F460850
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 536 | 299 | 531 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300049742|Ga0501080_0262376|Ga0501080_0262376_347_1039 |
| Length | 230 |
| Sequence | MARDIRAAFDDKLTKLRPGTPSALNYENYGPAPGGNMGWIILAIIVLLAFWVVGIYNGLVAARNGYKNAFAQIDVQLTRRHDLIPNLVETAKGYLAHERQTLEAVITARNAAVAGLKAAAANPGDPAAVQQLAGAENALSGALGRLFALAEAYPDLKANQNMMQLSEELTTTENKVAFARQAYNDSVMGYNNRREMFPGSIIANSFGFQPAQLLEIEAPEKRAVPQVSFT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 2 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 3 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 4 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 5 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 6 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 148 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 149 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 150 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 157 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 158 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 171 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 176 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 184 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 185 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 186 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 191 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 192 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 193 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 194 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 195 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 196 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 197 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 198 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 199 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 200 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 201 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 202 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 203 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 204 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 205 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 206 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 209 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 210 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 211 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 244 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 245 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 246 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 273 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 292 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 293 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 295 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 296 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 297 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0 |
| Isolates | 0.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.87 |
| Nodule | 0 |
| Rhizoplane | 1.87 |
| Rhizosphere | 93.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000896 | 3300000545 | Bacteria | 1952 |
| 2 | rootH1_10110933 | 3300003323 | Bacteria | 10572 |
| 3 | Ga0055536_1006922 | 3300003781 | Bacteria | 5168 |
| 4 | Ga0065703_1020324 | 3300005272 | Bacteria | 1870 |
| 5 | Ga0065704_10394947 | 3300005289 | Bacteria | 758 |
| 6 | Ga0065712_10136839 | 3300005290 | Bacteria | 1489 |
| 7 | Ga0065712_10273480 | 3300005290 | Bacteria | 911 |
| 8 | Ga0065712_10289752 | 3300005290 | Bacteria | 879 |
| 9 | Ga0065715_10009448 | 3300005293 | Bacteria | 2827 |
| 10 | Ga0065715_10306465 | 3300005293 | Bacteria | 1023 |
| 11 | Ga0065707_10082271 | 3300005295 | Bacteria | 17800 |
| 12 | Ga0065707_10171255 | 3300005295 | Bacteria | 1483 |
| 13 | Ga0065707_10418652 | 3300005295 | Bacteria | 833 |
| 14 | Ga0070676_10138923 | 3300005328 | Bacteria | 1544 |
| 15 | Ga0070683_100544441 | 3300005329 | Bacteria | 1110 |
| 16 | Ga0070670_100039018 | 3300005331 | Bacteria | 4083 |
| 17 | Ga0070670_100209720 | 3300005331 | Bacteria | 1694 |
| 18 | Ga0070670_100357782 | 3300005331 | Bacteria | 1283 |
| 19 | Ga0068869_100006863 | 3300005334 | Bacteria | 7243 |
| 20 | Ga0068869_100264454 | 3300005334 | Bacteria | 1378 |
| 21 | Ga0068869_100384888 | 3300005334 | Bacteria | 1150 |
| 22 | Ga0068869_100414881 | 3300005334 | Bacteria | 1110 |
| 23 | Ga0070666_10018125 | 3300005335 | Bacteria | 4522 |
| 24 | Ga0070666_10027094 | 3300005335 | Bacteria | 3750 |
| 25 | Ga0068868_100283071 | 3300005338 | Bacteria | 1404 |
| 26 | Ga0070689_100001792 | 3300005340 | Bacteria | 13798 |
| 27 | Ga0070689_100107373 | 3300005340 | Bacteria | 2216 |
| 28 | Ga0070689_100250835 | 3300005340 | Bacteria | 1460 |
| 29 | Ga0070661_100002783 | 3300005344 | Bacteria | 12003 |
| 30 | Ga0070661_100124199 | 3300005344 | Bacteria | 1935 |
| 31 | Ga0070668_100064144 | 3300005347 | Bacteria | 2848 |
| 32 | Ga0070669_100011681 | 3300005353 | Bacteria | 6231 |
| 33 | Ga0070669_100125601 | 3300005353 | Bacteria | 1963 |
| 34 | Ga0070669_100347328 | 3300005353 | Bacteria | 1203 |
| 35 | Ga0070675_100007428 | 3300005354 | Bacteria | 8467 |
| 36 | Ga0070675_100017621 | 3300005354 | Bacteria | 5678 |
| 37 | Ga0070675_100098781 | 3300005354 | Bacteria | 2456 |
| 38 | Ga0070671_100083307 | 3300005355 | Bacteria | 2674 |
| 39 | Ga0070674_100016829 | 3300005356 | Bacteria | 4587 |
| 40 | Ga0070674_100439234 | 3300005356 | Bacteria | 1075 |
| 41 | Ga0070673_100015582 | 3300005364 | Bacteria | 5346 |
| 42 | Ga0070673_100018116 | 3300005364 | Bacteria | 5026 |
| 43 | Ga0070688_100022568 | 3300005365 | Bacteria | 3691 |
| 44 | Ga0070688_100068588 | 3300005365 | Bacteria | 2261 |
| 45 | Ga0070667_100021949 | 3300005367 | Bacteria | 5298 |
| 46 | Ga0070701_10036150 | 3300005438 | Bacteria | 2487 |
| 47 | Ga0070701_10044840 | 3300005438 | Bacteria | 2267 |
| 48 | Ga0070701_10423798 | 3300005438 | Bacteria | 848 |
| 49 | Ga0070711_100569297 | 3300005439 | Bacteria | 942 |
| 50 | Ga0070705_100030509 | 3300005440 | Bacteria | 2977 |
| 51 | Ga0070705_100079135 | 3300005440 | Bacteria | 2013 |
| 52 | Ga0070700_100012796 | 3300005441 | Bacteria | 4698 |
| 53 | Ga0070694_100268031 | 3300005444 | Bacteria | 1297 |
| 54 | Ga0070678_100021459 | 3300005456 | Bacteria | 4259 |
| 55 | Ga0070662_100071818 | 3300005457 | Bacteria | 2553 |
| 56 | Ga0070662_100186994 | 3300005457 | Bacteria | 1635 |
| 57 | Ga0068867_100158438 | 3300005459 | Bacteria | 1783 |
| 58 | Ga0070685_10032672 | 3300005466 | Bacteria | 2916 |
| 59 | Ga0070685_10083055 | 3300005466 | Bacteria | 1924 |
| 60 | Ga0070684_100000531 | 3300005535 | Bacteria | 26141 |
| 61 | Ga0070684_100254401 | 3300005535 | Bacteria | 1605 |
| 62 | Ga0068853_100234663 | 3300005539 | Bacteria | 1679 |
| 63 | Ga0068853_100595762 | 3300005539 | Bacteria | 1049 |
| 64 | Ga0070672_100004785 | 3300005543 | Bacteria | 8887 |
| 65 | Ga0070686_100006093 | 3300005544 | Bacteria | 6693 |
| 66 | Ga0070686_100094357 | 3300005544 | Bacteria | 2008 |
| 67 | Ga0070693_100012081 | 3300005547 | Bacteria | 4361 |
| 68 | Ga0070693_100052333 | 3300005547 | Bacteria | 2340 |
| 69 | Ga0070693_100635625 | 3300005547 | Bacteria | 774 |
| 70 | Ga0070665_100000027 | 3300005548 | Bacteria | 359314 |
| 71 | Ga0070665_100072319 | 3300005548 | Bacteria | 3456 |
| 72 | Ga0070665_100151162 | 3300005548 | Bacteria | 2325 |
| 73 | Ga0070704_100176046 | 3300005549 | Bacteria | 1706 |
| 74 | Ga0068855_100048995 | 3300005563 | Bacteria | 4985 |
| 75 | Ga0070664_100018384 | 3300005564 | Bacteria | 5740 |
| 76 | Ga0070664_100066450 | 3300005564 | Bacteria | 3079 |
| 77 | Ga0068857_100011136 | 3300005577 | Bacteria | 7821 |
| 78 | Ga0068857_100021793 | 3300005577 | Bacteria | 5639 |
| 79 | Ga0068857_100062154 | 3300005577 | Bacteria | 3319 |
| 80 | Ga0068857_100072598 | 3300005577 | Bacteria | 3067 |
| 81 | Ga0068857_100486181 | 3300005577 | Bacteria | 1157 |
| 82 | Ga0070702_100002848 | 3300005615 | Bacteria | 7589 |
| 83 | Ga0068852_100160752 | 3300005616 | Bacteria | 2097 |
| 84 | Ga0068852_100983886 | 3300005616 | Bacteria | 862 |
| 85 | Ga0068859_100043672 | 3300005617 | Bacteria | 4505 |
| 86 | Ga0068859_100251242 | 3300005617 | Bacteria | 1859 |
| 87 | Ga0068859_100251821 | 3300005617 | Bacteria | 1857 |
| 88 | Ga0068859_100341516 | 3300005617 | Bacteria | 1591 |
| 89 | Ga0068864_100017826 | 3300005618 | Bacteria | 5923 |
| 90 | Ga0068864_100104950 | 3300005618 | Bacteria | 2511 |
| 91 | Ga0068864_100207660 | 3300005618 | Bacteria | 1802 |
| 92 | Ga0068861_100003131 | 3300005719 | Bacteria | 10931 |
| 93 | Ga0068861_100554413 | 3300005719 | Bacteria | 1048 |
| 94 | Ga0068861_101210417 | 3300005719 | Bacteria | 731 |
| 95 | Ga0068851_10007768 | 3300005834 | Bacteria | 4933 |
| 96 | Ga0068870_10003262 | 3300005840 | Bacteria | 6848 |
| 97 | Ga0068863_100002472 | 3300005841 | Bacteria | 18369 |
| 98 | Ga0068863_100038589 | 3300005841 | Bacteria | 4543 |
| 99 | Ga0068863_100068076 | 3300005841 | Bacteria | 3368 |
| 100 | Ga0068863_100308966 | 3300005841 | Bacteria | 1534 |
| 101 | Ga0068858_100001790 | 3300005842 | Bacteria | 21918 |
| 102 | Ga0068858_100059794 | 3300005842 | Bacteria | 3522 |
| 103 | Ga0068858_100123255 | 3300005842 | Bacteria | 2425 |
| 104 | Ga0068858_100140539 | 3300005842 | Bacteria | 2266 |
| 105 | Ga0068860_100078868 | 3300005843 | Bacteria | 3131 |
