_102137351 170
244 3300025321 Ga0207656_10189801 Ga0207656_101898012 170
245 3300025899 Ga0207642_10394644 Ga0207642_103946441 170
246 3300025904 Ga0207647_10084686 Ga0207647_100846862 170
247 3300025913 Ga0207695_10086938 Ga0207695_100869384 170
248 3300025914 Ga0207671_10017495 Ga0207671_100174952 170
249 3300025914 Ga0207671_10049535 Ga0207671_100495352 170
250 3300025915 Ga0207693_10087142 Ga0207693_100871423 170
251 3300025915 Ga0207693_10396874 Ga0207693_103968741 170
252 3300025915 Ga0207693_10895137 Ga0207693_108951371 170
253 3300025917 Ga0207660_10432847 Ga0207660_104328471 170
254 3300025920 Ga0207649_10167723 Ga0207649_101677233 170
255 3300025921 Ga0207652_11365954 Ga0207652_113659541 170
256 3300025924 Ga0207694_10045602 Ga0207694_100456022 170
257 3300025924 Ga0207694_10393263 Ga0207694_103932631 170
258 3300025925 Ga0207650_10275214 Ga0207650_102752142 170
259 3300025927 Ga0207687_10477164 Ga0207687_104771642 170
260 3300025928 Ga0207700_10009234 Ga0207700_100092345 170
261 3300025928 Ga0207700_10754248 Ga0207700_107542481 170
262 3300025929 Ga0207664_10851947 Ga0207664_108519471 170
263 3300025931 Ga0207644_10445899 Ga0207644_104458992 170
264 3300025933 Ga0207706_10646145 Ga0207706_106461451 170
265 3300025937 Ga0207669_10783651 Ga0207669_107836511 170
266 3300025938 Ga0207704_10067493 Ga0207704_100674934 170
267 3300025940 Ga0207691_10183872 Ga0207691_101838722 170
268 3300025941 Ga0207711_10230505 Ga0207711_102305054 170
269 3300025942 Ga0207689_10036180 Ga0207689_100361803 170
270 3300025942 Ga0207689_10168988 Ga0207689_101689882 170
271 3300025945 Ga0207679_10511856 Ga0207679_105118562 170
272 3300025949 Ga0207667_10769184 Ga0207667_107691841 170
273 3300025972 Ga0207668_10175217 Ga0207668_101752173 170
274 3300025986 Ga0207658_10091936 Ga0207658_100919362 170
275 3300025986 Ga0207658_11191289 Ga0207658_111912891 170
276 3300026023 Ga0207677_10334152 Ga0207677_103341523 170
277 3300026035 Ga0207703_10189493 Ga0207703_101894932 170
278 3300026041 Ga0207639_10082707 Ga0207639_100827072 170
279 3300026067 Ga0207678_10037290 Ga0207678_100372902 170
280 3300026078 Ga0207702_10172071 Ga0207702_101720713 170
281 3300026088 Ga0207641_10116887 Ga0207641_101168871 170
282 3300026088 Ga0207641_10642096 Ga0207641_106420962 170
283 3300026095 Ga0207676_10037254 Ga0207676_100372543 170
284 3300026095 Ga0207676_11121149 Ga0207676_111211491 170
285 3300026121 Ga0207683_10046084 Ga0207683_100460846 170
286 3300026121 Ga0207683_10072440 Ga0207683_100724401 170
287 3300026142 Ga0207698_10058070 Ga0207698_100580704 170
288 3300028379 Ga0268266_10095308 Ga0268266_100953083 170
289 3300028379 Ga0268266_10595924 Ga0268266_105959241 170
290 3300028379 Ga0268266_11396159 Ga0268266_113961591 170
291 3300028381 Ga0268264_10345843 Ga0268264_103458432 170
292 3300028786 Ga0307517_10000175 Ga0307517_100001755 170
293 3300028794 Ga0307515_10045637 Ga0307515_100456372 170
294 3300028794 Ga0307515_10079464 Ga0307515_100794644 170
295 3300031456 Ga0307513_10344352 Ga0307513_103443522 170
296 3300031456 Ga0307513_10374903 Ga0307513_103749031 170
297 3300031730 Ga0307516_10447801 Ga0307516_104478011 170
298 3300031730 Ga0307516_10491528 Ga0307516_104915281 170