| 106 | Ga0068860_100191059 | 3300005843 | Bacteria | 1982 |
| 107 | Ga0068860_100356511 | 3300005843 | Bacteria | 1440 |
| 108 | Ga0068862_100000444 | 3300005844 | Bacteria | 45032 |
| 109 | Ga0068862_100003520 | 3300005844 | Bacteria | 13441 |
| 110 | Ga0081538_10102868 | 3300005981 | Bacteria | 1431 |
| 111 | Ga0081540_1008676 | 3300005983 | Bacteria | 7079 |
| 112 | Ga0070712_100199407 | 3300006175 | Unclassified | 1571 |
| 113 | Ga0097621_100012148 | 3300006237 | Bacteria | 6373 |
| 114 | Ga0068871_100046908 | 3300006358 | Bacteria | 3482 |
| 115 | Ga0075428_100010387 | 3300006844 | Bacteria | 10338 |
| 116 | Ga0075428_100047780 | 3300006844 | Bacteria | 4699 |
| 117 | Ga0075428_100504718 | 3300006844 | Bacteria | 1294 |
| 118 | Ga0075428_100575528 | 3300006844 | Bacteria | 1203 |
| 119 | Ga0075430_100002675 | 3300006846 | Bacteria | 14877 |
| 120 | Ga0075430_100037006 | 3300006846 | Bacteria | 4137 |
| 121 | Ga0075430_100334171 | 3300006846 | Bacteria | 1252 |
| 122 | Ga0075431_100036273 | 3300006847 | Bacteria | 5078 |
| 123 | Ga0075431_100236133 | 3300006847 | Bacteria | 1861 |
| 124 | Ga0075431_100478361 | 3300006847 | Bacteria | 1238 |
| 125 | Ga0075433_10782701 | 3300006852 | Bacteria | 834 |
| 126 | Ga0075429_100001256 | 3300006880 | Bacteria | 20623 |
| 127 | Ga0075429_100713182 | 3300006880 | Bacteria | 878 |
| 128 | Ga0068865_100031524 | 3300006881 | Bacteria | 3535 |
| 129 | Ga0068865_100201948 | 3300006881 | Bacteria | 1544 |
| 130 | Ga0068865_100225392 | 3300006881 | Bacteria | 1467 |
| 131 | Ga0097620_100043673 | 3300006931 | Bacteria | 4505 |
| 132 | Ga0097620_100251228 | 3300006931 | Bacteria | 1859 |
| 133 | Ga0097620_100251805 | 3300006931 | Bacteria | 1857 |
| 134 | Ga0097620_100341492 | 3300006931 | Bacteria | 1591 |
| 135 | Ga0075435_100208825 | 3300007076 | Bacteria | 1656 |
| 136 | Ga0099795_10065721 | 3300007788 | Bacteria | 1357 |
| 137 | Ga0105250_10049752 | 3300009092 | Bacteria | 1681 |
| 138 | Ga0105240_10008614 | 3300009093 | Bacteria | 14574 |
| 139 | Ga0111539_10015981 | 3300009094 | Bacteria | 9322 |
| 140 | Ga0111539_10057872 | 3300009094 | Bacteria | 4601 |
| 141 | Ga0111539_10149624 | 3300009094 | Bacteria | 2733 |
| 142 | Ga0105245_10849780 | 3300009098 | Bacteria | 953 |
| 143 | Ga0105247_10218752 | 3300009101 | Bacteria | 1288 |
| 144 | Ga0114129_10001392 | 3300009147 | Bacteria | 32566 |
| 145 | Ga0114129_10947552 | 3300009147 | Bacteria | 1088 |
| 146 | Ga0105248_10016715 | 3300009177 | Bacteria | 8078 |
| 147 | Ga0105248_10105783 | 3300009177 | Bacteria | 3173 |
| 148 | Ga0105248_10238337 | 3300009177 | Bacteria | 2048 |
| 149 | Ga0105237_10192220 | 3300009545 | Bacteria | 2041 |
| 150 | Ga0105238_10193221 | 3300009551 | Unclassified | 2011 |
| 151 | Ga0105249_10007299 | 3300009553 | Bacteria | 9637 |
| 152 | Ga0105249_10288331 | 3300009553 | Bacteria | 1642 |
| 153 | Ga0105032_101247 | 3300009979 | Bacteria | 2344 |
| 154 | Ga0105239_10363539 | 3300010375 | Bacteria | 1635 |
| 155 | Ga0105246_10219023 | 3300011119 | Bacteria | 1491 |
| 156 | Ga0105246_10657674 | 3300011119 | Bacteria | 913 |
| 157 | Ga0157370_10827318 | 3300013104 | Bacteria | 842 |
| 158 | Ga0157369_10140751 | 3300013105 | Bacteria | 2553 |
| 159 | Ga0157374_10011274 | 3300013296 | Bacteria | 7733 |
| 160 | Ga0157374_10658585 | 3300013296 | Bacteria | 1059 |
| 161 | Ga0157378_10005865 | 3300013297 | Bacteria | 10759 |
| 162 | Ga0157378_10038247 | 3300013297 | Bacteria | 4251 |
| 163 | Ga0157378_10385066 | 3300013297 | Bacteria | 1378 |
| 164 | Ga0163162_10099243 | 3300013306 | Bacteria | 3002 |
| 165 | Ga0157375_10079768 | 3300013308 | Bacteria | 3310 |
| 166 | Ga0157375_10321868 | 3300013308 | Bacteria | 1711 |
| 167 | Ga0163163_10008519 | 3300014325 | Bacteria | 9115 |
| 168 | Ga0157380_10002817 | 3300014326 | Bacteria | 11824 |
| 169 | Ga0157380_10005312 | 3300014326 | Bacteria | 9000 |
| 170 | Ga0157380_10012525 | 3300014326 | Bacteria | 6155 |
| 171 | Ga0157380_10020050 | 3300014326 | Bacteria | 4992 |
| 172 | Ga0157380_10166649 | 3300014326 | Bacteria | 1921 |
| 173 | Ga0157380_10199208 | 3300014326 | Bacteria | 1775 |
| 174 | Ga0157380_10588166 | 3300014326 | Bacteria | 1099 |
| 175 | Ga0182008_10244070 | 3300014497 | Bacteria | 925 |
| 176 | Ga0157377_10016970 | 3300014745 | Bacteria | 3757 |
| 177 | Ga0157377_10052248 | 3300014745 | Bacteria | 2307 |
| 178 | Ga0157376_10176347 | 3300014969 | Bacteria | 1950 |
| 179 | Ga0157376_10230563 | 3300014969 | Bacteria | 1720 |
| 180 | Ga0157376_10285127 | 3300014969 | Bacteria | 1557 |
| 181 | Ga0182006_1062273 | 3300015261 | Bacteria | 1404 |
| 182 | Ga0163161_10124807 | 3300017792 | Bacteria | 1937 |
| 183 | Ga0163161_10592947 | 3300017792 | Bacteria | 913 |
| 184 | Ga0209676_1000129 | 3300025292 | Bacteria | 187495 |
| 185 | Ga0207696_1107559 | 3300025711 | Bacteria | 757 |
| 186 | Ga0207688_10006633 | 3300025901 | Bacteria | 6296 |
| 187 | Ga0207688_10307109 | 3300025901 | Bacteria | 971 |
| 188 | Ga0207680_10046347 | 3300025903 | Bacteria | 2569 |
| 189 | Ga0207645_10100511 | 3300025907 | Bacteria | 1866 |
| 190 | Ga0207643_10011994 | 3300025908 | Bacteria | 4679 |
| 191 | Ga0207643_10292710 | 3300025908 | Bacteria | 1012 |
| 192 | Ga0207695_10057608 | 3300025913 | Bacteria | 4036 |
| 193 | Ga0207663_10343489 | 3300025916 | Bacteria | 1128 |
| 194 | Ga0207662_10015882 | 3300025918 | Bacteria | 4242 |
| 195 | Ga0207657_10593766 | 3300025919 | Bacteria | 864 |
| 196 | Ga0207649_10116123 | 3300025920 | Bacteria | 1797 |
| 197 | Ga0207681_10133617 | 3300025923 | Bacteria | 1838 |
| 198 | Ga0207681_10604479 | 3300025923 | Bacteria | 906 |
| 199 | Ga0207650_10130841 | 3300025925 | Bacteria | 1963 |
| 200 | Ga0207650_10168276 | 3300025925 | Bacteria | 1740 |
| 201 | Ga0207650_10347220 | 3300025925 | Bacteria | 1220 |
| 202 | Ga0207659_10021152 | 3300025926 | Bacteria | 4314 |
| 203 | Ga0207659_10392508 | 3300025926 | Bacteria | 1159 |
| 204 | Ga0207687_10505703 | 3300025927 | Bacteria | 1009 |
| 205 | Ga0207644_10048650 | 3300025931 | Bacteria | 3033 |
| 206 | Ga0207644_10057830 | 3300025931 | Bacteria | 2801 |
| 207 | Ga0207706_10023512 | 3300025933 | Bacteria | 5534 |
| 208 | Ga0207709_10179586 | 3300025935 | Bacteria | 1493 |
| 209 | Ga0207670_10009960 | 3300025936 | Bacteria | 5449 |
| 210 | Ga0207670_10156271 | 3300025936 | Bacteria | 1698 |
| 211 | Ga0207669_10094141 | 3300025937 | Bacteria | 1959 |
| 212 | Ga0207704_10027813 | 3300025938 | Bacteria | 3127 |
| 213 | Ga0207704_10042952 | 3300025938 | Bacteria | 2665 |
| 214 | Ga0207704_10490692 | 3300025938 | Bacteria | 988 |
| 215 | Ga0207691_10001891 | 3300025940 | Bacteria | 20461 |
| 216 | Ga0207711_10056088 | 3300025941 | Bacteria | 3384 |
| 217 | Ga0207689_10004017 | 3300025942 | Bacteria | 13373 |
| 218 | Ga0207689_10213254 | 3300025942 | Bacteria | 1595 |
| 219 | Ga0207689_10461935 | 3300025942 | Bacteria | 1062 |
| 220 | Ga0207661_10289099 | 3300025944 | Bacteria | 1467 |
| 221 | Ga0207661_10601375 | 3300025944 | Bacteria | 1009 |
| 222 | Ga0207679_10018032 | 3300025945 | Bacteria | 4720 |
| 223 | Ga0207667_10416429 | 3300025949 | Bacteria | 1367 |
| 224 | Ga0207651_10112263 | 3300025960 | Bacteria | 2048 |
| 225 | Ga0207651_10133688 | 3300025960 | Bacteria | 1904 |
| 226 | Ga0207651_11316976 | 3300025960 | Bacteria | 649 |
| 227 | Ga0207712_10861898 | 3300025961 | Bacteria | 799 |
| 228 | Ga0207668_10100371 | 3300025972 | Bacteria | 2149 |
| 229 | Ga0207668_10440793 | 3300025972 | Bacteria | 1109 |
| 230 | Ga0207640_10209841 | 3300025981 | Bacteria | 1483 |
| 231 | Ga0207703_10001370 | 3300026035 | Bacteria | 22258 |
| 232 | Ga0207703_10059730 | 3300026035 | Bacteria | 3115 |
| 233 | Ga0207703_10069493 | 3300026035 | Bacteria | 2905 |
| 234 | Ga0207703_10080890 | 3300026035 | Bacteria | 2707 |
| 235 | Ga0207639_10222426 | 3300026041 | Bacteria | 1631 |
| 236 | Ga0207708_10081957 | 3300026075 | Bacteria | 2480 |
| 237 | Ga0207708_10099199 | 3300026075 | Bacteria | 2252 |
| 238 | Ga0207641_10011688 | 3300026088 | Bacteria | 7208 |
| 239 | Ga0207641_10013092 | 3300026088 | Bacteria | 6803 |
| 240 | Ga0207641_11229761 | 3300026088 | Bacteria | 749 |
| 241 | Ga0207648_10172604 | 3300026089 | Bacteria | 1912 |
| 242 | Ga0207648_10174108 | 3300026089 | Bacteria | 1903 |
| 243 | Ga0207676_10023142 | 3300026095 | Bacteria | 4579 |
| 244 | Ga0207676_10027715 | 3300026095 | Bacteria | 4222 |
| 245 | Ga0207674_10011119 | 3300026116 | Bacteria | 10122 |
| 246 | Ga0207674_10023693 | 3300026116 | Bacteria | 6571 |
| 247 | Ga0207674_10041032 | 3300026116 | Bacteria | 4788 |
| 248 | Ga0207674_10108197 | 3300026116 | Bacteria | 2757 |
| 249 | Ga0207675_100011449 | 3300026118 | Bacteria | 8297 |
| 250 | Ga0207675_100016093 | 3300026118 | Bacteria | 6985 |
| 251 | Ga0207675_100021963 | 3300026118 | Bacteria | 5942 |
| 252 | Ga0207675_100474460 | 3300026118 | Bacteria | 1242 |
| 253 | Ga0207675_101018989 | 3300026118 | Bacteria | 847 |
| 254 | Ga0207698_10085779 | 3300026142 | Bacteria | 2558 |
| 255 | Ga0207698_10625886 | 3300026142 | Bacteria | 1063 |
| 256 | Ga0207698_10954075 | 3300026142 | Bacteria | 867 |
| 257 | Ga0209967_1002913 | 3300027364 | Bacteria | 2238 |
| 258 | Ga0209998_10019498 | 3300027717 | Bacteria | 1446 |
| 259 | Ga0207428_10045555 | 3300027907 | Bacteria | 3532 |
| 260 | Ga0207428_10115937 | 3300027907 | Bacteria | 2058 |
| 261 | Ga0207428_10192210 | 3300027907 | Bacteria | 1538 |
| 262 | Ga0268266_10000050 | 3300028379 | Bacteria | 302778 |
| 263 | Ga0268266_10235644 | 3300028379 | Bacteria | 1687 |
| 264 | Ga0268265_10001895 | 3300028380 | Bacteria | 16631 |
| 265 | Ga0268265_10014776 | 3300028380 | Bacteria | 5328 |
| 266 | Ga0268265_10200333 | 3300028380 | Bacteria | 1731 |
| 267 | Ga0268264_10115062 | 3300028381 | Bacteria | 2362 |
| 268 | Ga0268264_10474033 | 3300028381 | Bacteria | 1216 |
| 269 | Ga0265323_10043849 | 3300028653 | Bacteria | 1613 |
| 270 | Ga0316177_1002664 | 3300030731 | Bacteria | 5660 |
| 271 | Ga0316176_1216601 | 3300030732 | Bacteria | 1577 |
| 272 | Ga0314311_1264832 | 3300030733 | Bacteria | 4502 |
| 273 | Ga0316178_1087300 | 3300030735 | Bacteria | 3824 |
| 274 | Ga0265331_10085008 | 3300031250 | Bacteria | 1466 |
| 275 | Ga0265316_10075444 | 3300031344 | Bacteria | 2593 |
| 276 | Ga0307513_10028087 | 3300031456 | Bacteria | 6442 |
| 277 | Ga0307408_100102451 | 3300031548 | Bacteria | 2183 |
| 278 | Ga0307408_100122670 | 3300031548 | Bacteria | 2015 |
| 279 | Ga0307408_100599632 | 3300031548 | Bacteria | 978 |
| 280 | Ga0265342_10273331 | 3300031712 | Bacteria | 896 |
| 281 | Ga0316576_10332534 | 3300031727 | Bacteria | 1132 |
| 282 | Ga0316578_10078161 | 3300031728 | Bacteria | 1966 |
| 283 | Ga0316578_10264161 | 3300031728 | Bacteria | 1032 |
| 284 | Ga0307516_10355145 | 3300031730 | Bacteria | 1131 |
| 285 | Ga0307405_10027065 | 3300031731 | Bacteria | 3319 |
| 286 | Ga0316577_10212770 | 3300031733 | Bacteria | 1093 |
| 287 | Ga0307413_10209326 | 3300031824 | Bacteria | 1415 |
| 288 | Ga0307413_10290049 | 3300031824 | Bacteria | 1235 |
| 289 | Ga0307413_10456953 | 3300031824 | Bacteria | 1015 |
| 290 | Ga0307410_10069758 | 3300031852 | Bacteria | 2432 |
| 291 | Ga0307410_10338108 | 3300031852 | Bacteria | 1199 |
| 292 | Ga0307406_10135844 | 3300031901 | Bacteria | 1733 |
| 293 | Ga0307412_10011233 | 3300031911 | Bacteria | 5180 |
| 294 | Ga0307412_10038038 | 3300031911 | Bacteria | 3095 |
| 295 | Ga0307412_10226865 | 3300031911 | Bacteria | 1436 |
| 296 | Ga0307412_10722473 | 3300031911 | Bacteria | 857 |
| 297 | Ga0307409_100464555 | 3300031995 | Bacteria | 1224 |
| 298 | Ga0307409_100974866 | 3300031995 | Bacteria | 865 |
| 299 | Ga0307416_100014743 | 3300032002 | Bacteria | 5371 |
| 300 | Ga0307416_100273925 | 3300032002 | Bacteria | 1659 |
| 301 | Ga0307414_10015964 | 3300032004 | Bacteria | 4550 |
| 302 | Ga0307414_10035256 | 3300032004 | Bacteria | 3328 |
| 303 | Ga0307414_10038249 | 3300032004 | Bacteria | 3220 |
| 304 | Ga0307414_10093162 | 3300032004 | Bacteria | 2245 |
| 305 | Ga0307414_10198944 | 3300032004 | Bacteria | 1628 |
| 306 | Ga0307414_10845751 | 3300032004 | Bacteria | 836 |
| 307 | Ga0307414_10966776 | 3300032004 | Bacteria | 783 |
| 308 | Ga0307411_10195196 | 3300032005 | Bacteria | 1549 |
| 309 | Ga0307411_10336845 | 3300032005 | Bacteria | 1224 |
| 310 | Ga0307411_10433175 | 3300032005 | Bacteria | 1095 |
| 311 | Ga0307415_100013848 | 3300032126 | Bacteria | 4721 |
| 312 | Ga0307415_100279803 | 3300032126 | Bacteria | 1371 |
| 313 | Ga0316583_10038946 | 3300032133 | Bacteria | 1684 |
| 314 | Ga0316583_10188631 | 3300032133 | Bacteria | 716 |
| 315 | Ga0373959_0035132 | 3300034820 | Bacteria | 1029 |
| 316 | Ga0373952_0048166 | 3300035092 | Bacteria | 1007 |
| 317 | Ga0373939_0096966 | 3300035114 | Bacteria | 1006 |
| 318 | Ga0373943_0645631 | 3300035170 | Bacteria | 625 |
| 319 | Ga0373962_0158119 | 3300035242 | Bacteria | 746 |
| 320 | Ga0316574_0006309 | 3300035398 | Bacteria | 6397 |
| 321 | Ga0373931_0053115 | 3300035691 | Bacteria | 2162 |
| 322 | Ga0373927_0170333 | 3300035695 | Bacteria | 1427 |
| 323 | Ga0373937_0205959 | 3300036401 | Bacteria | 1850 |
| 324 | Ga0316582_0183214 | 3300036647 | Bacteria | 1425 |
| 325 | Ga0316584_0103922 | 3300036712 | Bacteria | 2126 |
| 326 | Ga0316584_0266100 | 3300036712 | Unclassified | 1249 |
| 327 | Ga0316584_0505160 | 3300036712 | Bacteria | 849 |
| 328 | Ga0373925_0038332 | 3300037068 | Bacteria | 3543 |
| 329 | Ga0400483_237371 | 3300039062 | Bacteria | 7748 |
| 330 | Ga0439436_0091254 | 3300041404 | Bacteria | 848 |
| 331 | Ga0439439_0017147 | 3300041406 | Bacteria | 1778 |
| 332 | Ga0451789_1164836 | 3300041443 | Bacteria | 1308 |
| 333 | Ga0451791_1129320 | 3300041451 | Bacteria | 1079 |
| 334 | Ga0451802_0603233 | 3300041460 | Bacteria | 3355 |
| 335 | Ga0451804_0451569 | 3300041463 | Bacteria | 729 |
| 336 | Ga0451841_0074451 | 3300041498 | Bacteria | 1170 |
| 337 | Ga0451847_0627597 | 3300041503 | Bacteria | 1089 |
| 338 | Ga0451853_0279546 | 3300041512 | Bacteria | 1272 |
| 339 | Ga0439442_025557 | 3300042002 | Bacteria | 1228 |
| 340 | Ga0439432_011614 | 3300042006 | Bacteria | 3034 |
| 341 | Ga0439449_0053008 | 3300042007 | Bacteria | 1499 |
| 342 | Ga0439449_0070960 | 3300042007 | Bacteria | 1283 |
| 343 | Ga0439456_037407 | 3300042013 | Bacteria | 1048 |
| 344 | Ga0439462_0009379 | 3300042015 | Bacteria | 2475 |
| 345 | Ga0439462_0036341 | 3300042015 | Bacteria | 1311 |
| 346 | Ga0439463_068155 | 3300042016 | Bacteria | 911 |
| 347 | Ga0450920_001622 | 3300042122 | Bacteria | 3754 |
| 348 | Ga0450923_001052 | 3300042125 | Bacteria | 3474 |
| 349 | Ga0450923_002489 | 3300042125 | Bacteria | 2650 |
| 350 | Ga0450896_000353 | 3300042133 | Bacteria | 4489 |
| 351 | Ga0450896_030379 | 3300042133 | Bacteria | 816 |
| 352 | Ga0450898_007083 | 3300042134 | Bacteria | 1739 |
| 353 | Ga0450898_060096 | 3300042134 | Bacteria | 746 |
| 354 | Ga0450905_068236 | 3300042142 | Bacteria | 603 |
| 355 | Ga0450906_044703 | 3300042145 | Bacteria | 782 |
| 356 | Ga0450910_003052 | 3300042147 | Bacteria | 2209 |
| 357 | Ga0450910_008091 | 3300042147 | Bacteria | 1475 |
| 358 | Ga0439446_0000028 | 3300042156 | Bacteria | 24332 |
| 359 | Ga0439446_0000178 | 3300042156 | Bacteria | 11158 |
| 360 | Ga0439446_0129856 | 3300042156 | Bacteria | 816 |
| 361 | Ga0439434_0019384 | 3300042435 | Bacteria | 2040 |
| 362 | Ga0439435_0010341 | 3300042436 | Bacteria | 2212 |
| 363 | Ga0439435_0165185 | 3300042436 | Bacteria | 717 |
| 364 | Ga0439460_0013435 | 3300042461 | Bacteria | 2142 |
| 365 | Ga0450916_025270 | 3300042530 | Bacteria | 838 |
| 366 | Ga0450918_011032 | 3300042531 | Bacteria | 1575 |
| 367 | Ga0450918_030058 | 3300042531 | Bacteria | 959 |
| 368 | Ga0453684_0275236 | 3300044712 | Bacteria | 1922 |
| 369 | Ga0451576_0079582 | 3300045051 | Bacteria | 3410 |
| 370 | Ga0451576_0116465 | 3300045051 | Bacteria | 2782 |
| 371 | Ga0451576_0301636 | 3300045051 | Bacteria | 1676 |
| 372 | Ga0466967_0650601 | 3300045976 | Bacteria | 1042 |
| 373 | Ga0495638_0009520 | 3300046460 | Bacteria | 6812 |
| 374 | Ga0495582_0013572 | 3300046473 | Bacteria | 4485 |
| 375 | Ga0495582_0575952 | 3300046473 | Bacteria | 651 |
| 376 | Ga0495607_0005344 | 3300046501 | Bacteria | 9229 |
| 377 | Ga0495630_0109824 | 3300046517 | Bacteria | 2089 |
| 378 | Ga0495640_0269204 | 3300046533 | Bacteria | 1063 |
| 379 | Ga0495586_0031171 | 3300046535 | Bacteria | 2854 |
| 380 | Ga0495586_0106727 | 3300046535 | Bacteria | 1557 |
| 381 | Ga0495586_0333030 | 3300046535 | Bacteria | 871 |
| 382 | Ga0495621_0050098 | 3300046539 | Bacteria | 1492 |
| 383 | Ga0495668_0206632 | 3300046616 | Bacteria | 1075 |
| 384 | Ga0495625_0059514 | 3300046660 | Bacteria | 2710 |
| 385 | Ga0495657_0343904 | 3300046675 | Bacteria | 884 |
| 386 | Ga0495647_0285653 | 3300046681 | Bacteria | 741 |
| 387 | Ga0495647_0293188 | 3300046681 | Bacteria | 732 |
| 388 | Ga0495613_0074068 | 3300046689 | Bacteria | 2480 |
| 389 | Ga0495624_0346496 | 3300046690 | Bacteria | 894 |
| 390 | Ga0495670_0054740 | 3300046691 | Bacteria | 2000 |
| 391 | Ga0495581_0043620 | 3300047315 | Bacteria | 2594 |
| 392 | Ga0495680_0402936 | 3300047322 | Bacteria | 944 |
| 393 | Ga0495686_0004699 | 3300047472 | Bacteria | 11079 |
| 394 | Ga0495593_0215357 | 3300047673 | Bacteria | 964 |
| 395 | Ga0495614_0316435 | 3300048089 | Bacteria | 723 |
| 396 | Ga0496106_0178523 | 3300048909 | Bacteria | 1685 |
| 397 | Ga0496110_0821209 | 3300048913 | Bacteria | 834 |
| 398 | Ga0496111_0320202 | 3300048914 | Bacteria | 1149 |
| 399 | Ga0496112_0014495 | 3300048915 | Bacteria | 7319 |
| 400 | Ga0496113_0115687 | 3300048916 | Bacteria | 2092 |
| 401 | Ga0496114_0137874 | 3300048917 | Bacteria | 2110 |
| 402 | Ga0496118_0000513 | 3300048921 | Bacteria | 63612 |
| 403 | Ga0496121_0027777 | 3300048924 | Bacteria | 5286 |
| 404 | Ga0496126_0401838 | 3300048929 | Bacteria | 1111 |
| 405 | Ga0501299_015714 | 3300049522 | Bacteria | 1332 |
| 406 | Ga0501300_015709 | 3300049523 | Bacteria | 1106 |
| 407 | Ga0501301_012949 | 3300049524 | Bacteria | 716 |
| 408 | Ga0501031_0070658 | 3300049568 | Bacteria | 2274 |
| 409 | Ga0501031_0159332 | 3300049568 | Bacteria | 1475 |
| 410 | Ga0501032_0004329 | 3300049569 | Bacteria | 10718 |
| 411 | Ga0501032_0291802 | 3300049569 | Bacteria | 1055 |
| 412 | Ga0501033_0001368 | 3300049570 | Bacteria | 21745 |
| 413 | Ga0501033_0432315 | 3300049570 | Bacteria | 916 |
| 414 | Ga0501034_0111089 | 3300049571 | Bacteria | 2731 |
| 415 | Ga0501034_0631799 | 3300049571 | Bacteria | 974 |
| 416 | Ga0501036_0023698 | 3300049572 | Bacteria | 5172 |
| 417 | Ga0501036_0040738 | 3300049572 | Bacteria | 3929 |
| 418 | Ga0501037_0057893 | 3300049573 | Bacteria | 2828 |
| 419 | Ga0501037_0100106 | 3300049573 | Bacteria | 2093 |
| 420 | Ga0501038_0014042 | 3300049574 | Bacteria | 7298 |
| 421 | Ga0501038_0024783 | 3300049574 | Bacteria | 5348 |
| 422 | Ga0501038_0040077 | 3300049574 | Bacteria | 4094 |