299 3300031731 Ga0307405_10167975 Ga0307405_101679752 170
300 3300031731 Ga0307405_10191184 Ga0307405_101911841 170
301 3300031901 Ga0307406_10433196 Ga0307406_104331961 170
302 3300032002 Ga0307416_100654075 Ga0307416_1006540752 170
303 3300032126 Ga0307415_100051373 Ga0307415_1000513732 170
304 3300033180 Ga0307510_10289574 Ga0307510_102895741 170
305 3300034817 Ga0373948_0049480 Ga0373948_0049480_103_615 170
306 3300035084 Ga0373928_0188040 Ga0373928_0188040_38_550 170
307 3300035089 Ga0373944_0067745 Ga0373944_0067745_601_1113 170
308 3300035090 Ga0373949_0039414 Ga0373949_0039414_300_812 170
309 3300035092 Ga0373952_0064488 Ga0373952_0064488_126_638 170
310 3300035111 Ga0373923_0094060 Ga0373923_0094060_143_721 170
311 3300035113 Ga0373936_0004680 Ga0373936_0004680_675_1253 170
312 3300035120 Ga0373957_0138937 Ga0373957_0138937_339_917 170
313 3300035170 Ga0373943_0009067 Ga0373943_0009067_3564_4076 170
314 3300035170 Ga0373943_0031307 Ga0373943_0031307_246_824 170
315 3300035171 Ga0373946_0008136 Ga0373946_0008136_3120_3698 170
316 3300035410 Ga0373924_0026539 Ga0373924_0026539_34_612 170
317 3300035691 Ga0373931_0028873 Ga0373931_0028873_962_1474 170
318 3300035692 Ga0373935_0000500 Ga0373935_0000500_2712_3290 170
319 3300035692 Ga0373935_0320200 Ga0373935_0320200_259_771 170
320 3300035692 Ga0373935_0706208 Ga0373935_0706208_101_613 170
321 3300035695 Ga0373927_0000337 Ga0373927_0000337_22521_23099 170
322 3300035695 Ga0373927_0092084 Ga0373927_0092084_1366_1878 170
323 3300035725 Ga0373947_0001596 Ga0373947_0001596_11732_12310 170
324 3300035725 Ga0373947_0081228 Ga0373947_0081228_758_1270 170
325 3300035725 Ga0373947_0254668 Ga0373947_0254668_386_898 170
326 3300037068 Ga0373925_0002178 Ga0373925_0002178_4180_4758 170
327 3300037068 Ga0373925_0028292 Ga0373925_0028292_2638_3150 170
328 3300037068 Ga0373925_0130610 Ga0373925_0130610_212_724 170
329 3300037068 Ga0373925_0133301 Ga0373925_0133301_1153_1665 170
330 3300037418 Ga0395900_0005446 Ga0395900_0005446_3384_3896 170
331 3300037466 Ga0395898_0027897 Ga0395898_0027897_3056_3568 170
332 3300037471 Ga0395905_0155779 Ga0395905_0155779_827_1339 170
333 3300037853 Ga0436364_0842905 Ga0436364_0842905_799_1311 170
334 3300037853 Ga0436364_1290935 Ga0436364_1290935_150_662 170
335 3300038443 Ga0395901_0243888 Ga0395901_0243888_1007_1519 170
336 3300039437 Ga0436365_0005537 Ga0436365_0005537_3243_3755 170
337 3300039438 Ga0436360_0581218 Ga0436360_0581218_12_524 170
338 3300041452 Ga0451793_1242619 Ga0451793_1242619_142_654 170
339 3300041512 Ga0451853_3130839 Ga0451853_3130839_207_719 170
340 3300046455 Ga0495603_0002718 Ga0495603_0002718_5892_6470 170
341 3300046457 Ga0495590_0167088 Ga0495590_0167088_134_646 170
342 3300046459 Ga0495629_0000727 Ga0495629_0000727_4362_4940 170
343 3300046459 Ga0495629_0543880 Ga0495629_0543880_179_691 170
344 3300046459 Ga0495629_0739630 Ga0495629_0739630_116_628 170
345 3300046460 Ga0495638_0322226 Ga0495638_0322226_41_553 170
346 3300046461 Ga0495641_0004166 Ga0495641_0004166_5571_6149 170
347 3300046472 Ga0495580_0000246 Ga0495580_0000246_5541_6119 170
348 3300046473 Ga0495582_0000494 Ga0495582_0000494_14018_14596 170
349 3300046473 Ga0495582_0077162 Ga0495582_0077162_1199_1711 170