| 423 | Ga0501039_0005001 | 3300049575 | Bacteria | 10063 |
| 424 | Ga0501039_0011236 | 3300049575 | Bacteria | 6823 |
| 425 | Ga0501039_0160469 | 3300049575 | Bacteria | 1767 |
| 426 | Ga0501039_0262503 | 3300049575 | Bacteria | 1357 |
| 427 | Ga0501039_0314916 | 3300049575 | Bacteria | 1230 |
| 428 | Ga0501040_0030186 | 3300049576 | Bacteria | 3661 |
| 429 | Ga0501040_0041347 | 3300049576 | Bacteria | 3140 |
| 430 | Ga0501040_0191613 | 3300049576 | Bacteria | 1451 |
| 431 | Ga0501041_0085229 | 3300049577 | Bacteria | 1948 |
| 432 | Ga0501041_0090484 | 3300049577 | Bacteria | 1889 |
| 433 | Ga0501041_0285174 | 3300049577 | Bacteria | 1039 |
| 434 | Ga0501042_0055657 | 3300049578 | Bacteria | 2823 |
| 435 | Ga0501042_0221103 | 3300049578 | Bacteria | 1366 |
| 436 | Ga0501042_0432022 | 3300049578 | Bacteria | 955 |
| 437 | Ga0501043_0030678 | 3300049579 | Bacteria | 4226 |
| 438 | Ga0501046_0002661 | 3300049580 | Bacteria | 16661 |
| 439 | Ga0501046_0056726 | 3300049580 | Bacteria | 3073 |
| 440 | Ga0501046_0225580 | 3300049580 | Bacteria | 1386 |
| 441 | Ga0501047_0019967 | 3300049581 | Bacteria | 6432 |
| 442 | Ga0501047_0581025 | 3300049581 | Bacteria | 943 |
| 443 | Ga0501048_0314350 | 3300049582 | Bacteria | 1115 |
| 444 | Ga0501067_0013431 | 3300049583 | Bacteria | 4536 |
| 445 | Ga0501067_0099241 | 3300049583 | Bacteria | 1617 |
| 446 | Ga0501067_0149359 | 3300049583 | Bacteria | 1302 |
| 447 | Ga0501068_0030886 | 3300049584 | Bacteria | 3180 |
| 448 | Ga0501069_0086002 | 3300049585 | Bacteria | 1775 |
| 449 | Ga0501070_0143110 | 3300049586 | Bacteria | 1974 |
| 450 | Ga0501070_0498123 | 3300049586 | Bacteria | 979 |
| 451 | Ga0501071_0008854 | 3300049587 | Bacteria | 6672 |
| 452 | Ga0501071_0057503 | 3300049587 | Bacteria | 2811 |
| 453 | Ga0501071_0126341 | 3300049587 | Bacteria | 1898 |
| 454 | Ga0501073_0008997 | 3300049589 | Bacteria | 7374 |
| 455 | Ga0501073_0017008 | 3300049589 | Bacteria | 5268 |
| 456 | Ga0501073_0077091 | 3300049589 | Bacteria | 2320 |
| 457 | Ga0501073_0083410 | 3300049589 | Bacteria | 2224 |
| 458 | Ga0501073_0485396 | 3300049589 | Bacteria | 854 |
| 459 | Ga0501074_0018685 | 3300049590 | Bacteria | 5037 |
| 460 | Ga0501074_0303745 | 3300049590 | Bacteria | 1133 |
| 461 | Ga0501075_0021462 | 3300049591 | Bacteria | 4708 |
| 462 | Ga0501075_0054327 | 3300049591 | Bacteria | 3013 |
| 463 | Ga0501075_0097123 | 3300049591 | Bacteria | 2235 |
| 464 | Ga0501076_0072658 | 3300049592 | Bacteria | 2753 |
| 465 | Ga0501076_0174020 | 3300049592 | Bacteria | 1755 |
| 466 | Ga0501076_0308004 | 3300049592 | Bacteria | 1299 |
| 467 | Ga0501076_0743929 | 3300049592 | Bacteria | 809 |
| 468 | Ga0501077_0026028 | 3300049593 | Bacteria | 3712 |
| 469 | Ga0501077_0383612 | 3300049593 | Bacteria | 898 |
| 470 | Ga0501208_002223 | 3300049655 | Bacteria | 1995 |
| 471 | Ga0501242_024419 | 3300049674 | Bacteria | 792 |
| 472 | Ga0501079_0047893 | 3300049741 | Bacteria | 3298 |
| 473 | Ga0501079_0168851 | 3300049741 | Bacteria | 1706 |
| 474 | Ga0501079_0192343 | 3300049741 | Bacteria | 1592 |
| 475 | Ga0501079_0203980 | 3300049741 | Bacteria | 1545 |
| 476 | Ga0501079_0249420 | 3300049741 | Bacteria | 1387 |
| 477 | Ga0501079_0903306 | 3300049741 | Bacteria | 695 |
| 478 | Ga0501080_0015415 | 3300049742 | Bacteria | 7045 |
| 479 | Ga0501080_0262376 | 3300049742 | Bacteria | 1573 |
| 480 | Ga0501080_0345853 | 3300049742 | Bacteria | 1343 |
| 481 | Ga0501081_0016037 | 3300049743 | Bacteria | 4947 |
| 482 | Ga0501081_0047391 | 3300049743 | Bacteria | 2957 |
| 483 | Ga0501081_0207569 | 3300049743 | Bacteria | 1422 |
| 484 | Ga0501083_0091115 | 3300049744 | Bacteria | 2013 |
| 485 | Ga0501279_018635 | 3300049775 | Bacteria | 979 |
| 486 | Ga0501035_0189243 | 3300049822 | Bacteria | 1770 |
| 487 | Ga0501035_0377028 | 3300049822 | Bacteria | 1183 |
| 488 | Ga0501035_0576269 | 3300049822 | Bacteria | 919 |
| 489 | Ga0501035_0721715 | 3300049822 | Bacteria | 802 |
| 490 | Ga0501044_0078127 | 3300049823 | Bacteria | 3354 |
| 491 | Ga0501044_0262160 | 3300049823 | Bacteria | 1666 |
| 492 | Ga0501044_1099859 | 3300049823 | Bacteria | 664 |
| 493 | Ga0501045_0059434 | 3300049824 | Bacteria | 2800 |
| 494 | Ga0501045_0094035 | 3300049824 | Bacteria | 2217 |
| 495 | nmdc:mga05p37_1259_c1 | 3300050507 | Bacteria | 29382 |
| 496 | nmdc:mga09592_132415_c1 | 3300050508 | Bacteria | 1807 |
| 497 | nmdc:mga09592_473564_c1 | 3300050508 | Bacteria | 1079 |
| 498 | nmdc:mga09592_960_c1 | 3300050508 | Bacteria | 22733 |
| 499 | nmdc:mga0qj67_121932_c1 | 3300050509 | Bacteria | 2109 |
| 500 | nmdc:mga0qj67_2202_c1 | 3300050509 | Bacteria | 13850 |
| 501 | nmdc:mga06r32_19902_c1 | 3300050510 | Bacteria | 6170 |
| 502 | nmdc:mga06r32_227796_c1 | 3300050510 | Bacteria | 1852 |
| 503 | nmdc:mga06r32_444957_c1 | 3300050510 | Bacteria | 1276 |
| 504 | nmdc:mga06r32_5694_c1 | 3300050510 | Bacteria | 11219 |
| 505 | nmdc:mga06r32_65685_c1 | 3300050510 | Bacteria | 3500 |
| 506 | nmdc:mga06r32_84738_c1 | 3300050510 | Bacteria | 3089 |
| 507 | nmdc:mga08y16_22982_c1 | 3300050511 | Bacteria | 6583 |
| 508 | nmdc:mga08y16_263181_c1 | 3300050511 | Bacteria | 1781 |
| 509 | nmdc:mga08y16_760276_c1 | 3300050511 | Bacteria | 965 |
| 510 | nmdc:mga08x19_1028867_c1 | 3300050514 | Bacteria | 585 |
| 511 | nmdc:mga0a205_667508_c1 | 3300050515 | Bacteria | 890 |
| 512 | Ga0500610_0001963 | 3300053079 | Bacteria | 7331 |
| 513 | Ga0500635_0151449 | 3300053080 | Bacteria | 885 |
| 514 | Ga0495619_0734420 | 3300053085 | Bacteria | 670 |
| 515 | Ga0500643_014094 | 3300053087 | Bacteria | 2793 |
| 516 | Ga0500555_000003 | 3300053103 | Bacteria | 392994 |
| 517 | Ga0500597_061536 | 3300053120 | Bacteria | 1613 |
| 518 | Ga0500559_0052981 | 3300053136 | Bacteria | 1795 |
| 519 | Ga0500573_0215508 | 3300053140 | Bacteria | 1010 |
| 520 | Ga0500616_0024825 | 3300053153 | Bacteria | 3327 |
| 521 | Ga0501084_0021439 | 3300054114 | Bacteria | 5384 |
| 522 | Ga0501084_0134894 | 3300054114 | Bacteria | 2078 |
| 523 | Ga0501084_0214325 | 3300054114 | Bacteria | 1624 |
| 524 | Ga0501082_0001130 | 3300060353 | Bacteria | 23635 |
| 525 | Ga0501082_0004506 | 3300060353 | Bacteria | 12168 |
| 526 | Ga0501082_0019334 | 3300060353 | Bacteria | 5870 |
| 527 | Ga0501082_0355618 | 3300060353 | Bacteria | 1277 |
| 528 | Ga0501082_0492805 | 3300060353 | Bacteria | 1071 |
| 529 | Ga0501082_0572194 | 3300060353 | Bacteria | 988 |
| 530 | Ga0530510_0057977 | 3300061734 | Bacteria | 2799 |
| 531 | Ga0530510_0286996 | 3300061734 | Bacteria | 1230 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032133 | Ga0316583_10038946 | Ga0316583_100389462 | 166 |
| 2 | 3300036647 | Ga0316582_0183214 | Ga0316582_0183214_538_1107 | 166 |
| 3 | 3300036712 | Ga0316584_0266100 | Ga0316584_0266100_434_994 | 167 |
| 4 | 3300031727 | Ga0316576_10332534 | Ga0316576_103325342 | 168 |
| 5 | 3300031728 | Ga0316578_10078161 | Ga0316578_100781612 | 168 |
| 6 | 3300031733 | Ga0316577_10212770 | Ga0316577_102127701 | 168 |
| 7 | 3300036712 | Ga0316584_0103922 | Ga0316584_0103922_49_615 | 168 |
| 8 | 3300049592 | Ga0501076_0743929 | Ga0501076_0743929_264_779 | 169 |
| 9 | 3300007788 | Ga0099795_10065721 | Ga0099795_100657213 | 179 |
| 10 | 3300035691 | Ga0373931_0053115 | Ga0373931_0053115_632_1189 | 179 |
| 11 | 3300036401 | Ga0373937_0205959 | Ga0373937_0205959_1146_1703 | 179 |
| 12 | 3300045051 | Ga0451576_0079582 | Ga0451576_0079582_1581_2138 | 179 |
| 13 | 3300036712 | Ga0316584_0505160 | Ga0316584_0505160_211_777 | 180 |
| 14 | 3300005290 | Ga0065712_10289752 | Ga0065712_102897522 | 181 |
| 15 | 3300005331 | Ga0070670_100357782 | Ga0070670_1003577822 | 181 |
| 16 | 3300005334 | Ga0068869_100264454 | Ga0068869_1002644542 | 181 |
| 17 | 3300005340 | Ga0070689_100250835 | Ga0070689_1002508352 | 181 |
| 18 | 3300005354 | Ga0070675_100098781 | Ga0070675_1000987812 | 181 |
| 19 | 3300005365 | Ga0070688_100068588 | Ga0070688_1000685882 | 181 |
| 20 | 3300005438 | Ga0070701_10036150 | Ga0070701_100361502 | 181 |
| 21 | 3300005459 | Ga0068867_100158438 | Ga0068867_1001584382 | 181 |
| 22 | 3300005466 | Ga0070685_10083055 | Ga0070685_100830553 | 181 |
| 23 | 3300005549 | Ga0070704_100176046 | Ga0070704_1001760463 | 181 |
| 24 | 3300005577 | Ga0068857_100021793 | Ga0068857_1000217933 | 181 |
| 25 | 3300005617 | Ga0068859_100251821 | Ga0068859_1002518212 | 181 |
| 26 | 3300005719 | Ga0068861_100554413 | Ga0068861_1005544132 | 181 |
| 27 | 3300006881 | Ga0068865_100225392 | Ga0068865_1002253922 | 181 |
| 28 | 3300006931 | Ga0097620_100251805 | Ga0097620_1002518052 | 181 |
| 29 | 3300007076 | Ga0075435_100208825 | Ga0075435_1002088253 | 181 |
| 30 | 3300013308 | Ga0157375_10321868 | Ga0157375_103218682 | 181 |
| 31 | 3300014326 | Ga0157380_10012525 | Ga0157380_100125254 | 181 |
| 32 | 3300014745 | Ga0157377_10052248 | Ga0157377_100522482 | 181 |
| 33 | 3300025908 | Ga0207643_10292710 | Ga0207643_102927102 | 181 |
| 34 | 3300025926 | Ga0207659_10392508 | Ga0207659_103925082 | 181 |
| 35 | 3300025936 | Ga0207670_10156271 | Ga0207670_101562712 | 181 |
| 36 | 3300025938 | Ga0207704_10490692 | Ga0207704_104906922 | 181 |
| 37 | 3300025942 | Ga0207689_10213254 | Ga0207689_102132542 | 181 |
| 38 | 3300026075 | Ga0207708_10099199 | Ga0207708_100991992 | 181 |
| 39 | 3300026088 | Ga0207641_11229761 | Ga0207641_112297611 | 181 |
| 40 | 3300026089 | Ga0207648_10174108 | Ga0207648_101741081 | 181 |
| 41 | 3300026116 | Ga0207674_10011119 | Ga0207674_100111195 | 181 |
| 42 | 3300026118 | Ga0207675_101018989 | Ga0207675_1010189892 | 181 |
| 43 | 3300035092 | Ga0373952_0048166 | Ga0373952_0048166_35_598 | 181 |
| 44 | 3300035695 | Ga0373927_0170333 | Ga0373927_0170333_566_1129 | 181 |
| 45 | 3300037068 | Ga0373925_0038332 | Ga0373925_0038332_869_1432 | 181 |
| 46 | 3300046473 | Ga0495582_0013572 | Ga0495582_0013572_1384_1947 | 181 |
| 47 | 3300046535 | Ga0495586_0106727 | Ga0495586_0106727_739_1302 | 181 |
| 48 | 3300046689 | Ga0495613_0074068 | Ga0495613_0074068_1743_2306 | 181 |
| 49 | 3300047315 | Ga0495581_0043620 | Ga0495581_0043620_74_637 | 181 |
| 50 | 3300047673 | Ga0495593_0215357 | Ga0495593_0215357_15_578 | 181 |
| 51 | 3300048089 | Ga0495614_0316435 | Ga0495614_0316435_123_686 | 181 |
| 52 | 3300014497 | Ga0182008_10244070 | Ga0182008_102440702 | 182 |
| 53 | 3300015261 | Ga0182006_1062273 | Ga0182006_10622732 | 182 |
| 54 | 3300005329 | Ga0070683_100544441 | Ga0070683_1005444412 | 183 |
| 55 | 3300005353 | Ga0070669_100125601 | Ga0070669_1001256012 | 183 |
| 56 | 3300005547 | Ga0070693_100012081 | Ga0070693_1000120811 | 183 |
| 57 | 3300006844 | Ga0075428_100047780 | Ga0075428_1000477805 | 183 |
| 58 | 3300009094 | Ga0111539_10015981 | Ga0111539_100159815 | 183 |
| 59 | 3300009147 | Ga0114129_10947552 | Ga0114129_109475522 | 183 |
| 60 | 3300013297 | Ga0157378_10005865 | Ga0157378_100058658 | 183 |
| 61 | 3300014326 | Ga0157380_10005312 | Ga0157380_1000531210 | 183 |
| 62 | 3300025923 | Ga0207681_10133617 | Ga0207681_101336171 | 183 |
| 63 | 3300025944 | Ga0207661_10601375 | Ga0207661_106013752 | 183 |
| 64 | 3300027907 | Ga0207428_10045555 | Ga0207428_100455556 | 183 |
| 65 | 3300041443 | Ga0451789_1164836 | Ga0451789_1164836_185_766 | 183 |
| 66 | 3300041512 | Ga0451853_0279546 | Ga0451853_0279546_95_685 | 183 |
| 67 | 3300046501 | Ga0495607_0005344 | Ga0495607_0005344_7464_8045 | 183 |
| 68 | 3300050511 | nmdc:mga08y16_22982_c1 | nmdc:mga08y16_22982_c1_5319_5903 | 183 |
| 69 | 3300005535 | Ga0070684_100254401 | Ga0070684_1002544012 | 184 |
| 70 | 3300005563 | Ga0068855_100048995 | Ga0068855_1000489952 | 184 |
| 71 | 3300005564 | Ga0070664_100066450 | Ga0070664_1000664502 | 184 |
| 72 | 3300005577 | Ga0068857_100072598 | Ga0068857_1000725981 | 184 |
| 73 | 3300005617 | Ga0068859_100251242 | Ga0068859_1002512422 | 184 |
| 74 | 3300006881 | Ga0068865_100031524 | Ga0068865_1000315243 | 184 |
| 75 | 3300006931 | Ga0097620_100251228 | Ga0097620_1002512282 | 184 |
| 76 | 3300009979 | Ga0105032_101247 | Ga0105032_1012472 | 184 |
| 77 | 3300013105 | Ga0157369_10140751 | Ga0157369_101407512 | 184 |
| 78 | 3300013296 | Ga0157374_10011274 | Ga0157374_100112743 | 184 |
| 79 | 3300025938 | Ga0207704_10027813 | Ga0207704_100278132 | 184 |
| 80 | 3300026116 | Ga0207674_10041032 | Ga0207674_100410324 | 184 |
| 81 | 3300027717 | Ga0209998_10019498 | Ga0209998_100194982 | 184 |
| 82 | 3300034820 | Ga0373959_0035132 | Ga0373959_0035132_163_750 | 184 |
| 83 | 3300045976 | Ga0466967_0650601 | Ga0466967_0650601_293_880 | 184 |
| 84 | 3300049589 | Ga0501073_0083410 | Ga0501073_0083410_1348_1935 | 184 |
| 85 | 3300049741 | Ga0501079_0168851 | Ga0501079_0168851_36_623 | 184 |
| 86 | 3300003781 | Ga0055536_1006922 | Ga0055536_10069222 | 185 |
| 87 | 3300005344 | Ga0070661_100124199 | Ga0070661_1001241992 | 185 |
| 88 | 3300005539 | Ga0068853_100234663 | Ga0068853_1002346632 | 185 |
| 89 | 3300005548 | Ga0070665_100000027 | Ga0070665_100000027159 | 185 |
| 90 | 3300005618 | Ga0068864_100104950 | Ga0068864_1001049502 | 185 |
| 91 | 3300005842 | Ga0068858_100001790 | Ga0068858_10000179017 | 185 |
| 92 | 3300005842 | Ga0068858_100059794 | Ga0068858_1000597945 | 185 |
| 93 | 3300005843 | Ga0068860_100356511 | Ga0068860_1003565113 | 185 |
| 94 | 3300009093 | Ga0105240_10008614 | Ga0105240_100086148 | 185 |
| 95 | 3300009551 | Ga0105238_10193221 | Ga0105238_101932211 | 185 |
| 96 | 3300025292 | Ga0209676_1000129 | Ga0209676_100012962 | 185 |
| 97 | 3300025913 | Ga0207695_10057608 | Ga0207695_100576082 | 185 |
| 98 | 3300026035 | Ga0207703_10001370 | Ga0207703_1000137016 | 185 |
| 99 | 3300026035 | Ga0207703_10059730 | Ga0207703_100597303 | 185 |
| 100 | 3300026088 | Ga0207641_10013092 | Ga0207641_100130924 | 185 |
| 101 | 3300028379 | Ga0268266_10000050 | Ga0268266_10000050124 | 185 |
| 102 | 3300041451 | Ga0451791_1129320 | Ga0451791_1129320_180_767 | 185 |
| 103 | 3300041460 | Ga0451802_0603233 | Ga0451802_0603233_2041_2628 | 185 |
| 104 | 3300041463 | Ga0451804_0451569 | Ga0451804_0451569_77_664 | 185 |
| 105 | 3300041498 | Ga0451841_0074451 | Ga0451841_0074451_202_789 | 185 |
| 106 | 3300049570 | Ga0501033_0432315 | Ga0501033_0432315_158_760 | 185 |
| 107 | 3300049571 | Ga0501034_0631799 | Ga0501034_0631799_294_896 | 185 |
| 108 | 3300050514 | nmdc:mga08x19_1028867_c1 | nmdc:mga08x19_1028867_c1_10_570 | 185 |
| 109 | 3300005616 | Ga0068852_100160752 | Ga0068852_1001607523 | 186 |
| 110 | 3300031995 | Ga0307409_100974866 | Ga0307409_1009748661 | 186 |
| 111 | 3300046473 | Ga0495582_0575952 | Ga0495582_0575952_25_612 | 186 |
| 112 | 3300046539 | Ga0495621_0050098 | Ga0495621_0050098_217_807 | 186 |
| 113 | 3300049568 | Ga0501031_0070658 | Ga0501031_0070658_820_1407 | 186 |
| 114 | 3300049569 | Ga0501032_0004329 | Ga0501032_0004329_5986_6612 | 186 |
| 115 | 3300049570 | Ga0501033_0001368 | Ga0501033_0001368_6534_7121 | 186 |
| 116 | 3300049571 | Ga0501034_0111089 | Ga0501034_0111089_984_1571 | 186 |
| 117 | 3300049572 | Ga0501036_0040738 | Ga0501036_0040738_858_1445 | 186 |
| 118 | 3300049573 | Ga0501037_0057893 | Ga0501037_0057893_2069_2656 | 186 |
| 119 | 3300049574 | Ga0501038_0014042 | Ga0501038_0014042_400_987 | 186 |
| 120 | 3300049575 | Ga0501039_0011236 | Ga0501039_0011236_5906_6493 | 186 |
| 121 | 3300049576 | Ga0501040_0191613 | Ga0501040_0191613_29_616 | 186 |
| 122 | 3300049579 | Ga0501043_0030678 | Ga0501043_0030678_2654_3241 | 186 |
| 123 | 3300049580 | Ga0501046_0002661 | Ga0501046_0002661_9555_10142 | 186 |
| 124 | 3300049580 | Ga0501046_0225580 | Ga0501046_0225580_381_983 | 186 |
| 125 | 3300049581 | Ga0501047_0019967 | Ga0501047_0019967_412_999 | 186 |
| 126 | 3300049581 | Ga0501047_0581025 | Ga0501047_0581025_164_766 | 186 |
| 127 | 3300049582 | Ga0501048_0314350 | Ga0501048_0314350_13_600 | 186 |
| 128 | 3300049583 | Ga0501067_0099241 | Ga0501067_0099241_838_1425 | 186 |
| 129 | 3300049584 | Ga0501068_0030886 | Ga0501068_0030886_155_742 | 186 |
| 130 | 3300049586 | Ga0501070_0498123 | Ga0501070_0498123_155_757 | 186 |
| 131 | 3300049589 | Ga0501073_0008997 | Ga0501073_0008997_312_899 | 186 |
| 132 | 3300049590 | Ga0501074_0018685 | Ga0501074_0018685_775_1362 | 186 |
| 133 | 3300049741 | Ga0501079_0903306 | Ga0501079_0903306_72_659 | 186 |
| 134 | 3300049744 | Ga0501083_0091115 | Ga0501083_0091115_645_1232 | 186 |
| 135 | 3300049822 | Ga0501035_0377028 | Ga0501035_0377028_424_1011 | 186 |
| 136 | 3300049823 | Ga0501044_0078127 | Ga0501044_0078127_312_899 | 186 |
| 137 | 3300049823 | Ga0501044_0262160 | Ga0501044_0262160_173_775 | 186 |
| 138 | 3300053140 | Ga0500573_0215508 | Ga0500573_0215508_323_934 | 186 |
| 139 | 3300054114 | Ga0501084_0134894 | Ga0501084_0134894_696_1283 | 186 |
| 140 | 3300005616 | Ga0068852_100983886 | Ga0068852_1009838861 | 187 |
| 141 | 3300010375 | Ga0105239_10363539 | Ga0105239_103635392 | 187 |
| 142 | 3300031250 | Ga0265331_10085008 | Ga0265331_100850082 | 187 |
| 143 | 3300031728 | Ga0316578_10264161 | Ga0316578_102641612 | 187 |
| 144 | 3300035398 | Ga0316574_0006309 | Ga0316574_0006309_3390_3977 | 187 |
| 145 | 3300042142 | Ga0450905_068236 | Ga0450905_068236_12_584 | 187 |
| 146 | 3300049574 | Ga0501038_0024783 | Ga0501038_0024783_1123_1710 | 187 |
| 147 | 3300049578 | Ga0501042_0432022 | Ga0501042_0432022_285_872 | 187 |
| 148 | 3300049822 | Ga0501035_0189243 | Ga0501035_0189243_306_908 | 187 |
| 149 | 3300053085 | Ga0495619_0734420 | Ga0495619_0734420_45_608 | 187 |
| 150 | 3300005335 | Ga0070666_10027094 | Ga0070666_100270943 | 188 |
| 151 | 3300005355 | Ga0070671_100083307 | Ga0070671_1000833072 | 188 |
| 152 | 3300005364 | Ga0070673_100018116 | Ga0070673_1000181163 | 188 |
| 153 | 3300005367 | Ga0070667_100021949 | Ga0070667_1000219493 | 188 |
| 154 | 3300005539 | Ga0068853_100595762 | Ga0068853_1005957621 | 188 |
| 155 | 3300005548 | Ga0070665_100151162 | Ga0070665_1001511622 | 188 |
| 156 | 3300005834 | Ga0068851_10007768 | Ga0068851_100077683 | 188 |
| 157 | 3300005841 | Ga0068863_100308966 | Ga0068863_1003089662 | 188 |
| 158 | 3300005842 | Ga0068858_100140539 | Ga0068858_1001405392 | 188 |
| 159 | 3300005843 | Ga0068860_100191059 | Ga0068860_1001910592 | 188 |
| 160 | 3300009101 | Ga0105247_10218752 | Ga0105247_102187522 | 188 |
| 161 | 3300009545 | Ga0105237_10192220 | Ga0105237_101922202 | 188 |
| 162 | 3300025931 | Ga0207644_10048650 | Ga0207644_100486502 | 188 |
| 163 | 3300025949 | Ga0207667_10416429 | Ga0207667_104164292 | 188 |
| 164 | 3300025960 | Ga0207651_11316976 | Ga0207651_113169761 | 188 |
| 165 | 3300026035 | Ga0207703_10080890 | Ga0207703_100808902 | 188 |
| 166 | 3300026041 | Ga0207639_10222426 | Ga0207639_102224262 | 188 |
| 167 | 3300026142 | Ga0207698_10085779 | Ga0207698_100857791 | 188 |
| 168 | 3300046675 | Ga0495657_0343904 | Ga0495657_0343904_43_651 | 188 |
| 169 | 3300026142 | Ga0207698_10954075 | Ga0207698_109540752 | 189 |
| 170 | 3300044712 | Ga0453684_0275236 | Ga0453684_0275236_62_712 | 189 |