350 3300046474 Ga0495605_0217053 Ga0495605_0217053_227_739 170
351 3300046475 Ga0495639_0000119 Ga0495639_0000119_17334_17912 170
352 3300046475 Ga0495639_0319549 Ga0495639_0319549_46_597 170
353 3300046476 Ga0495662_0001142 Ga0495662_0001142_1332_1910 170
354 3300046477 Ga0495664_0025257 Ga0495664_0025257_946_1524 170
355 3300046499 Ga0495594_0004003 Ga0495594_0004003_4986_5564 170
356 3300046516 Ga0495628_0017937 Ga0495628_0017937_1458_2036 170
357 3300046517 Ga0495630_0523216 Ga0495630_0523216_130_708 170
358 3300046517 Ga0495630_0674105 Ga0495630_0674105_197_709 170
359 3300046519 Ga0495632_0198769 Ga0495632_0198769_218_730 170
360 3300046526 Ga0495666_0012738 Ga0495666_0012738_2773_3351 170
361 3300046529 Ga0495652_0032064 Ga0495652_0032064_3317_3895 170
362 3300046531 Ga0495665_0000251 Ga0495665_0000251_4364_4942 170
363 3300046533 Ga0495640_0014321 Ga0495640_0014321_487_1065 170
364 3300046542 Ga0495597_0278889 Ga0495597_0278889_13_525 170
365 3300046557 Ga0495622_0032065 Ga0495622_0032065_931_1509 170
366 3300046559 Ga0495667_0218418 Ga0495667_0218418_69_647 170
367 3300046615 Ga0495656_0465270 Ga0495656_0465270_39_551 170
368 3300046642 Ga0495634_0000886 Ga0495634_0000886_12870_13448 170
369 3300046663 Ga0495635_0001208 Ga0495635_0001208_12499_13077 170
370 3300046674 Ga0495588_0037029 Ga0495588_0037029_1146_1724 170
371 3300046674 Ga0495588_0108811 Ga0495588_0108811_800_1312 170
372 3300046675 Ga0495657_0198144 Ga0495657_0198144_517_1095 170
373 3300046678 Ga0495599_0211033 Ga0495599_0211033_72_650 170
374 3300046680 Ga0495646_0003823 Ga0495646_0003823_7567_8145 170
375 3300046681 Ga0495647_0000085 Ga0495647_0000085_5256_5834 170
376 3300046683 Ga0495658_0000135 Ga0495658_0000135_18527_19105 170
377 3300046690 Ga0495624_0000144 Ga0495624_0000144_30220_30798 170
378 3300046690 Ga0495624_0119526 Ga0495624_0119526_480_992 170
379 3300046809 Ga0495600_0238847 Ga0495600_0238847_121_699 170
380 3300047315 Ga0495581_0000421 Ga0495581_0000421_13891_14469 170
381 3300047315 Ga0495581_0427317 Ga0495581_0427317_83_595 170
382 3300047317 Ga0495604_0247268 Ga0495604_0247268_536_1114 170
383 3300047319 Ga0495674_0001274 Ga0495674_0001274_21864_22442 170
384 3300047321 Ga0495676_0007487 Ga0495676_0007487_837_1415 170
385 3300047321 Ga0495676_0207212 Ga0495676_0207212_211_723 170
386 3300047322 Ga0495680_0202615 Ga0495680_0202615_564_1142 170
387 3300047471 Ga0495684_0134276 Ga0495684_0134276_200_778 170
388 3300047673 Ga0495593_0000007 Ga0495593_0000007_21008_21586 170
389 3300048089 Ga0495614_0007215 Ga0495614_0007215_2636_3214 170
390 3300048903 Ga0496100_0114824 Ga0496100_0114824_1318_1830 170
391 3300048904 Ga0496101_0002295 Ga0496101_0002295_10667_11179 170
392 3300048905 Ga0496102_0003496 Ga0496102_0003496_3647_4159 170
393 3300048905 Ga0496102_0051167 Ga0496102_0051167_1956_2468 170
394 3300048906 Ga0496103_0005524 Ga0496103_0005524_6508_7020 170
395 3300048907 Ga0496104_0179338 Ga0496104_0179338_1327_1839 170
396 3300048908 Ga0496105_0012456 Ga0496105_0012456_5355_5867 170
397 3300048908 Ga0496105_0040580 Ga0496105_0040580_3302_3814 170
398 3300048908 Ga0496105_0094038 Ga0496105_0094038_28_540 170
399 3300048909 Ga0496106_0004144 Ga0496106_0004144_2105_2629 170