| 171 | 3300049742 | Ga0501080_0015415 | Ga0501080_0015415_3683_4270 | 189 |
| 172 | iso_pu_bacteria | 2571042365 | 2572254687 | 189 |
| 173 | iso_pu_bacteria | 2643221695 | 2644530411 | 189 |
| 174 | 3300053136 | Ga0500559_0052981 | Ga0500559_0052981_638_1219 | 190 |
| 175 | iso_pu_bacteria | 2643221577 | 2643896833 | 190 |
| 176 | iso_pu_bacteria | 2643221685 | 2644479038 | 190 |
| 177 | 3300003323 | rootH1_10110933 | rootH1_101109337 | 191 |
| 178 | 3300005289 | Ga0065704_10394947 | Ga0065704_103949471 | 191 |
| 179 | 3300005290 | Ga0065712_10136839 | Ga0065712_101368392 | 191 |
| 180 | 3300005293 | Ga0065715_10009448 | Ga0065715_100094483 | 191 |
| 181 | 3300005295 | Ga0065707_10082271 | Ga0065707_100822715 | 191 |
| 182 | 3300005295 | Ga0065707_10171255 | Ga0065707_101712551 | 191 |
| 183 | 3300005295 | Ga0065707_10418652 | Ga0065707_104186521 | 191 |
| 184 | 3300005328 | Ga0070676_10138923 | Ga0070676_101389232 | 191 |
| 185 | 3300005331 | Ga0070670_100039018 | Ga0070670_1000390182 | 191 |
| 186 | 3300005334 | Ga0068869_100006863 | Ga0068869_1000068634 | 191 |
| 187 | 3300005334 | Ga0068869_100414881 | Ga0068869_1004148812 | 191 |
| 188 | 3300005335 | Ga0070666_10018125 | Ga0070666_100181251 | 191 |
| 189 | 3300005338 | Ga0068868_100283071 | Ga0068868_1002830712 | 191 |
| 190 | 3300005340 | Ga0070689_100001792 | Ga0070689_10000179213 | 191 |
| 191 | 3300005344 | Ga0070661_100002783 | Ga0070661_1000027839 | 191 |
| 192 | 3300005347 | Ga0070668_100064144 | Ga0070668_1000641442 | 191 |
| 193 | 3300005353 | Ga0070669_100011681 | Ga0070669_1000116813 | 191 |
| 194 | 3300005353 | Ga0070669_100347328 | Ga0070669_1003473281 | 191 |
| 195 | 3300005354 | Ga0070675_100007428 | Ga0070675_1000074282 | 191 |
| 196 | 3300005354 | Ga0070675_100017621 | Ga0070675_1000176213 | 191 |
| 197 | 3300005356 | Ga0070674_100016829 | Ga0070674_1000168292 | 191 |
| 198 | 3300005356 | Ga0070674_100439234 | Ga0070674_1004392342 | 191 |
| 199 | 3300005364 | Ga0070673_100015582 | Ga0070673_1000155823 | 191 |
| 200 | 3300005365 | Ga0070688_100022568 | Ga0070688_1000225682 | 191 |
| 201 | 3300005438 | Ga0070701_10044840 | Ga0070701_100448402 | 191 |
| 202 | 3300005440 | Ga0070705_100030509 | Ga0070705_1000305092 | 191 |
| 203 | 3300005441 | Ga0070700_100012796 | Ga0070700_1000127964 | 191 |
| 204 | 3300005444 | Ga0070694_100268031 | Ga0070694_1002680312 | 191 |
| 205 | 3300005456 | Ga0070678_100021459 | Ga0070678_1000214591 | 191 |
| 206 | 3300005457 | Ga0070662_100071818 | Ga0070662_1000718182 | 191 |
| 207 | 3300005457 | Ga0070662_100186994 | Ga0070662_1001869942 | 191 |
| 208 | 3300005466 | Ga0070685_10032672 | Ga0070685_100326721 | 191 |
| 209 | 3300005535 | Ga0070684_100000531 | Ga0070684_10000053116 | 191 |
| 210 | 3300005543 | Ga0070672_100004785 | Ga0070672_1000047854 | 191 |
| 211 | 3300005544 | Ga0070686_100006093 | Ga0070686_1000060932 | 191 |
| 212 | 3300005547 | Ga0070693_100052333 | Ga0070693_1000523332 | 191 |
| 213 | 3300005548 | Ga0070665_100072319 | Ga0070665_1000723194 | 191 |
| 214 | 3300005564 | Ga0070664_100018384 | Ga0070664_1000183843 | 191 |
| 215 | 3300005577 | Ga0068857_100011136 | Ga0068857_1000111369 | 191 |
| 216 | 3300005577 | Ga0068857_100062154 | Ga0068857_1000621542 | 191 |
| 217 | 3300005615 | Ga0070702_100002848 | Ga0070702_1000028482 | 191 |
| 218 | 3300005617 | Ga0068859_100341516 | Ga0068859_1003415161 | 191 |
| 219 | 3300005618 | Ga0068864_100017826 | Ga0068864_1000178263 | 191 |
| 220 | 3300005719 | Ga0068861_100003131 | Ga0068861_1000031315 | 191 |
| 221 | 3300005719 | Ga0068861_101210417 | Ga0068861_1012104172 | 191 |
| 222 | 3300005840 | Ga0068870_10003262 | Ga0068870_100032623 | 191 |
| 223 | 3300005841 | Ga0068863_100002472 | Ga0068863_10000247213 | 191 |
| 224 | 3300005842 | Ga0068858_100123255 | Ga0068858_1001232553 | 191 |
| 225 | 3300005843 | Ga0068860_100078868 | Ga0068860_1000788682 | 191 |
| 226 | 3300005844 | Ga0068862_100000444 | Ga0068862_10000044423 | 191 |
| 227 | 3300005844 | Ga0068862_100003520 | Ga0068862_1000035202 | 191 |
| 228 | 3300005981 | Ga0081538_10102868 | Ga0081538_101028681 | 191 |
| 229 | 3300006237 | Ga0097621_100012148 | Ga0097621_1000121484 | 191 |
| 230 | 3300006358 | Ga0068871_100046908 | Ga0068871_1000469082 | 191 |
| 231 | 3300006844 | Ga0075428_100010387 | Ga0075428_1000103872 | 191 |
| 232 | 3300006844 | Ga0075428_100504718 | Ga0075428_1005047182 | 191 |
| 233 | 3300006844 | Ga0075428_100575528 | Ga0075428_1005755282 | 191 |
| 234 | 3300006846 | Ga0075430_100002675 | Ga0075430_1000026752 | 191 |
| 235 | 3300006846 | Ga0075430_100037006 | Ga0075430_1000370062 | 191 |
| 236 | 3300006846 | Ga0075430_100334171 | Ga0075430_1003341712 | 191 |
| 237 | 3300006847 | Ga0075431_100036273 | Ga0075431_1000362732 | 191 |
| 238 | 3300006847 | Ga0075431_100478361 | Ga0075431_1004783612 | 191 |
| 239 | 3300006852 | Ga0075433_10782701 | Ga0075433_107827011 | 191 |
| 240 | 3300006880 | Ga0075429_100001256 | Ga0075429_10000125616 | 191 |
| 241 | 3300006881 | Ga0068865_100201948 | Ga0068865_1002019482 | 191 |
| 242 | 3300006931 | Ga0097620_100341492 | Ga0097620_1003414921 | 191 |
| 243 | 3300009092 | Ga0105250_10049752 | Ga0105250_100497522 | 191 |
| 244 | 3300009094 | Ga0111539_10057872 | Ga0111539_100578723 | 191 |
| 245 | 3300009094 | Ga0111539_10149624 | Ga0111539_101496242 | 191 |
| 246 | 3300009147 | Ga0114129_10001392 | Ga0114129_1000139222 | 191 |
| 247 | 3300009177 | Ga0105248_10016715 | Ga0105248_100167157 | 191 |
| 248 | 3300009553 | Ga0105249_10007299 | Ga0105249_100072993 | 191 |
| 249 | 3300011119 | Ga0105246_10219023 | Ga0105246_102190232 | 191 |
| 250 | 3300013297 | Ga0157378_10038247 | Ga0157378_100382472 | 191 |
| 251 | 3300013306 | Ga0163162_10099243 | Ga0163162_100992432 | 191 |
| 252 | 3300013308 | Ga0157375_10079768 | Ga0157375_100797683 | 191 |
| 253 | 3300014325 | Ga0163163_10008519 | Ga0163163_100085197 | 191 |
| 254 | 3300014326 | Ga0157380_10002817 | Ga0157380_100028173 | 191 |
| 255 | 3300014326 | Ga0157380_10020050 | Ga0157380_100200507 | 191 |
| 256 | 3300014326 | Ga0157380_10166649 | Ga0157380_101666491 | 191 |
| 257 | 3300014326 | Ga0157380_10588166 | Ga0157380_105881662 | 191 |
| 258 | 3300014745 | Ga0157377_10016970 | Ga0157377_100169702 | 191 |
| 259 | 3300014969 | Ga0157376_10176347 | Ga0157376_101763472 | 191 |
| 260 | 3300017792 | Ga0163161_10124807 | Ga0163161_101248072 | 191 |
| 261 | 3300017792 | Ga0163161_10592947 | Ga0163161_105929472 | 191 |
| 262 | 3300025711 | Ga0207696_1107559 | Ga0207696_11075591 | 191 |
| 263 | 3300025901 | Ga0207688_10006633 | Ga0207688_100066338 | 191 |
| 264 | 3300025901 | Ga0207688_10307109 | Ga0207688_103071091 | 191 |
| 265 | 3300025903 | Ga0207680_10046347 | Ga0207680_100463472 | 191 |
| 266 | 3300025907 | Ga0207645_10100511 | Ga0207645_101005112 | 191 |
| 267 | 3300025908 | Ga0207643_10011994 | Ga0207643_100119943 | 191 |
| 268 | 3300025918 | Ga0207662_10015882 | Ga0207662_100158823 | 191 |
| 269 | 3300025920 | Ga0207649_10116123 | Ga0207649_101161232 | 191 |
| 270 | 3300025923 | Ga0207681_10604479 | Ga0207681_106044791 | 191 |
| 271 | 3300025925 | Ga0207650_10130841 | Ga0207650_101308412 | 191 |
| 272 | 3300025925 | Ga0207650_10168276 | Ga0207650_101682762 | 191 |
| 273 | 3300025926 | Ga0207659_10021152 | Ga0207659_100211523 | 191 |
| 274 | 3300025931 | Ga0207644_10057830 | Ga0207644_100578302 | 191 |
| 275 | 3300025933 | Ga0207706_10023512 | Ga0207706_100235123 | 191 |
| 276 | 3300025935 | Ga0207709_10179586 | Ga0207709_101795862 | 191 |
| 277 | 3300025936 | Ga0207670_10009960 | Ga0207670_100099602 | 191 |
| 278 | 3300025937 | Ga0207669_10094141 | Ga0207669_100941412 | 191 |
| 279 | 3300025938 | Ga0207704_10042952 | Ga0207704_100429522 | 191 |
| 280 | 3300025940 | Ga0207691_10001891 | Ga0207691_100018917 | 191 |
| 281 | 3300025941 | Ga0207711_10056088 | Ga0207711_100560882 | 191 |
| 282 | 3300025942 | Ga0207689_10004017 | Ga0207689_100040175 | 191 |
| 283 | 3300025942 | Ga0207689_10461935 | Ga0207689_104619352 | 191 |
| 284 | 3300025945 | Ga0207679_10018032 | Ga0207679_100180323 | 191 |
| 285 | 3300025960 | Ga0207651_10112263 | Ga0207651_101122632 | 191 |
| 286 | 3300025960 | Ga0207651_10133688 | Ga0207651_101336881 | 191 |
| 287 | 3300025961 | Ga0207712_10861898 | Ga0207712_108618981 | 191 |
| 288 | 3300025972 | Ga0207668_10100371 | Ga0207668_101003712 | 191 |
| 289 | 3300025972 | Ga0207668_10440793 | Ga0207668_104407932 | 191 |
| 290 | 3300025981 | Ga0207640_10209841 | Ga0207640_102098412 | 191 |
| 291 | 3300026035 | Ga0207703_10069493 | Ga0207703_100694932 | 191 |
| 292 | 3300026075 | Ga0207708_10081957 | Ga0207708_100819572 | 191 |
| 293 | 3300026088 | Ga0207641_10011688 | Ga0207641_100116884 | 191 |
| 294 | 3300026095 | Ga0207676_10027715 | Ga0207676_100277153 | 191 |
| 295 | 3300026116 | Ga0207674_10023693 | Ga0207674_100236932 | 191 |
| 296 | 3300026116 | Ga0207674_10108197 | Ga0207674_101081973 | 191 |
| 297 | 3300026118 | Ga0207675_100011449 | Ga0207675_1000114495 | 191 |
| 298 | 3300026118 | Ga0207675_100016093 | Ga0207675_1000160934 | 191 |
| 299 | 3300026118 | Ga0207675_100021963 | Ga0207675_1000219638 | 191 |
| 300 | 3300026142 | Ga0207698_10625886 | Ga0207698_106258862 | 191 |
| 301 | 3300027907 | Ga0207428_10115937 | Ga0207428_101159372 | 191 |
| 302 | 3300027907 | Ga0207428_10192210 | Ga0207428_101922102 | 191 |
| 303 | 3300028379 | Ga0268266_10235644 | Ga0268266_102356442 | 191 |
| 304 | 3300028380 | Ga0268265_10001895 | Ga0268265_100018959 | 191 |