400 3300048909 Ga0496106_0076702 Ga0496106_0076702_1050_1562 170
401 3300048909 Ga0496106_1038362 Ga0496106_1038362_37_564 170
402 3300048910 Ga0496107_0007336 Ga0496107_0007336_6926_7438 170
403 3300048910 Ga0496107_0200679 Ga0496107_0200679_842_1354 170
404 3300048911 Ga0496108_0009442 Ga0496108_0009442_493_1005 170
405 3300048911 Ga0496108_0012940 Ga0496108_0012940_1899_2423 170
406 3300048912 Ga0496109_0003252 Ga0496109_0003252_10142_10666 170
407 3300048912 Ga0496109_0033178 Ga0496109_0033178_217_729 170
408 3300048912 Ga0496109_0118817 Ga0496109_0118817_115_627 170
409 3300048913 Ga0496110_0007869 Ga0496110_0007869_3136_3660 170
410 3300048913 Ga0496110_0011070 Ga0496110_0011070_1664_2176 170
411 3300048913 Ga0496110_0067035 Ga0496110_0067035_513_1025 170
412 3300048914 Ga0496111_0072677 Ga0496111_0072677_1937_2449 170
413 3300048914 Ga0496111_0094051 Ga0496111_0094051_806_1330 170
414 3300048914 Ga0496111_0114599 Ga0496111_0114599_1039_1551 170
415 3300048915 Ga0496112_0003481 Ga0496112_0003481_3125_3649 170
416 3300048915 Ga0496112_0014567 Ga0496112_0014567_2140_2652 170
417 3300048916 Ga0496113_0010612 Ga0496113_0010612_1294_1806 170
418 3300048916 Ga0496113_0013241 Ga0496113_0013241_182_706 170
419 3300048916 Ga0496113_0045387 Ga0496113_0045387_1335_1847 170
420 3300048917 Ga0496114_0281834 Ga0496114_0281834_547_1059 170
421 3300048918 Ga0496115_0067108 Ga0496115_0067108_1319_1831 170
422 3300048918 Ga0496115_0171375 Ga0496115_0171375_327_851 170
423 3300048918 Ga0496115_0279350 Ga0496115_0279350_478_990 170
424 3300048918 Ga0496115_0940651 Ga0496115_0940651_37_549 170
425 3300048924 Ga0496121_0152242 Ga0496121_0152242_1116_1628 170
426 3300048927 Ga0496124_0182051 Ga0496124_0182051_743_1255 170
427 3300048928 Ga0496125_0615532 Ga0496125_0615532_10_537 170
428 3300048929 Ga0496126_0410754 Ga0496126_0410754_156_887 170
429 3300050490 nmdc:mga03n38_270632_c1 nmdc:mga03n38_270632_c1_85_597 170
430 3300050492 nmdc:mga0yw44_163726_c1 nmdc:mga0yw44_163726_c1_56_568 170
431 3300050494 nmdc:mga06z11_504044_c1 nmdc:mga06z11_504044_c1_191_703 170
432 3300053077 Ga0495601_0111850 Ga0495601_0111850_1206_1718 170
433 3300053077 Ga0495601_0181981 Ga0495601_0181981_123_635 170
434 3300053083 Ga0495655_0037605 Ga0495655_0037605_477_989 170
435 3300053085 Ga0495619_0275360 Ga0495619_0275360_602_1114 170
436 3300053094 Ga0500566_0008515 Ga0500566_0008515_246_773 170
437 3300053119 Ga0500595_024041 Ga0500595_024041_1517_2044 170
438 3300053122 Ga0500608_008620 Ga0500608_008620_2512_3024 170
439 3300053136 Ga0500559_0000244 Ga0500559_0000244_38132_38656 170
440 3300053150 Ga0500603_036500 Ga0500603_036500_140_667 170
441 3300053162 Ga0500638_005746 Ga0500638_005746_764_1291 170
442 3300053163 Ga0500639_010041 Ga0500639_010041_3755_4279 170
443 3300053177 Ga0500636_0182396 Ga0500636_0182396_493_1017 170
444 3300055283 Ga0500661_001701 Ga0500661_001701_2564_3091 170
445 3300003659 JGI25404J52841_10006540 JGI25404J52841_100065402 171
446 3300005329 Ga0070683_100117757 Ga0070683_1001177573 171
447 3300005435 Ga0070714_100985552 Ga0070714_1009855521 171
448 3300005436 Ga0070713_101011778 Ga0070713_1010117782 171
449 3300005439 Ga0070711_100087568 Ga0070711_1000875681 171
450 3300005458 Ga0070681_10059978 Ga0070681_100599782 171
451 3300005458 Ga0070681_10110277 Ga0070681_101102772 171
452 3300005530 Ga0070679_100237787 Ga0070679_1002377872 171
453 3300005535 Ga0070684_100026464 Ga0070684_1000264642 171
454 3300005577 Ga0068857_100015885 Ga0068857_1000158854 171
455 3300005577 Ga0068857_100620809 Ga0068857_1006208092 171
456 3300005616 Ga0068852_100298753 Ga0068852_1002987531 171
457 3300005937 Ga0081455_10036290 Ga0081455_100362904 171
458 3300005983 Ga0081540_1006380 Ga0081540_10063804 171
459 3300006173 Ga0070716_100427153 Ga0070716_1004271532 171
460 3300009093 Ga0105240_10271507 Ga0105240_102715073 171
461 3300009174 Ga0105241_10938026 Ga0105241_109380261 171
462 3300010375 Ga0105239_10871800 Ga0105239_108718002 171
463 3300010375 Ga0105239_11653313 Ga0105239_116533131 171
464 3300013104 Ga0157370_10847209 Ga0157370_108472091 171
465 3300013105 Ga0157369_10767653 Ga0157369_107676532 171
466 3300014497 Ga0182008_10137409 Ga0182008_101374092 171
467 3300021320 Ga0214544_1000016 Ga0214544_1000016120 171
468 3300021321 Ga0214542_1000016 Ga0214542_100001682 171
469 3300021324 Ga0214545_1000008 Ga0214545_100000888 171
470 3300021327 Ga0214543_1000043 Ga0214543_100004338 171
471 3300021384 Ga0213876_10133952 Ga0213876_101339522 171
472 3300025906 Ga0207699_10673462 Ga0207699_106734621 171
473 3300025912 Ga0207707_10001318 Ga0207707_1000131821 171
474 3300025913 Ga0207695_10502936 Ga0207695_105029362 171
475 3300025916 Ga0207663_10170237 Ga0207663_101702371 171
476 3300025917 Ga0207660_10026100 Ga0207660_100261003 171
477 3300025921 Ga0207652_10199492 Ga0207652_101994922 171
478 3300025929 Ga0207664_10367938 Ga0207664_103679381 171
479 3300025929 Ga0207664_10628266 Ga0207664_106282662 171
480 3300025944 Ga0207661_10007310 Ga0207661_100073104 171
481 3300026116 Ga0207674_10047136 Ga0207674_100471364 171
482 3300031616 Ga0307508_10218291 Ga0307508_102182912 171
483 3300035086 Ga0373934_0167492 Ga0373934_0167492_98_613 171
484 3300035111 Ga0373923_0015288 Ga0373923_0015288_1925_2440 171
485 3300035113 Ga0373936_0122131 Ga0373936_0122131_301_816 171
486 3300035116 Ga0373945_0343015 Ga0373945_0343015_20_535 171
487 3300035172 Ga0373955_0198651 Ga0373955_0198651_173_688 171
488 3300035692 Ga0373935_0022952 Ga0373935_0022952_3282_3797 171
489 3300035724 Ga0373933_0203226 Ga0373933_0203226_302_817 171
490 3300035725 Ga0373947_0107828 Ga0373947_0107828_1144_1659 171
491 3300039437 Ga0436365_0719884 Ga0436365_0719884_575_1099 171
492 3300039447 Ga0436361_0406703 Ga0436361_0406703_53_568 171
493 3300044656 Ga0466969_0101819 Ga0466969_0101819_791_1306 171
494 3300044658 Ga0466972_0000107 Ga0466972_0000107_33220_33735 171
495 3300044658 Ga0466972_0037535 Ga0466972_0037535_1703_2218 171
496 3300044683 Ga0466965_0069700 Ga0466965_0069700_711_1226 171
497 3300044684 Ga0466966_0356384 Ga0466966_0356384_154_669 171
498 3300044693 Ga0466961_0197223 Ga0466961_0197223_508_1023 171
499 3300044719 Ga0466971_0114410 Ga0466971_0114410_36_551 171
500 3300044735 Ga0466968_0048898 Ga0466968_0048898_1030_1545 171
501 3300044735 Ga0466968_0139117 Ga0466968_0139117_309_824 171
502 3300044735 Ga0466968_0276529 Ga0466968_0276529_180_695 171
503 3300044765 Ga0466970_0032219 Ga0466970_0032219_166_681 171
504 3300044842 Ga0466957_0056717 Ga0466957_0056717_473_988 171
505 3300044901 Ga0466960_0012111 Ga0466960_0012111_2732_3247 171
506 3300045049 Ga0466959_0067109 Ga0466959_0067109_1736_2251 171
507 3300045976 Ga0466967_0030343 Ga0466967_0030343_3883_4398 171
508 3300046459 Ga0495629_0051911 Ga0495629_0051911_113_628 171
509 3300046472 Ga0495580_0012045 Ga0495580_0012045_457_972 171
510 3300046473 Ga0495582_0028272 Ga0495582_0028272_2194_2709 171
511 3300046475 Ga0495639_0006327 Ga0495639_0006327_69_584 171
512 3300046476 Ga0495662_0144246 Ga0495662_0144246_119_634 171
513 3300046477 Ga0495664_0049070 Ga0495664_0049070_578_1093 171
514 3300046477 Ga0495664_0106632 Ga0495664_0106632_464_979 171
515 3300046514 Ga0495618_0083133 Ga0495618_0083133_1282_1797 171
516 3300046517 Ga0495630_0111067 Ga0495630_0111067_198_713 171
517 3300046526 Ga0495666_0053467 Ga0495666_0053467_960_1475 171
518 3300046531 Ga0495665_0029705 Ga0495665_0029705_87_602 171
519 3300046533 Ga0495640_0205294 Ga0495640_0205294_82_597 171
520 3300046535 Ga0495586_0127261 Ga0495586_0127261_570_1085 171
521 3300046543 Ga0495645_0007915 Ga0495645_0007915_749_1264 171
522 3300046559 Ga0495667_0013822 Ga0495667_0013822_219_734 171
523 3300046642 Ga0495634_0088946 Ga0495634_0088946_397_912 171
524 3300046678 Ga0495599_0236690 Ga0495599_0236690_131_646 171
525 3300046681 Ga0495647_0058975 Ga0495647_0058975_829_1344 171
526 3300046689 Ga0495613_0529770 Ga0495613_0529770_109_624 171
527 3300047317 Ga0495604_0110337 Ga0495604_0110337_662_1177 171
528 3300047319 Ga0495674_0483917 Ga0495674_0483917_179_694 171
529 3300048905 Ga0496102_0922133 Ga0496102_0922133_12_527 171
530 3300048917 Ga0496114_0184123 Ga0496114_0184123_807_1562 171
531 3300048924 Ga0496121_0410993 Ga0496121_0410993_87_602 171
532 3300048929 Ga0496126_0064106 Ga0496126_0064106_259_780 171
533 3300050490 nmdc:mga03n38_89108_c1 nmdc:mga03n38_89108_c1_274_789 171
534 3300053077 Ga0495601_0225372 Ga0495601_0225372_282_797 171
535 3300053078 Ga0495612_0028993 Ga0495612_0028993_1544_2059 171
536 3300053085 Ga0495619_0603168 Ga0495619_0603168_152_667 171
537 3300061719 Ga0466962_0120391 Ga0466962_0120391_467_982 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

70

200

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mtz-assembly1.cif.gz_A haddock model of bacillus subtilis l,d-transpeptidase in complex with a peptidoglycan hexamuropeptide 0.874 41 168
4lzh-assembly1.cif.gz_A l,d-transpeptidase from klebsiella pneumoniae 0.8643 36 169
4a1i-assembly1.cif.gz_A ykud from b.subtilis 0.848 34 171
2hkl-assembly3.cif.gz_C crystal structure of enterococcus faecium l,d-transpeptidase c442s mutant 0.8171 38 170
6fj1-assembly2.cif.gz_B structure of the ldtfm-avibactam carbamoyl enzyme 0.8168 37 171
ID Description Score Start End Superfamily
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.9261 41 171 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8716 37 170 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8504 41 171 2.40.440.10
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.815 41 171 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.809 37 170 2.40.440.10

Feature Viewer

pLDDT pTM Quality
84.84 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map