| 305 | 3300028380 | Ga0268265_10200333 | Ga0268265_102003332 | 191 |
| 306 | 3300028381 | Ga0268264_10115062 | Ga0268264_101150622 | 191 |
| 307 | 3300028381 | Ga0268264_10474033 | Ga0268264_104740332 | 191 |
| 308 | 3300031548 | Ga0307408_100102451 | Ga0307408_1001024512 | 191 |
| 309 | 3300031548 | Ga0307408_100122670 | Ga0307408_1001226702 | 191 |
| 310 | 3300031548 | Ga0307408_100599632 | Ga0307408_1005996321 | 191 |
| 311 | 3300031731 | Ga0307405_10027065 | Ga0307405_100270652 | 191 |
| 312 | 3300031824 | Ga0307413_10456953 | Ga0307413_104569532 | 191 |
| 313 | 3300031852 | Ga0307410_10069758 | Ga0307410_100697583 | 191 |
| 314 | 3300031901 | Ga0307406_10135844 | Ga0307406_101358442 | 191 |
| 315 | 3300031911 | Ga0307412_10011233 | Ga0307412_100112333 | 191 |
| 316 | 3300031911 | Ga0307412_10038038 | Ga0307412_100380384 | 191 |
| 317 | 3300031911 | Ga0307412_10226865 | Ga0307412_102268652 | 191 |
| 318 | 3300031911 | Ga0307412_10722473 | Ga0307412_107224731 | 191 |
| 319 | 3300031995 | Ga0307409_100464555 | Ga0307409_1004645552 | 191 |
| 320 | 3300032002 | Ga0307416_100014743 | Ga0307416_1000147432 | 191 |
| 321 | 3300032002 | Ga0307416_100273925 | Ga0307416_1002739252 | 191 |
| 322 | 3300032004 | Ga0307414_10966776 | Ga0307414_109667761 | 191 |
| 323 | 3300032005 | Ga0307411_10336845 | Ga0307411_103368452 | 191 |
| 324 | 3300032005 | Ga0307411_10433175 | Ga0307411_104331752 | 191 |
| 325 | 3300032126 | Ga0307415_100013848 | Ga0307415_1000138484 | 191 |
| 326 | 3300032126 | Ga0307415_100279803 | Ga0307415_1002798032 | 191 |
| 327 | 3300035114 | Ga0373939_0096966 | Ga0373939_0096966_45_629 | 191 |
| 328 | 3300035242 | Ga0373962_0158119 | Ga0373962_0158119_86_670 | 191 |
| 329 | 3300042002 | Ga0439442_025557 | Ga0439442_025557_357_941 | 191 |
| 330 | 3300042013 | Ga0439456_037407 | Ga0439456_037407_152_736 | 191 |
| 331 | 3300042015 | Ga0439462_0036341 | Ga0439462_0036341_550_1134 | 191 |
| 332 | 3300042016 | Ga0439463_068155 | Ga0439463_068155_121_705 | 191 |
| 333 | 3300042122 | Ga0450920_001622 | Ga0450920_001622_1894_2478 | 191 |
| 334 | 3300042125 | Ga0450923_001052 | Ga0450923_001052_2843_3427 | 191 |
| 335 | 3300042125 | Ga0450923_002489 | Ga0450923_002489_1482_2066 | 191 |
| 336 | 3300042133 | Ga0450896_000353 | Ga0450896_000353_3316_3900 | 191 |
| 337 | 3300042133 | Ga0450896_030379 | Ga0450896_030379_147_731 | 191 |
| 338 | 3300042134 | Ga0450898_007083 | Ga0450898_007083_29_613 | 191 |
| 339 | 3300042134 | Ga0450898_060096 | Ga0450898_060096_132_716 | 191 |
| 340 | 3300042147 | Ga0450910_003052 | Ga0450910_003052_618_1202 | 191 |
| 341 | 3300042147 | Ga0450910_008091 | Ga0450910_008091_593_1177 | 191 |
| 342 | 3300042156 | Ga0439446_0000178 | Ga0439446_0000178_9054_9638 | 191 |
| 343 | 3300042156 | Ga0439446_0129856 | Ga0439446_0129856_24_608 | 191 |
| 344 | 3300042435 | Ga0439434_0019384 | Ga0439434_0019384_1082_1666 | 191 |
| 345 | 3300042436 | Ga0439435_0010341 | Ga0439435_0010341_1399_1983 | 191 |
| 346 | 3300042436 | Ga0439435_0165185 | Ga0439435_0165185_88_672 | 191 |
| 347 | 3300042461 | Ga0439460_0013435 | Ga0439460_0013435_334_918 | 191 |
| 348 | 3300042530 | Ga0450916_025270 | Ga0450916_025270_95_679 | 191 |
| 349 | 3300042531 | Ga0450918_011032 | Ga0450918_011032_701_1285 | 191 |
| 350 | 3300042531 | Ga0450918_030058 | Ga0450918_030058_135_719 | 191 |
| 351 | 3300045051 | Ga0451576_0116465 | Ga0451576_0116465_135_719 | 191 |
| 352 | 3300046460 | Ga0495638_0009520 | Ga0495638_0009520_936_1520 | 191 |
| 353 | 3300046517 | Ga0495630_0109824 | Ga0495630_0109824_301_882 | 191 |
| 354 | 3300046533 | Ga0495640_0269204 | Ga0495640_0269204_449_1036 | 191 |
| 355 | 3300046535 | Ga0495586_0031171 | Ga0495586_0031171_1371_1952 | 191 |
| 356 | 3300046616 | Ga0495668_0206632 | Ga0495668_0206632_269_853 | 191 |
| 357 | 3300046660 | Ga0495625_0059514 | Ga0495625_0059514_2030_2614 | 191 |
| 358 | 3300046690 | Ga0495624_0346496 | Ga0495624_0346496_227_808 | 191 |
| 359 | 3300048909 | Ga0496106_0178523 | Ga0496106_0178523_239_823 | 191 |
| 360 | 3300048913 | Ga0496110_0821209 | Ga0496110_0821209_71_655 | 191 |
| 361 | 3300048914 | Ga0496111_0320202 | Ga0496111_0320202_498_1082 | 191 |
| 362 | 3300048915 | Ga0496112_0014495 | Ga0496112_0014495_3591_4175 | 191 |
| 363 | 3300048916 | Ga0496113_0115687 | Ga0496113_0115687_58_642 | 191 |
| 364 | 3300048917 | Ga0496114_0137874 | Ga0496114_0137874_47_634 | 191 |
| 365 | 3300048924 | Ga0496121_0027777 | Ga0496121_0027777_4237_4821 | 191 |
| 366 | 3300049522 | Ga0501299_015714 | Ga0501299_015714_26_610 | 191 |
| 367 | 3300049523 | Ga0501300_015709 | Ga0501300_015709_410_994 | 191 |
| 368 | 3300049524 | Ga0501301_012949 | Ga0501301_012949_122_706 | 191 |
| 369 | 3300049568 | Ga0501031_0159332 | Ga0501031_0159332_483_1067 | 191 |
| 370 | 3300049569 | Ga0501032_0291802 | Ga0501032_0291802_329_913 | 191 |
| 371 | 3300049572 | Ga0501036_0023698 | Ga0501036_0023698_3206_3790 | 191 |
| 372 | 3300049573 | Ga0501037_0100106 | Ga0501037_0100106_970_1554 | 191 |
| 373 | 3300049574 | Ga0501038_0040077 | Ga0501038_0040077_1422_2006 | 191 |
| 374 | 3300049575 | Ga0501039_0005001 | Ga0501039_0005001_1937_2521 | 191 |
| 375 | 3300049575 | Ga0501039_0160469 | Ga0501039_0160469_1000_1584 | 191 |
| 376 | 3300049575 | Ga0501039_0262503 | Ga0501039_0262503_663_1247 | 191 |
| 377 | 3300049575 | Ga0501039_0314916 | Ga0501039_0314916_78_662 | 191 |
| 378 | 3300049576 | Ga0501040_0030186 | Ga0501040_0030186_2470_3054 | 191 |
| 379 | 3300049576 | Ga0501040_0041347 | Ga0501040_0041347_2407_2991 | 191 |
| 380 | 3300049577 | Ga0501041_0085229 | Ga0501041_0085229_1182_1766 | 191 |
| 381 | 3300049577 | Ga0501041_0090484 | Ga0501041_0090484_254_838 | 191 |
| 382 | 3300049577 | Ga0501041_0285174 | Ga0501041_0285174_413_997 | 191 |
| 383 | 3300049578 | Ga0501042_0055657 | Ga0501042_0055657_1231_1815 | 191 |
| 384 | 3300049578 | Ga0501042_0221103 | Ga0501042_0221103_582_1166 | 191 |
| 385 | 3300049580 | Ga0501046_0056726 | Ga0501046_0056726_438_1022 | 191 |
| 386 | 3300049583 | Ga0501067_0013431 | Ga0501067_0013431_981_1565 | 191 |
| 387 | 3300049583 | Ga0501067_0149359 | Ga0501067_0149359_529_1119 | 191 |
| 388 | 3300049585 | Ga0501069_0086002 | Ga0501069_0086002_289_873 | 191 |
| 389 | 3300049587 | Ga0501071_0008854 | Ga0501071_0008854_2043_2627 | 191 |
| 390 | 3300049587 | Ga0501071_0057503 | Ga0501071_0057503_819_1403 | 191 |
| 391 | 3300049587 | Ga0501071_0126341 | Ga0501071_0126341_709_1293 | 191 |
| 392 | 3300049589 | Ga0501073_0017008 | Ga0501073_0017008_2220_2804 | 191 |
| 393 | 3300049589 | Ga0501073_0077091 | Ga0501073_0077091_1116_1700 | 191 |
| 394 | 3300049589 | Ga0501073_0485396 | Ga0501073_0485396_215_799 | 191 |
| 395 | 3300049590 | Ga0501074_0303745 | Ga0501074_0303745_175_759 | 191 |
| 396 | 3300049591 | Ga0501075_0021462 | Ga0501075_0021462_1204_1788 | 191 |
| 397 | 3300049591 | Ga0501075_0054327 | Ga0501075_0054327_1874_2458 | 191 |
| 398 | 3300049591 | Ga0501075_0097123 | Ga0501075_0097123_1036_1620 | 191 |
| 399 | 3300049592 | Ga0501076_0072658 | Ga0501076_0072658_1997_2581 | 191 |
| 400 | 3300049592 | Ga0501076_0174020 | Ga0501076_0174020_12_596 | 191 |
| 401 | 3300049592 | Ga0501076_0308004 | Ga0501076_0308004_263_847 | 191 |
| 402 | 3300049593 | Ga0501077_0026028 | Ga0501077_0026028_1950_2534 | 191 |
| 403 | 3300049593 | Ga0501077_0383612 | Ga0501077_0383612_262_846 | 191 |
| 404 | 3300049655 | Ga0501208_002223 | Ga0501208_002223_1361_1957 | 191 |
| 405 | 3300049741 | Ga0501079_0047893 | Ga0501079_0047893_2236_2820 | 191 |
| 406 | 3300049741 | Ga0501079_0192343 | Ga0501079_0192343_450_1034 | 191 |
| 407 | 3300049741 | Ga0501079_0203980 | Ga0501079_0203980_608_1192 | 191 |
| 408 | 3300049741 | Ga0501079_0249420 | Ga0501079_0249420_346_930 | 191 |
| 409 | 3300049743 | Ga0501081_0016037 | Ga0501081_0016037_1864_2448 | 191 |
| 410 | 3300049743 | Ga0501081_0047391 | Ga0501081_0047391_464_1048 | 191 |
| 411 | 3300049743 | Ga0501081_0207569 | Ga0501081_0207569_828_1412 | 191 |
| 412 | 3300049822 | Ga0501035_0576269 | Ga0501035_0576269_270_854 | 191 |
| 413 | 3300049822 | Ga0501035_0721715 | Ga0501035_0721715_186_770 | 191 |
| 414 | 3300049823 | Ga0501044_1099859 | Ga0501044_1099859_26_610 | 191 |
| 415 | 3300049824 | Ga0501045_0059434 | Ga0501045_0059434_1342_1926 | 191 |
| 416 | 3300049824 | Ga0501045_0094035 | Ga0501045_0094035_1502_2086 | 191 |
| 417 | 3300050507 | nmdc:mga05p37_1259_c1 | nmdc:mga05p37_1259_c1_19473_20057 | 191 |
| 418 | 3300050508 | nmdc:mga09592_132415_c1 | nmdc:mga09592_132415_c1_935_1519 | 191 |
| 419 | 3300050508 | nmdc:mga09592_960_c1 | nmdc:mga09592_960_c1_2847_3431 | 191 |
| 420 | 3300050509 | nmdc:mga0qj67_121932_c1 | nmdc:mga0qj67_121932_c1_642_1226 | 191 |
| 421 | 3300050509 | nmdc:mga0qj67_2202_c1 | nmdc:mga0qj67_2202_c1_3122_3706 | 191 |
| 422 | 3300050510 | nmdc:mga06r32_19902_c1 | nmdc:mga06r32_19902_c1_4067_4651 | 191 |
| 423 | 3300050510 | nmdc:mga06r32_227796_c1 | nmdc:mga06r32_227796_c1_1258_1842 | 191 |
| 424 | 3300050510 | nmdc:mga06r32_444957_c1 | nmdc:mga06r32_444957_c1_630_1214 | 191 |
| 425 | 3300050510 | nmdc:mga06r32_5694_c1 | nmdc:mga06r32_5694_c1_1987_2571 | 191 |
| 426 | 3300050510 | nmdc:mga06r32_84738_c1 | nmdc:mga06r32_84738_c1_2455_3039 | 191 |
| 427 | 3300050511 | nmdc:mga08y16_263181_c1 | nmdc:mga08y16_263181_c1_484_1068 | 191 |
| 428 | 3300050511 | nmdc:mga08y16_760276_c1 | nmdc:mga08y16_760276_c1_205_789 | 191 |
| 429 | 3300050515 | nmdc:mga0a205_667508_c1 | nmdc:mga0a205_667508_c1_28_612 | 191 |
| 430 | 3300054114 | Ga0501084_0021439 | Ga0501084_0021439_2057_2641 | 191 |
| 431 | 3300054114 | Ga0501084_0214325 | Ga0501084_0214325_851_1435 | 191 |
| 432 | 3300060353 | Ga0501082_0004506 | Ga0501082_0004506_2047_2631 | 191 |
| 433 | 3300060353 | Ga0501082_0019334 | Ga0501082_0019334_911_1495 | 191 |
| 434 | 3300060353 | Ga0501082_0355618 | Ga0501082_0355618_610_1194 | 191 |
| 435 | 3300060353 | Ga0501082_0492805 | Ga0501082_0492805_437_1021 | 191 |
| 436 | 3300060353 | Ga0501082_0572194 | Ga0501082_0572194_119_703 | 191 |
| 437 | 3300061734 | Ga0530510_0057977 | Ga0530510_0057977_1290_1874 | 191 |
| 438 | 3300061734 | Ga0530510_0286996 | Ga0530510_0286996_122_706 | 191 |
| 439 | 3300005290 | Ga0065712_10273480 | Ga0065712_102734802 | 192 |
| 440 | 3300005293 | Ga0065715_10306465 | Ga0065715_103064652 | 192 |
| 441 | 3300005331 | Ga0070670_100209720 | Ga0070670_1002097202 | 192 |
| 442 | 3300005334 | Ga0068869_100384888 | Ga0068869_1003848881 | 192 |
| 443 | 3300005438 | Ga0070701_10423798 | Ga0070701_104237981 | 192 |
| 444 | 3300005439 | Ga0070711_100569297 | Ga0070711_1005692971 | 192 |
| 445 | 3300005577 | Ga0068857_100486181 | Ga0068857_1004861811 | 192 |
| 446 | 3300005617 | Ga0068859_100043672 | Ga0068859_1000436721 | 192 |
| 447 | 3300005618 | Ga0068864_100207660 | Ga0068864_1002076603 | 192 |
| 448 | 3300005841 | Ga0068863_100038589 | Ga0068863_1000385894 | 192 |
| 449 | 3300005841 | Ga0068863_100068076 | Ga0068863_1000680764 | 192 |
| 450 | 3300005983 | Ga0081540_1008676 | Ga0081540_10086768 | 192 |
| 451 | 3300006931 | Ga0097620_100043673 | Ga0097620_1000436731 | 192 |
| 452 | 3300009177 | Ga0105248_10105783 | Ga0105248_101057833 | 192 |
| 453 | 3300009177 | Ga0105248_10238337 | Ga0105248_102383372 | 192 |
| 454 | 3300009553 | Ga0105249_10288331 | Ga0105249_102883312 | 192 |
| 455 | 3300011119 | Ga0105246_10657674 | Ga0105246_106576742 | 192 |
| 456 | 3300013104 | Ga0157370_10827318 | Ga0157370_108273181 | 192 |
| 457 | 3300013296 | Ga0157374_10658585 | Ga0157374_106585852 | 192 |
| 458 | 3300013297 | Ga0157378_10385066 | Ga0157378_103850662 | 192 |
| 459 | 3300014326 | Ga0157380_10199208 | Ga0157380_101992082 | 192 |
| 460 | 3300014969 | Ga0157376_10285127 | Ga0157376_102851272 | 192 |
| 461 | 3300025916 | Ga0207663_10343489 | Ga0207663_103434892 | 192 |
| 462 | 3300025919 | Ga0207657_10593766 | Ga0207657_105937662 | 192 |
| 463 | 3300025925 | Ga0207650_10347220 | Ga0207650_103472202 | 192 |
| 464 | 3300025927 | Ga0207687_10505703 | Ga0207687_105057031 | 192 |
| 465 | 3300025944 | Ga0207661_10289099 | Ga0207661_102890992 | 192 |
| 466 | 3300026089 | Ga0207648_10172604 | Ga0207648_101726043 | 192 |
| 467 | 3300026095 | Ga0207676_10023142 | Ga0207676_100231423 | 192 |
| 468 | 3300026118 | Ga0207675_100474460 | Ga0207675_1004744602 | 192 |
| 469 | 3300027364 | Ga0209967_1002913 | Ga0209967_10029132 | 192 |
| 470 | 3300028380 | Ga0268265_10014776 | Ga0268265_100147764 | 192 |
| 471 | 3300028653 | Ga0265323_10043849 | Ga0265323_100438491 | 192 |
| 472 | 3300030731 | Ga0316177_1002664 | Ga0316177_10026642 | 192 |
| 473 | 3300030732 | Ga0316176_1216601 | Ga0316176_12166011 | 192 |
| 474 | 3300030733 | Ga0314311_1264832 | Ga0314311_12648322 | 192 |
| 475 | 3300030735 | Ga0316178_1087300 | Ga0316178_10873002 | 192 |
| 476 | 3300031344 | Ga0265316_10075444 | Ga0265316_100754441 | 192 |
| 477 | 3300031712 | Ga0265342_10273331 | Ga0265342_102733311 | 192 |
| 478 | 3300031730 | Ga0307516_10355145 | Ga0307516_103551452 | 192 |
| 479 | 3300031824 | Ga0307413_10209326 | Ga0307413_102093261 | 192 |
| 480 | 3300031824 | Ga0307413_10290049 | Ga0307413_102900492 | 192 |
| 481 | 3300031852 | Ga0307410_10338108 | Ga0307410_103381082 | 192 |
| 482 | 3300032004 | Ga0307414_10015964 | Ga0307414_100159644 | 192 |
| 483 | 3300032004 | Ga0307414_10035256 | Ga0307414_100352562 | 192 |
| 484 | 3300032004 | Ga0307414_10038249 | Ga0307414_100382492 | 192 |
| 485 | 3300032004 | Ga0307414_10093162 | Ga0307414_100931622 | 192 |
| 486 | 3300032004 | Ga0307414_10198944 | Ga0307414_101989442 | 192 |
| 487 | 3300032004 | Ga0307414_10845751 | Ga0307414_108457511 | 192 |
| 488 | 3300032005 | Ga0307411_10195196 | Ga0307411_101951961 | 192 |
| 489 | 3300039062 | Ga0400483_237371 | Ga0400483_237371_5538_6125 | 192 |
| 490 | 3300041404 | Ga0439436_0091254 | Ga0439436_0091254_10_606 | 192 |
| 491 | 3300041406 | Ga0439439_0017147 | Ga0439439_0017147_215_811 | 192 |
| 492 | 3300041503 | Ga0451847_0627597 | Ga0451847_0627597_324_911 | 192 |
| 493 | 3300042006 | Ga0439432_011614 | Ga0439432_011614_560_1156 | 192 |
| 494 | 3300042007 | Ga0439449_0053008 | Ga0439449_0053008_195_791 | 192 |
| 495 | 3300042015 | Ga0439462_0009379 | Ga0439462_0009379_1580_2176 | 192 |
| 496 | 3300042145 | Ga0450906_044703 | Ga0450906_044703_53_649 | 192 |
| 497 | 3300042156 | Ga0439446_0000028 | Ga0439446_0000028_2034_2630 | 192 |
| 498 | 3300045051 | Ga0451576_0301636 | Ga0451576_0301636_989_1576 | 192 |
| 499 | 3300046535 | Ga0495586_0333030 | Ga0495586_0333030_158_754 | 192 |
| 500 | 3300046681 | Ga0495647_0285653 | Ga0495647_0285653_132_719 | 192 |
| 501 | 3300046681 | Ga0495647_0293188 | Ga0495647_0293188_98_685 | 192 |
| 502 | 3300046691 | Ga0495670_0054740 | Ga0495670_0054740_58_654 | 192 |
| 503 | 3300047322 | Ga0495680_0402936 | Ga0495680_0402936_227_814 | 192 |
| 504 | 3300047472 | Ga0495686_0004699 | Ga0495686_0004699_7339_7926 | 192 |
| 505 | 3300048921 | Ga0496118_0000513 | Ga0496118_0000513_58287_58874 | 192 |
| 506 | 3300048929 | Ga0496126_0401838 | Ga0496126_0401838_209_796 | 192 |
| 507 | 3300049586 | Ga0501070_0143110 | Ga0501070_0143110_1081_1668 | 192 |
| 508 | 3300049674 | Ga0501242_024419 | Ga0501242_024419_37_633 | 192 |
| 509 | 3300049742 | Ga0501080_0345853 | Ga0501080_0345853_611_1198 | 192 |
| 510 | 3300049775 | Ga0501279_018635 | Ga0501279_018635_186_782 | 192 |
| 511 | 3300053079 | Ga0500610_0001963 | Ga0500610_0001963_1715_2302 | 192 |
| 512 | 3300053080 | Ga0500635_0151449 | Ga0500635_0151449_67_654 | 192 |
| 513 | 3300053087 | Ga0500643_014094 | Ga0500643_014094_290_877 | 192 |
| 514 | 3300053120 | Ga0500597_061536 | Ga0500597_061536_513_1100 | 192 |
| 515 | 3300060353 | Ga0501082_0001130 | Ga0501082_0001130_4996_5583 | 192 |
| 516 | 3300032133 | Ga0316583_10188631 | Ga0316583_101886311 | 193 |
| 517 | 3300042007 | Ga0439449_0070960 | Ga0439449_0070960_415_1020 | 194 |
| 518 | iso_pu_bacteria | 2920107658 | 2920109520 | 194 |
| 519 | 3300053103 | Ga0500555_000003 | Ga0500555_000003_76674_77267 | 195 |
| 520 | 3300053153 | Ga0500616_0024825 | Ga0500616_0024825_1228_1821 | 195 |
| 521 | 3300006847 | Ga0075431_100236133 | Ga0075431_1002361332 | 196 |
| 522 | 3300006880 | Ga0075429_100713182 | Ga0075429_1007131821 | 196 |
| 523 | 3300050508 | nmdc:mga09592_473564_c1 | nmdc:mga09592_473564_c1_92_697 | 196 |
| 524 | 3300050510 | nmdc:mga06r32_65685_c1 | nmdc:mga06r32_65685_c1_2458_3063 | 196 |
| 525 | 3300005272 | Ga0065703_1020324 | Ga0065703_10203242 | 197 |
| 526 | 3300005340 | Ga0070689_100107373 | Ga0070689_1001073733 | 197 |
| 527 | 3300005440 | Ga0070705_100079135 | Ga0070705_1000791352 | 197 |
| 528 | 3300005544 | Ga0070686_100094357 | Ga0070686_1000943572 | 197 |
| 529 | 3300005547 | Ga0070693_100635625 | Ga0070693_1006356251 | 197 |
| 530 | 3300006175 | Ga0070712_100199407 | Ga0070712_1001994072 | 197 |
| 531 | 3300009098 | Ga0105245_10849780 | Ga0105245_108497801 | 197 |
| 532 | 3300014969 | Ga0157376_10230563 | Ga0157376_102305632 | 197 |
| 533 | 3300035170 | Ga0373943_0645631 | Ga0373943_0645631_22_615 | 197 |
| 534 | 3300049742 | Ga0501080_0262376 | Ga0501080_0262376_347_1039 | 198 |
| 535 | 3300000545 | CNXas_1000896 | CNXas_10008962 | 199 |
| 536 | 3300031456 | Ga0307513_10028087 | Ga0307513_100280874 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2etd-assembly1.cif.gz_A | crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution | 0.8615 | 28 | 184 |
| 2etd-assembly1.cif.gz_A | crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution | 0.828 | 28 | 184 |
| 2lqg-assembly1.cif.gz_A | solution structure of the r4 domain of talin | 0.7028 | 37 | 156 |
| 7ocf-assembly1.cif.gz_J | active state glua1/a2 ampa receptor in complex with tarp gamma 8 and cnih2 (lbd-tmd) | 0.6307 | 68 | 153 |
| 2lqg-assembly1.cif.gz_A | solution structure of the r4 domain of talin | 0.6215 | 37 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4iggA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat | 0.8999 | 62 | 122 | 1.10.287.160 |
| af_Q58971_21_189_1.20.1440.20 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain | 0.859 | 20 | 199 | 1.20.1440.20 |
| af_Q58971_21_189_1.20.1440.20 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain | 0.8497 | 20 | 199 | 1.20.1440.20 |
| 4iggA01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat | 0.8114 | 62 | 122 | 1.10.287.160 |
| 4onsC01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.7809 | 35 | 122 | 1.20.120.230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A076MQI9-F1-model_v4 | LemA family protein | 0.9925 | 5 | 169 |
GO:0016020
|
| AF-A0A293NEM5-F1-model_v4 | LemA family protein | 0.984 | 3 | 182 |
GO:0016020
|
| AF-A0A7C3RR29-F1-model_v4 | LemA family protein | 0.9787 | 5 | 194 |
GO:0016020
|
| AF-A0A076MQI9-F1-model_v4 | LemA family protein | 0.9749 | 5 | 169 |
GO:0016020
|
| AF-A0A848Z4X2-F1-model_v4 | LemA family protein | 0.973 | 1 | 185 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar