F460850

General Info

Members Datasets Scaffolds Average Seq Length
536 299 531 192

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0262376|Ga0501080_0262376_347_1039
Length 230
Sequence MARDIRAAFDDKLTKLRPGTPSALNYENYGPAPGGNMGWIILAIIVLLAFWVVGIYNGLVAARNGYKNAFAQIDVQLTRRHDLIPNLVETAKGYLAHERQTLEAVITARNAAVAGLKAAAANPGDPAAVQQLAGAENALSGALGRLFALAEAYPDLKANQNMMQLSEELTTTENKVAFARQAYNDSVMGYNNRREMFPGSIIANSFGFQPAQLLEIEAPEKRAVPQVSFT

Samples

Sample ID Description Type Environment
1 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
2 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
3 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
4 2643221695 Lysobacter sp. Root494 Isolate Unclassified
5 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
6 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
148 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
149 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
150 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
157 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
184 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
187 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
188 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
189 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
190 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
191 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
194 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
200 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
201 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
202 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
203 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
204 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
205 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
211 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
244 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
245 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
272 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
292 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
293 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
294 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
295 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0
Rhizoplane 1.87
Rhizosphere 93.84
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000896 3300000545 Bacteria 1952
2 rootH1_10110933 3300003323 Bacteria 10572
3 Ga0055536_1006922 3300003781 Bacteria 5168
4 Ga0065703_1020324 3300005272 Bacteria 1870
5 Ga0065704_10394947 3300005289 Bacteria 758
6 Ga0065712_10136839 3300005290 Bacteria 1489
7 Ga0065712_10273480 3300005290 Bacteria 911
8 Ga0065712_10289752 3300005290 Bacteria 879
9 Ga0065715_10009448 3300005293 Bacteria 2827
10 Ga0065715_10306465 3300005293 Bacteria 1023
11 Ga0065707_10082271 3300005295 Bacteria 17800
12 Ga0065707_10171255 3300005295 Bacteria 1483
13 Ga0065707_10418652 3300005295 Bacteria 833
14 Ga0070676_10138923 3300005328 Bacteria 1544
15 Ga0070683_100544441 3300005329 Bacteria 1110
16 Ga0070670_100039018 3300005331 Bacteria 4083
17 Ga0070670_100209720 3300005331 Bacteria 1694
18 Ga0070670_100357782 3300005331 Bacteria 1283
19 Ga0068869_100006863 3300005334 Bacteria 7243
20 Ga0068869_100264454 3300005334 Bacteria 1378
21 Ga0068869_100384888 3300005334 Bacteria 1150
22 Ga0068869_100414881 3300005334 Bacteria 1110
23 Ga0070666_10018125 3300005335 Bacteria 4522
24 Ga0070666_10027094 3300005335 Bacteria 3750
25 Ga0068868_100283071 3300005338 Bacteria 1404
26 Ga0070689_100001792 3300005340 Bacteria 13798
27 Ga0070689_100107373 3300005340 Bacteria 2216
28 Ga0070689_100250835 3300005340 Bacteria 1460
29 Ga0070661_100002783 3300005344 Bacteria 12003
30 Ga0070661_100124199 3300005344 Bacteria 1935
31 Ga0070668_100064144 3300005347 Bacteria 2848
32 Ga0070669_100011681 3300005353 Bacteria 6231
33 Ga0070669_100125601 3300005353 Bacteria 1963
34 Ga0070669_100347328 3300005353 Bacteria 1203
35 Ga0070675_100007428 3300005354 Bacteria 8467
36 Ga0070675_100017621 3300005354 Bacteria 5678
37 Ga0070675_100098781 3300005354 Bacteria 2456
38 Ga0070671_100083307 3300005355 Bacteria 2674
39 Ga0070674_100016829 3300005356 Bacteria 4587
40 Ga0070674_100439234 3300005356 Bacteria 1075
41 Ga0070673_100015582 3300005364 Bacteria 5346
42 Ga0070673_100018116 3300005364 Bacteria 5026
43 Ga0070688_100022568 3300005365 Bacteria 3691
44 Ga0070688_100068588 3300005365 Bacteria 2261
45 Ga0070667_100021949 3300005367 Bacteria 5298
46 Ga0070701_10036150 3300005438 Bacteria 2487
47 Ga0070701_10044840 3300005438 Bacteria 2267
48 Ga0070701_10423798 3300005438 Bacteria 848
49 Ga0070711_100569297 3300005439 Bacteria 942
50 Ga0070705_100030509 3300005440 Bacteria 2977
51 Ga0070705_100079135 3300005440 Bacteria 2013
52 Ga0070700_100012796 3300005441 Bacteria 4698
53 Ga0070694_100268031 3300005444 Bacteria 1297
54 Ga0070678_100021459 3300005456 Bacteria 4259
55 Ga0070662_100071818 3300005457 Bacteria 2553
56 Ga0070662_100186994 3300005457 Bacteria 1635
57 Ga0068867_100158438 3300005459 Bacteria 1783
58 Ga0070685_10032672 3300005466 Bacteria 2916
59 Ga0070685_10083055 3300005466 Bacteria 1924
60 Ga0070684_100000531 3300005535 Bacteria 26141
61 Ga0070684_100254401 3300005535 Bacteria 1605
62 Ga0068853_100234663 3300005539 Bacteria 1679
63 Ga0068853_100595762 3300005539 Bacteria 1049
64 Ga0070672_100004785 3300005543 Bacteria 8887
65 Ga0070686_100006093 3300005544 Bacteria 6693
66 Ga0070686_100094357 3300005544 Bacteria 2008
67 Ga0070693_100012081 3300005547 Bacteria 4361
68 Ga0070693_100052333 3300005547 Bacteria 2340
69 Ga0070693_100635625 3300005547 Bacteria 774
70 Ga0070665_100000027 3300005548 Bacteria 359314
71 Ga0070665_100072319 3300005548 Bacteria 3456
72 Ga0070665_100151162 3300005548 Bacteria 2325
73 Ga0070704_100176046 3300005549 Bacteria 1706
74 Ga0068855_100048995 3300005563 Bacteria 4985
75 Ga0070664_100018384 3300005564 Bacteria 5740
76 Ga0070664_100066450 3300005564 Bacteria 3079
77 Ga0068857_100011136 3300005577 Bacteria 7821
78 Ga0068857_100021793 3300005577 Bacteria 5639
79 Ga0068857_100062154 3300005577 Bacteria 3319
80 Ga0068857_100072598 3300005577 Bacteria 3067
81 Ga0068857_100486181 3300005577 Bacteria 1157
82 Ga0070702_100002848 3300005615 Bacteria 7589
83 Ga0068852_100160752 3300005616 Bacteria 2097
84 Ga0068852_100983886 3300005616 Bacteria 862
85 Ga0068859_100043672 3300005617 Bacteria 4505
86 Ga0068859_100251242 3300005617 Bacteria 1859
87 Ga0068859_100251821 3300005617 Bacteria 1857
88 Ga0068859_100341516 3300005617 Bacteria 1591
89 Ga0068864_100017826 3300005618 Bacteria 5923
90 Ga0068864_100104950 3300005618 Bacteria 2511
91 Ga0068864_100207660 3300005618 Bacteria 1802
92 Ga0068861_100003131 3300005719 Bacteria 10931
93 Ga0068861_100554413 3300005719 Bacteria 1048
94 Ga0068861_101210417 3300005719 Bacteria 731
95 Ga0068851_10007768 3300005834 Bacteria 4933
96 Ga0068870_10003262 3300005840 Bacteria 6848
97 Ga0068863_100002472 3300005841 Bacteria 18369
98 Ga0068863_100038589 3300005841 Bacteria 4543
99 Ga0068863_100068076 3300005841 Bacteria 3368
100 Ga0068863_100308966 3300005841 Bacteria 1534
101 Ga0068858_100001790 3300005842 Bacteria 21918
102 Ga0068858_100059794 3300005842 Bacteria 3522
103 Ga0068858_100123255 3300005842 Bacteria 2425
104 Ga0068858_100140539 3300005842 Bacteria 2266
105 Ga0068860_100078868 3300005843 Bacteria 3131
106 Ga0068860_100191059 3300005843 Bacteria 1982
107 Ga0068860_100356511 3300005843 Bacteria 1440
108 Ga0068862_100000444 3300005844 Bacteria 45032
109 Ga0068862_100003520 3300005844 Bacteria 13441
110 Ga0081538_10102868 3300005981 Bacteria 1431
111 Ga0081540_1008676 3300005983 Bacteria 7079
112 Ga0070712_100199407 3300006175 Unclassified 1571
113 Ga0097621_100012148 3300006237 Bacteria 6373
114 Ga0068871_100046908 3300006358 Bacteria 3482
115 Ga0075428_100010387 3300006844 Bacteria 10338
116 Ga0075428_100047780 3300006844 Bacteria 4699
117 Ga0075428_100504718 3300006844 Bacteria 1294
118 Ga0075428_100575528 3300006844 Bacteria 1203
119 Ga0075430_100002675 3300006846 Bacteria 14877
120 Ga0075430_100037006 3300006846 Bacteria 4137
121 Ga0075430_100334171 3300006846 Bacteria 1252
122 Ga0075431_100036273 3300006847 Bacteria 5078
123 Ga0075431_100236133 3300006847 Bacteria 1861
124 Ga0075431_100478361 3300006847 Bacteria 1238
125 Ga0075433_10782701 3300006852 Bacteria 834
126 Ga0075429_100001256 3300006880 Bacteria 20623
127 Ga0075429_100713182 3300006880 Bacteria 878
128 Ga0068865_100031524 3300006881 Bacteria 3535
129 Ga0068865_100201948 3300006881 Bacteria 1544
130 Ga0068865_100225392 3300006881 Bacteria 1467
131 Ga0097620_100043673 3300006931 Bacteria 4505
132 Ga0097620_100251228 3300006931 Bacteria 1859
133 Ga0097620_100251805 3300006931 Bacteria 1857
134 Ga0097620_100341492 3300006931 Bacteria 1591
135 Ga0075435_100208825 3300007076 Bacteria 1656
136 Ga0099795_10065721 3300007788 Bacteria 1357
137 Ga0105250_10049752 3300009092 Bacteria 1681
138 Ga0105240_10008614 3300009093 Bacteria 14574
139 Ga0111539_10015981 3300009094 Bacteria 9322
140 Ga0111539_10057872 3300009094 Bacteria 4601
141 Ga0111539_10149624 3300009094 Bacteria 2733
142 Ga0105245_10849780 3300009098 Bacteria 953
143 Ga0105247_10218752 3300009101 Bacteria 1288
144 Ga0114129_10001392 3300009147 Bacteria 32566
145 Ga0114129_10947552 3300009147 Bacteria 1088
146 Ga0105248_10016715 3300009177 Bacteria 8078
147 Ga0105248_10105783 3300009177 Bacteria 3173
148 Ga0105248_10238337 3300009177 Bacteria 2048
149 Ga0105237_10192220 3300009545 Bacteria 2041
150 Ga0105238_10193221 3300009551 Unclassified 2011
151 Ga0105249_10007299 3300009553 Bacteria 9637
152 Ga0105249_10288331 3300009553 Bacteria 1642
153 Ga0105032_101247 3300009979 Bacteria 2344
154 Ga0105239_10363539 3300010375 Bacteria 1635
155 Ga0105246_10219023 3300011119 Bacteria 1491
156 Ga0105246_10657674 3300011119 Bacteria 913
157 Ga0157370_10827318 3300013104 Bacteria 842
158 Ga0157369_10140751 3300013105 Bacteria 2553
159 Ga0157374_10011274 3300013296 Bacteria 7733
160 Ga0157374_10658585 3300013296 Bacteria 1059
161 Ga0157378_10005865 3300013297 Bacteria 10759
162 Ga0157378_10038247 3300013297 Bacteria 4251
163 Ga0157378_10385066 3300013297 Bacteria 1378
164 Ga0163162_10099243 3300013306 Bacteria 3002
165 Ga0157375_10079768 3300013308 Bacteria 3310
166 Ga0157375_10321868 3300013308 Bacteria 1711
167 Ga0163163_10008519 3300014325 Bacteria 9115
168 Ga0157380_10002817 3300014326 Bacteria 11824
169 Ga0157380_10005312 3300014326 Bacteria 9000
170 Ga0157380_10012525 3300014326 Bacteria 6155
171 Ga0157380_10020050 3300014326 Bacteria 4992
172 Ga0157380_10166649 3300014326 Bacteria 1921
173 Ga0157380_10199208 3300014326 Bacteria 1775
174 Ga0157380_10588166 3300014326 Bacteria 1099
175 Ga0182008_10244070 3300014497 Bacteria 925
176 Ga0157377_10016970 3300014745 Bacteria 3757
177 Ga0157377_10052248 3300014745 Bacteria 2307
178 Ga0157376_10176347 3300014969 Bacteria 1950
179 Ga0157376_10230563 3300014969 Bacteria 1720
180 Ga0157376_10285127 3300014969 Bacteria 1557
181 Ga0182006_1062273 3300015261 Bacteria 1404
182 Ga0163161_10124807 3300017792 Bacteria 1937
183 Ga0163161_10592947 3300017792 Bacteria 913
184 Ga0209676_1000129 3300025292 Bacteria 187495
185 Ga0207696_1107559 3300025711 Bacteria 757
186 Ga0207688_10006633 3300025901 Bacteria 6296
187 Ga0207688_10307109 3300025901 Bacteria 971
188 Ga0207680_10046347 3300025903 Bacteria 2569
189 Ga0207645_10100511 3300025907 Bacteria 1866
190 Ga0207643_10011994 3300025908 Bacteria 4679
191 Ga0207643_10292710 3300025908 Bacteria 1012
192 Ga0207695_10057608 3300025913 Bacteria 4036
193 Ga0207663_10343489 3300025916 Bacteria 1128
194 Ga0207662_10015882 3300025918 Bacteria 4242
195 Ga0207657_10593766 3300025919 Bacteria 864
196 Ga0207649_10116123 3300025920 Bacteria 1797
197 Ga0207681_10133617 3300025923 Bacteria 1838
198 Ga0207681_10604479 3300025923 Bacteria 906
199 Ga0207650_10130841 3300025925 Bacteria 1963
200 Ga0207650_10168276 3300025925 Bacteria 1740
201 Ga0207650_10347220 3300025925 Bacteria 1220
202 Ga0207659_10021152 3300025926 Bacteria 4314
203 Ga0207659_10392508 3300025926 Bacteria 1159
204 Ga0207687_10505703 3300025927 Bacteria 1009
205 Ga0207644_10048650 3300025931 Bacteria 3033
206 Ga0207644_10057830 3300025931 Bacteria 2801
207 Ga0207706_10023512 3300025933 Bacteria 5534
208 Ga0207709_10179586 3300025935 Bacteria 1493
209 Ga0207670_10009960 3300025936 Bacteria 5449
210 Ga0207670_10156271 3300025936 Bacteria 1698
211 Ga0207669_10094141 3300025937 Bacteria 1959
212 Ga0207704_10027813 3300025938 Bacteria 3127
213 Ga0207704_10042952 3300025938 Bacteria 2665
214 Ga0207704_10490692 3300025938 Bacteria 988
215 Ga0207691_10001891 3300025940 Bacteria 20461
216 Ga0207711_10056088 3300025941 Bacteria 3384
217 Ga0207689_10004017 3300025942 Bacteria 13373
218 Ga0207689_10213254 3300025942 Bacteria 1595
219 Ga0207689_10461935 3300025942 Bacteria 1062
220 Ga0207661_10289099 3300025944 Bacteria 1467
221 Ga0207661_10601375 3300025944 Bacteria 1009
222 Ga0207679_10018032 3300025945 Bacteria 4720
223 Ga0207667_10416429 3300025949 Bacteria 1367
224 Ga0207651_10112263 3300025960 Bacteria 2048
225 Ga0207651_10133688 3300025960 Bacteria 1904
226 Ga0207651_11316976 3300025960 Bacteria 649
227 Ga0207712_10861898 3300025961 Bacteria 799
228 Ga0207668_10100371 3300025972 Bacteria 2149
229 Ga0207668_10440793 3300025972 Bacteria 1109
230 Ga0207640_10209841 3300025981 Bacteria 1483
231 Ga0207703_10001370 3300026035 Bacteria 22258
232 Ga0207703_10059730 3300026035 Bacteria 3115
233 Ga0207703_10069493 3300026035 Bacteria 2905
234 Ga0207703_10080890 3300026035 Bacteria 2707
235 Ga0207639_10222426 3300026041 Bacteria 1631
236 Ga0207708_10081957 3300026075 Bacteria 2480
237 Ga0207708_10099199 3300026075 Bacteria 2252
238 Ga0207641_10011688 3300026088 Bacteria 7208
239 Ga0207641_10013092 3300026088 Bacteria 6803
240 Ga0207641_11229761 3300026088 Bacteria 749
241 Ga0207648_10172604 3300026089 Bacteria 1912
242 Ga0207648_10174108 3300026089 Bacteria 1903
243 Ga0207676_10023142 3300026095 Bacteria 4579
244 Ga0207676_10027715 3300026095 Bacteria 4222
245 Ga0207674_10011119 3300026116 Bacteria 10122
246 Ga0207674_10023693 3300026116 Bacteria 6571
247 Ga0207674_10041032 3300026116 Bacteria 4788
248 Ga0207674_10108197 3300026116 Bacteria 2757
249 Ga0207675_100011449 3300026118 Bacteria 8297
250 Ga0207675_100016093 3300026118 Bacteria 6985
251 Ga0207675_100021963 3300026118 Bacteria 5942
252 Ga0207675_100474460 3300026118 Bacteria 1242
253 Ga0207675_101018989 3300026118 Bacteria 847
254 Ga0207698_10085779 3300026142 Bacteria 2558
255 Ga0207698_10625886 3300026142 Bacteria 1063
256 Ga0207698_10954075 3300026142 Bacteria 867
257 Ga0209967_1002913 3300027364 Bacteria 2238
258 Ga0209998_10019498 3300027717 Bacteria 1446
259 Ga0207428_10045555 3300027907 Bacteria 3532
260 Ga0207428_10115937 3300027907 Bacteria 2058
261 Ga0207428_10192210 3300027907 Bacteria 1538
262 Ga0268266_10000050 3300028379 Bacteria 302778
263 Ga0268266_10235644 3300028379 Bacteria 1687
264 Ga0268265_10001895 3300028380 Bacteria 16631
265 Ga0268265_10014776 3300028380 Bacteria 5328
266 Ga0268265_10200333 3300028380 Bacteria 1731
267 Ga0268264_10115062 3300028381 Bacteria 2362
268 Ga0268264_10474033 3300028381 Bacteria 1216
269 Ga0265323_10043849 3300028653 Bacteria 1613
270 Ga0316177_1002664 3300030731 Bacteria 5660
271 Ga0316176_1216601 3300030732 Bacteria 1577
272 Ga0314311_1264832 3300030733 Bacteria 4502
273 Ga0316178_1087300 3300030735 Bacteria 3824
274 Ga0265331_10085008 3300031250 Bacteria 1466
275 Ga0265316_10075444 3300031344 Bacteria 2593
276 Ga0307513_10028087 3300031456 Bacteria 6442
277 Ga0307408_100102451 3300031548 Bacteria 2183
278 Ga0307408_100122670 3300031548 Bacteria 2015
279 Ga0307408_100599632 3300031548 Bacteria 978
280 Ga0265342_10273331 3300031712 Bacteria 896
281 Ga0316576_10332534 3300031727 Bacteria 1132
282 Ga0316578_10078161 3300031728 Bacteria 1966
283 Ga0316578_10264161 3300031728 Bacteria 1032
284 Ga0307516_10355145 3300031730 Bacteria 1131
285 Ga0307405_10027065 3300031731 Bacteria 3319
286 Ga0316577_10212770 3300031733 Bacteria 1093
287 Ga0307413_10209326 3300031824 Bacteria 1415
288 Ga0307413_10290049 3300031824 Bacteria 1235
289 Ga0307413_10456953 3300031824 Bacteria 1015
290 Ga0307410_10069758 3300031852 Bacteria 2432
291 Ga0307410_10338108 3300031852 Bacteria 1199
292 Ga0307406_10135844 3300031901 Bacteria 1733
293 Ga0307412_10011233 3300031911 Bacteria 5180
294 Ga0307412_10038038 3300031911 Bacteria 3095
295 Ga0307412_10226865 3300031911 Bacteria 1436
296 Ga0307412_10722473 3300031911 Bacteria 857
297 Ga0307409_100464555 3300031995 Bacteria 1224
298 Ga0307409_100974866 3300031995 Bacteria 865
299 Ga0307416_100014743 3300032002 Bacteria 5371
300 Ga0307416_100273925 3300032002 Bacteria 1659
301 Ga0307414_10015964 3300032004 Bacteria 4550
302 Ga0307414_10035256 3300032004 Bacteria 3328
303 Ga0307414_10038249 3300032004 Bacteria 3220
304 Ga0307414_10093162 3300032004 Bacteria 2245
305 Ga0307414_10198944 3300032004 Bacteria 1628
306 Ga0307414_10845751 3300032004 Bacteria 836
307 Ga0307414_10966776 3300032004 Bacteria 783
308 Ga0307411_10195196 3300032005 Bacteria 1549
309 Ga0307411_10336845 3300032005 Bacteria 1224
310 Ga0307411_10433175 3300032005 Bacteria 1095
311 Ga0307415_100013848 3300032126 Bacteria 4721
312 Ga0307415_100279803 3300032126 Bacteria 1371
313 Ga0316583_10038946 3300032133 Bacteria 1684
314 Ga0316583_10188631 3300032133 Bacteria 716
315 Ga0373959_0035132 3300034820 Bacteria 1029
316 Ga0373952_0048166 3300035092 Bacteria 1007
317 Ga0373939_0096966 3300035114 Bacteria 1006
318 Ga0373943_0645631 3300035170 Bacteria 625
319 Ga0373962_0158119 3300035242 Bacteria 746
320 Ga0316574_0006309 3300035398 Bacteria 6397
321 Ga0373931_0053115 3300035691 Bacteria 2162
322 Ga0373927_0170333 3300035695 Bacteria 1427
323 Ga0373937_0205959 3300036401 Bacteria 1850
324 Ga0316582_0183214 3300036647 Bacteria 1425
325 Ga0316584_0103922 3300036712 Bacteria 2126
326 Ga0316584_0266100 3300036712 Unclassified 1249
327 Ga0316584_0505160 3300036712 Bacteria 849
328 Ga0373925_0038332 3300037068 Bacteria 3543
329 Ga0400483_237371 3300039062 Bacteria 7748
330 Ga0439436_0091254 3300041404 Bacteria 848
331 Ga0439439_0017147 3300041406 Bacteria 1778
332 Ga0451789_1164836 3300041443 Bacteria 1308
333 Ga0451791_1129320 3300041451 Bacteria 1079
334 Ga0451802_0603233 3300041460 Bacteria 3355
335 Ga0451804_0451569 3300041463 Bacteria 729
336 Ga0451841_0074451 3300041498 Bacteria 1170
337 Ga0451847_0627597 3300041503 Bacteria 1089
338 Ga0451853_0279546 3300041512 Bacteria 1272
339 Ga0439442_025557 3300042002 Bacteria 1228
340 Ga0439432_011614 3300042006 Bacteria 3034
341 Ga0439449_0053008 3300042007 Bacteria 1499
342 Ga0439449_0070960 3300042007 Bacteria 1283
343 Ga0439456_037407 3300042013 Bacteria 1048
344 Ga0439462_0009379 3300042015 Bacteria 2475
345 Ga0439462_0036341 3300042015 Bacteria 1311
346 Ga0439463_068155 3300042016 Bacteria 911
347 Ga0450920_001622 3300042122 Bacteria 3754
348 Ga0450923_001052 3300042125 Bacteria 3474
349 Ga0450923_002489 3300042125 Bacteria 2650
350 Ga0450896_000353 3300042133 Bacteria 4489
351 Ga0450896_030379 3300042133 Bacteria 816
352 Ga0450898_007083 3300042134 Bacteria 1739
353 Ga0450898_060096 3300042134 Bacteria 746
354 Ga0450905_068236 3300042142 Bacteria 603
355 Ga0450906_044703 3300042145 Bacteria 782
356 Ga0450910_003052 3300042147 Bacteria 2209
357 Ga0450910_008091 3300042147 Bacteria 1475
358 Ga0439446_0000028 3300042156 Bacteria 24332
359 Ga0439446_0000178 3300042156 Bacteria 11158
360 Ga0439446_0129856 3300042156 Bacteria 816
361 Ga0439434_0019384 3300042435 Bacteria 2040
362 Ga0439435_0010341 3300042436 Bacteria 2212
363 Ga0439435_0165185 3300042436 Bacteria 717
364 Ga0439460_0013435 3300042461 Bacteria 2142
365 Ga0450916_025270 3300042530 Bacteria 838
366 Ga0450918_011032 3300042531 Bacteria 1575
367 Ga0450918_030058 3300042531 Bacteria 959
368 Ga0453684_0275236 3300044712 Bacteria 1922
369 Ga0451576_0079582 3300045051 Bacteria 3410
370 Ga0451576_0116465 3300045051 Bacteria 2782
371 Ga0451576_0301636 3300045051 Bacteria 1676
372 Ga0466967_0650601 3300045976 Bacteria 1042
373 Ga0495638_0009520 3300046460 Bacteria 6812
374 Ga0495582_0013572 3300046473 Bacteria 4485
375 Ga0495582_0575952 3300046473 Bacteria 651
376 Ga0495607_0005344 3300046501 Bacteria 9229
377 Ga0495630_0109824 3300046517 Bacteria 2089
378 Ga0495640_0269204 3300046533 Bacteria 1063
379 Ga0495586_0031171 3300046535 Bacteria 2854
380 Ga0495586_0106727 3300046535 Bacteria 1557
381 Ga0495586_0333030 3300046535 Bacteria 871
382 Ga0495621_0050098 3300046539 Bacteria 1492
383 Ga0495668_0206632 3300046616 Bacteria 1075
384 Ga0495625_0059514 3300046660 Bacteria 2710
385 Ga0495657_0343904 3300046675 Bacteria 884
386 Ga0495647_0285653 3300046681 Bacteria 741
387 Ga0495647_0293188 3300046681 Bacteria 732
388 Ga0495613_0074068 3300046689 Bacteria 2480
389 Ga0495624_0346496 3300046690 Bacteria 894
390 Ga0495670_0054740 3300046691 Bacteria 2000
391 Ga0495581_0043620 3300047315 Bacteria 2594
392 Ga0495680_0402936 3300047322 Bacteria 944
393 Ga0495686_0004699 3300047472 Bacteria 11079
394 Ga0495593_0215357 3300047673 Bacteria 964
395 Ga0495614_0316435 3300048089 Bacteria 723
396 Ga0496106_0178523 3300048909 Bacteria 1685
397 Ga0496110_0821209 3300048913 Bacteria 834
398 Ga0496111_0320202 3300048914 Bacteria 1149
399 Ga0496112_0014495 3300048915 Bacteria 7319
400 Ga0496113_0115687 3300048916 Bacteria 2092
401 Ga0496114_0137874 3300048917 Bacteria 2110
402 Ga0496118_0000513 3300048921 Bacteria 63612
403 Ga0496121_0027777 3300048924 Bacteria 5286
404 Ga0496126_0401838 3300048929 Bacteria 1111
405 Ga0501299_015714 3300049522 Bacteria 1332
406 Ga0501300_015709 3300049523 Bacteria 1106
407 Ga0501301_012949 3300049524 Bacteria 716
408 Ga0501031_0070658 3300049568 Bacteria 2274
409 Ga0501031_0159332 3300049568 Bacteria 1475
410 Ga0501032_0004329 3300049569 Bacteria 10718
411 Ga0501032_0291802 3300049569 Bacteria 1055
412 Ga0501033_0001368 3300049570 Bacteria 21745
413 Ga0501033_0432315 3300049570 Bacteria 916
414 Ga0501034_0111089 3300049571 Bacteria 2731
415 Ga0501034_0631799 3300049571 Bacteria 974
416 Ga0501036_0023698 3300049572 Bacteria 5172
417 Ga0501036_0040738 3300049572 Bacteria 3929
418 Ga0501037_0057893 3300049573 Bacteria 2828
419 Ga0501037_0100106 3300049573 Bacteria 2093
420 Ga0501038_0014042 3300049574 Bacteria 7298
421 Ga0501038_0024783 3300049574 Bacteria 5348
422 Ga0501038_0040077 3300049574 Bacteria 4094
423 Ga0501039_0005001 3300049575 Bacteria 10063
424 Ga0501039_0011236 3300049575 Bacteria 6823
425 Ga0501039_0160469 3300049575 Bacteria 1767
426 Ga0501039_0262503 3300049575 Bacteria 1357
427 Ga0501039_0314916 3300049575 Bacteria 1230
428 Ga0501040_0030186 3300049576 Bacteria 3661
429 Ga0501040_0041347 3300049576 Bacteria 3140
430 Ga0501040_0191613 3300049576 Bacteria 1451
431 Ga0501041_0085229 3300049577 Bacteria 1948
432 Ga0501041_0090484 3300049577 Bacteria 1889
433 Ga0501041_0285174 3300049577 Bacteria 1039
434 Ga0501042_0055657 3300049578 Bacteria 2823
435 Ga0501042_0221103 3300049578 Bacteria 1366
436 Ga0501042_0432022 3300049578 Bacteria 955
437 Ga0501043_0030678 3300049579 Bacteria 4226
438 Ga0501046_0002661 3300049580 Bacteria 16661
439 Ga0501046_0056726 3300049580 Bacteria 3073
440 Ga0501046_0225580 3300049580 Bacteria 1386
441 Ga0501047_0019967 3300049581 Bacteria 6432
442 Ga0501047_0581025 3300049581 Bacteria 943
443 Ga0501048_0314350 3300049582 Bacteria 1115
444 Ga0501067_0013431 3300049583 Bacteria 4536
445 Ga0501067_0099241 3300049583 Bacteria 1617
446 Ga0501067_0149359 3300049583 Bacteria 1302
447 Ga0501068_0030886 3300049584 Bacteria 3180
448 Ga0501069_0086002 3300049585 Bacteria 1775
449 Ga0501070_0143110 3300049586 Bacteria 1974
450 Ga0501070_0498123 3300049586 Bacteria 979
451 Ga0501071_0008854 3300049587 Bacteria 6672
452 Ga0501071_0057503 3300049587 Bacteria 2811
453 Ga0501071_0126341 3300049587 Bacteria 1898
454 Ga0501073_0008997 3300049589 Bacteria 7374
455 Ga0501073_0017008 3300049589 Bacteria 5268
456 Ga0501073_0077091 3300049589 Bacteria 2320
457 Ga0501073_0083410 3300049589 Bacteria 2224
458 Ga0501073_0485396 3300049589 Bacteria 854
459 Ga0501074_0018685 3300049590 Bacteria 5037
460 Ga0501074_0303745 3300049590 Bacteria 1133
461 Ga0501075_0021462 3300049591 Bacteria 4708
462 Ga0501075_0054327 3300049591 Bacteria 3013
463 Ga0501075_0097123 3300049591 Bacteria 2235
464 Ga0501076_0072658 3300049592 Bacteria 2753
465 Ga0501076_0174020 3300049592 Bacteria 1755
466 Ga0501076_0308004 3300049592 Bacteria 1299
467 Ga0501076_0743929 3300049592 Bacteria 809
468 Ga0501077_0026028 3300049593 Bacteria 3712
469 Ga0501077_0383612 3300049593 Bacteria 898
470 Ga0501208_002223 3300049655 Bacteria 1995
471 Ga0501242_024419 3300049674 Bacteria 792
472 Ga0501079_0047893 3300049741 Bacteria 3298
473 Ga0501079_0168851 3300049741 Bacteria 1706
474 Ga0501079_0192343 3300049741 Bacteria 1592
475 Ga0501079_0203980 3300049741 Bacteria 1545
476 Ga0501079_0249420 3300049741 Bacteria 1387
477 Ga0501079_0903306 3300049741 Bacteria 695
478 Ga0501080_0015415 3300049742 Bacteria 7045
479 Ga0501080_0262376 3300049742 Bacteria 1573
480 Ga0501080_0345853 3300049742 Bacteria 1343
481 Ga0501081_0016037 3300049743 Bacteria 4947
482 Ga0501081_0047391 3300049743 Bacteria 2957
483 Ga0501081_0207569 3300049743 Bacteria 1422
484 Ga0501083_0091115 3300049744 Bacteria 2013
485 Ga0501279_018635 3300049775 Bacteria 979
486 Ga0501035_0189243 3300049822 Bacteria 1770
487 Ga0501035_0377028 3300049822 Bacteria 1183
488 Ga0501035_0576269 3300049822 Bacteria 919
489 Ga0501035_0721715 3300049822 Bacteria 802
490 Ga0501044_0078127 3300049823 Bacteria 3354
491 Ga0501044_0262160 3300049823 Bacteria 1666
492 Ga0501044_1099859 3300049823 Bacteria 664
493 Ga0501045_0059434 3300049824 Bacteria 2800
494 Ga0501045_0094035 3300049824 Bacteria 2217
495 nmdc:mga05p37_1259_c1 3300050507 Bacteria 29382
496 nmdc:mga09592_132415_c1 3300050508 Bacteria 1807
497 nmdc:mga09592_473564_c1 3300050508 Bacteria 1079
498 nmdc:mga09592_960_c1 3300050508 Bacteria 22733
499 nmdc:mga0qj67_121932_c1 3300050509 Bacteria 2109
500 nmdc:mga0qj67_2202_c1 3300050509 Bacteria 13850
501 nmdc:mga06r32_19902_c1 3300050510 Bacteria 6170
502 nmdc:mga06r32_227796_c1 3300050510 Bacteria 1852
503 nmdc:mga06r32_444957_c1 3300050510 Bacteria 1276
504 nmdc:mga06r32_5694_c1 3300050510 Bacteria 11219
505 nmdc:mga06r32_65685_c1 3300050510 Bacteria 3500
506 nmdc:mga06r32_84738_c1 3300050510 Bacteria 3089
507 nmdc:mga08y16_22982_c1 3300050511 Bacteria 6583
508 nmdc:mga08y16_263181_c1 3300050511 Bacteria 1781
509 nmdc:mga08y16_760276_c1 3300050511 Bacteria 965
510 nmdc:mga08x19_1028867_c1 3300050514 Bacteria 585
511 nmdc:mga0a205_667508_c1 3300050515 Bacteria 890
512 Ga0500610_0001963 3300053079 Bacteria 7331
513 Ga0500635_0151449 3300053080 Bacteria 885
514 Ga0495619_0734420 3300053085 Bacteria 670
515 Ga0500643_014094 3300053087 Bacteria 2793
516 Ga0500555_000003 3300053103 Bacteria 392994
517 Ga0500597_061536 3300053120 Bacteria 1613
518 Ga0500559_0052981 3300053136 Bacteria 1795
519 Ga0500573_0215508 3300053140 Bacteria 1010
520 Ga0500616_0024825 3300053153 Bacteria 3327
521 Ga0501084_0021439 3300054114 Bacteria 5384
522 Ga0501084_0134894 3300054114 Bacteria 2078
523 Ga0501084_0214325 3300054114 Bacteria 1624
524 Ga0501082_0001130 3300060353 Bacteria 23635
525 Ga0501082_0004506 3300060353 Bacteria 12168
526 Ga0501082_0019334 3300060353 Bacteria 5870
527 Ga0501082_0355618 3300060353 Bacteria 1277
528 Ga0501082_0492805 3300060353 Bacteria 1071
529 Ga0501082_0572194 3300060353 Bacteria 988
530 Ga0530510_0057977 3300061734 Bacteria 2799
531 Ga0530510_0286996 3300061734 Bacteria 1230

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032133 Ga0316583_10038946 Ga0316583_100389462 166
2 3300036647 Ga0316582_0183214 Ga0316582_0183214_538_1107 166
3 3300036712 Ga0316584_0266100 Ga0316584_0266100_434_994 167
4 3300031727 Ga0316576_10332534 Ga0316576_103325342 168
5 3300031728 Ga0316578_10078161 Ga0316578_100781612 168
6 3300031733 Ga0316577_10212770 Ga0316577_102127701 168
7 3300036712 Ga0316584_0103922 Ga0316584_0103922_49_615 168
8 3300049592 Ga0501076_0743929 Ga0501076_0743929_264_779 169
9 3300007788 Ga0099795_10065721 Ga0099795_100657213 179
10 3300035691 Ga0373931_0053115 Ga0373931_0053115_632_1189 179
11 3300036401 Ga0373937_0205959 Ga0373937_0205959_1146_1703 179
12 3300045051 Ga0451576_0079582 Ga0451576_0079582_1581_2138 179
13 3300036712 Ga0316584_0505160 Ga0316584_0505160_211_777 180
14 3300005290 Ga0065712_10289752 Ga0065712_102897522 181
15 3300005331 Ga0070670_100357782 Ga0070670_1003577822 181
16 3300005334 Ga0068869_100264454 Ga0068869_1002644542 181
17 3300005340 Ga0070689_100250835 Ga0070689_1002508352 181
18 3300005354 Ga0070675_100098781 Ga0070675_1000987812 181
19 3300005365 Ga0070688_100068588 Ga0070688_1000685882 181
20 3300005438 Ga0070701_10036150 Ga0070701_100361502 181
21 3300005459 Ga0068867_100158438 Ga0068867_1001584382 181
22 3300005466 Ga0070685_10083055 Ga0070685_100830553 181
23 3300005549 Ga0070704_100176046 Ga0070704_1001760463 181
24 3300005577 Ga0068857_100021793 Ga0068857_1000217933 181
25 3300005617 Ga0068859_100251821 Ga0068859_1002518212 181
26 3300005719 Ga0068861_100554413 Ga0068861_1005544132 181
27 3300006881 Ga0068865_100225392 Ga0068865_1002253922 181
28 3300006931 Ga0097620_100251805 Ga0097620_1002518052 181
29 3300007076 Ga0075435_100208825 Ga0075435_1002088253 181
30 3300013308 Ga0157375_10321868 Ga0157375_103218682 181
31 3300014326 Ga0157380_10012525 Ga0157380_100125254 181
32 3300014745 Ga0157377_10052248 Ga0157377_100522482 181
33 3300025908 Ga0207643_10292710 Ga0207643_102927102 181
34 3300025926 Ga0207659_10392508 Ga0207659_103925082 181
35 3300025936 Ga0207670_10156271 Ga0207670_101562712 181
36 3300025938 Ga0207704_10490692 Ga0207704_104906922 181
37 3300025942 Ga0207689_10213254 Ga0207689_102132542 181
38 3300026075 Ga0207708_10099199 Ga0207708_100991992 181
39 3300026088 Ga0207641_11229761 Ga0207641_112297611 181
40 3300026089 Ga0207648_10174108 Ga0207648_101741081 181
41 3300026116 Ga0207674_10011119 Ga0207674_100111195 181
42 3300026118 Ga0207675_101018989 Ga0207675_1010189892 181
43 3300035092 Ga0373952_0048166 Ga0373952_0048166_35_598 181
44 3300035695 Ga0373927_0170333 Ga0373927_0170333_566_1129 181
45 3300037068 Ga0373925_0038332 Ga0373925_0038332_869_1432 181
46 3300046473 Ga0495582_0013572 Ga0495582_0013572_1384_1947 181
47 3300046535 Ga0495586_0106727 Ga0495586_0106727_739_1302 181
48 3300046689 Ga0495613_0074068 Ga0495613_0074068_1743_2306 181
49 3300047315 Ga0495581_0043620 Ga0495581_0043620_74_637 181
50 3300047673 Ga0495593_0215357 Ga0495593_0215357_15_578 181
51 3300048089 Ga0495614_0316435 Ga0495614_0316435_123_686 181
52 3300014497 Ga0182008_10244070 Ga0182008_102440702 182
53 3300015261 Ga0182006_1062273 Ga0182006_10622732 182
54 3300005329 Ga0070683_100544441 Ga0070683_1005444412 183
55 3300005353 Ga0070669_100125601 Ga0070669_1001256012 183
56 3300005547 Ga0070693_100012081 Ga0070693_1000120811 183
57 3300006844 Ga0075428_100047780 Ga0075428_1000477805 183
58 3300009094 Ga0111539_10015981 Ga0111539_100159815 183
59 3300009147 Ga0114129_10947552 Ga0114129_109475522 183
60 3300013297 Ga0157378_10005865 Ga0157378_100058658 183
61 3300014326 Ga0157380_10005312 Ga0157380_1000531210 183
62 3300025923 Ga0207681_10133617 Ga0207681_101336171 183
63 3300025944 Ga0207661_10601375 Ga0207661_106013752 183
64 3300027907 Ga0207428_10045555 Ga0207428_100455556 183
65 3300041443 Ga0451789_1164836 Ga0451789_1164836_185_766 183
66 3300041512 Ga0451853_0279546 Ga0451853_0279546_95_685 183
67 3300046501 Ga0495607_0005344 Ga0495607_0005344_7464_8045 183
68 3300050511 nmdc:mga08y16_22982_c1 nmdc:mga08y16_22982_c1_5319_5903 183
69 3300005535 Ga0070684_100254401 Ga0070684_1002544012 184
70 3300005563 Ga0068855_100048995 Ga0068855_1000489952 184
71 3300005564 Ga0070664_100066450 Ga0070664_1000664502 184
72 3300005577 Ga0068857_100072598 Ga0068857_1000725981 184
73 3300005617 Ga0068859_100251242 Ga0068859_1002512422 184
74 3300006881 Ga0068865_100031524 Ga0068865_1000315243 184
75 3300006931 Ga0097620_100251228 Ga0097620_1002512282 184
76 3300009979 Ga0105032_101247 Ga0105032_1012472 184
77 3300013105 Ga0157369_10140751 Ga0157369_101407512 184
78 3300013296 Ga0157374_10011274 Ga0157374_100112743 184
79 3300025938 Ga0207704_10027813 Ga0207704_100278132 184
80 3300026116 Ga0207674_10041032 Ga0207674_100410324 184
81 3300027717 Ga0209998_10019498 Ga0209998_100194982 184
82 3300034820 Ga0373959_0035132 Ga0373959_0035132_163_750 184
83 3300045976 Ga0466967_0650601 Ga0466967_0650601_293_880 184
84 3300049589 Ga0501073_0083410 Ga0501073_0083410_1348_1935 184
85 3300049741 Ga0501079_0168851 Ga0501079_0168851_36_623 184
86 3300003781 Ga0055536_1006922 Ga0055536_10069222 185
87 3300005344 Ga0070661_100124199 Ga0070661_1001241992 185
88 3300005539 Ga0068853_100234663 Ga0068853_1002346632 185
89 3300005548 Ga0070665_100000027 Ga0070665_100000027159 185
90 3300005618 Ga0068864_100104950 Ga0068864_1001049502 185
91 3300005842 Ga0068858_100001790 Ga0068858_10000179017 185
92 3300005842 Ga0068858_100059794 Ga0068858_1000597945 185
93 3300005843 Ga0068860_100356511 Ga0068860_1003565113 185
94 3300009093 Ga0105240_10008614 Ga0105240_100086148 185
95 3300009551 Ga0105238_10193221 Ga0105238_101932211 185
96 3300025292 Ga0209676_1000129 Ga0209676_100012962 185
97 3300025913 Ga0207695_10057608 Ga0207695_100576082 185
98 3300026035 Ga0207703_10001370 Ga0207703_1000137016 185
99 3300026035 Ga0207703_10059730 Ga0207703_100597303 185
100 3300026088 Ga0207641_10013092 Ga0207641_100130924 185
101 3300028379 Ga0268266_10000050 Ga0268266_10000050124 185
102 3300041451 Ga0451791_1129320 Ga0451791_1129320_180_767 185
103 3300041460 Ga0451802_0603233 Ga0451802_0603233_2041_2628 185
104 3300041463 Ga0451804_0451569 Ga0451804_0451569_77_664 185
105 3300041498 Ga0451841_0074451 Ga0451841_0074451_202_789 185
106 3300049570 Ga0501033_0432315 Ga0501033_0432315_158_760 185
107 3300049571 Ga0501034_0631799 Ga0501034_0631799_294_896 185
108 3300050514 nmdc:mga08x19_1028867_c1 nmdc:mga08x19_1028867_c1_10_570 185
109 3300005616 Ga0068852_100160752 Ga0068852_1001607523 186
110 3300031995 Ga0307409_100974866 Ga0307409_1009748661 186
111 3300046473 Ga0495582_0575952 Ga0495582_0575952_25_612 186
112 3300046539 Ga0495621_0050098 Ga0495621_0050098_217_807 186
113 3300049568 Ga0501031_0070658 Ga0501031_0070658_820_1407 186
114 3300049569 Ga0501032_0004329 Ga0501032_0004329_5986_6612 186
115 3300049570 Ga0501033_0001368 Ga0501033_0001368_6534_7121 186
116 3300049571 Ga0501034_0111089 Ga0501034_0111089_984_1571 186
117 3300049572 Ga0501036_0040738 Ga0501036_0040738_858_1445 186
118 3300049573 Ga0501037_0057893 Ga0501037_0057893_2069_2656 186
119 3300049574 Ga0501038_0014042 Ga0501038_0014042_400_987 186
120 3300049575 Ga0501039_0011236 Ga0501039_0011236_5906_6493 186
121 3300049576 Ga0501040_0191613 Ga0501040_0191613_29_616 186
122 3300049579 Ga0501043_0030678 Ga0501043_0030678_2654_3241 186
123 3300049580 Ga0501046_0002661 Ga0501046_0002661_9555_10142 186
124 3300049580 Ga0501046_0225580 Ga0501046_0225580_381_983 186
125 3300049581 Ga0501047_0019967 Ga0501047_0019967_412_999 186
126 3300049581 Ga0501047_0581025 Ga0501047_0581025_164_766 186
127 3300049582 Ga0501048_0314350 Ga0501048_0314350_13_600 186
128 3300049583 Ga0501067_0099241 Ga0501067_0099241_838_1425 186
129 3300049584 Ga0501068_0030886 Ga0501068_0030886_155_742 186
130 3300049586 Ga0501070_0498123 Ga0501070_0498123_155_757 186
131 3300049589 Ga0501073_0008997 Ga0501073_0008997_312_899 186
132 3300049590 Ga0501074_0018685 Ga0501074_0018685_775_1362 186
133 3300049741 Ga0501079_0903306 Ga0501079_0903306_72_659 186
134 3300049744 Ga0501083_0091115 Ga0501083_0091115_645_1232 186
135 3300049822 Ga0501035_0377028 Ga0501035_0377028_424_1011 186
136 3300049823 Ga0501044_0078127 Ga0501044_0078127_312_899 186
137 3300049823 Ga0501044_0262160 Ga0501044_0262160_173_775 186
138 3300053140 Ga0500573_0215508 Ga0500573_0215508_323_934 186
139 3300054114 Ga0501084_0134894 Ga0501084_0134894_696_1283 186
140 3300005616 Ga0068852_100983886 Ga0068852_1009838861 187
141 3300010375 Ga0105239_10363539 Ga0105239_103635392 187
142 3300031250 Ga0265331_10085008 Ga0265331_100850082 187
143 3300031728 Ga0316578_10264161 Ga0316578_102641612 187
144 3300035398 Ga0316574_0006309 Ga0316574_0006309_3390_3977 187
145 3300042142 Ga0450905_068236 Ga0450905_068236_12_584 187
146 3300049574 Ga0501038_0024783 Ga0501038_0024783_1123_1710 187
147 3300049578 Ga0501042_0432022 Ga0501042_0432022_285_872 187
148 3300049822 Ga0501035_0189243 Ga0501035_0189243_306_908 187
149 3300053085 Ga0495619_0734420 Ga0495619_0734420_45_608 187
150 3300005335 Ga0070666_10027094 Ga0070666_100270943 188
151 3300005355 Ga0070671_100083307 Ga0070671_1000833072 188
152 3300005364 Ga0070673_100018116 Ga0070673_1000181163 188
153 3300005367 Ga0070667_100021949 Ga0070667_1000219493 188
154 3300005539 Ga0068853_100595762 Ga0068853_1005957621 188
155 3300005548 Ga0070665_100151162 Ga0070665_1001511622 188
156 3300005834 Ga0068851_10007768 Ga0068851_100077683 188
157 3300005841 Ga0068863_100308966 Ga0068863_1003089662 188
158 3300005842 Ga0068858_100140539 Ga0068858_1001405392 188
159 3300005843 Ga0068860_100191059 Ga0068860_1001910592 188
160 3300009101 Ga0105247_10218752 Ga0105247_102187522 188
161 3300009545 Ga0105237_10192220 Ga0105237_101922202 188
162 3300025931 Ga0207644_10048650 Ga0207644_100486502 188
163 3300025949 Ga0207667_10416429 Ga0207667_104164292 188
164 3300025960 Ga0207651_11316976 Ga0207651_113169761 188
165 3300026035 Ga0207703_10080890 Ga0207703_100808902 188
166 3300026041 Ga0207639_10222426 Ga0207639_102224262 188
167 3300026142 Ga0207698_10085779 Ga0207698_100857791 188
168 3300046675 Ga0495657_0343904 Ga0495657_0343904_43_651 188
169 3300026142 Ga0207698_10954075 Ga0207698_109540752 189
170 3300044712 Ga0453684_0275236 Ga0453684_0275236_62_712 189
171 3300049742 Ga0501080_0015415 Ga0501080_0015415_3683_4270 189
172 iso_pu_bacteria 2571042365 2572254687 189
173 iso_pu_bacteria 2643221695 2644530411 189
174 3300053136 Ga0500559_0052981 Ga0500559_0052981_638_1219 190
175 iso_pu_bacteria 2643221577 2643896833 190
176 iso_pu_bacteria 2643221685 2644479038 190
177 3300003323 rootH1_10110933 rootH1_101109337 191
178 3300005289 Ga0065704_10394947 Ga0065704_103949471 191
179 3300005290 Ga0065712_10136839 Ga0065712_101368392 191
180 3300005293 Ga0065715_10009448 Ga0065715_100094483 191
181 3300005295 Ga0065707_10082271 Ga0065707_100822715 191
182 3300005295 Ga0065707_10171255 Ga0065707_101712551 191
183 3300005295 Ga0065707_10418652 Ga0065707_104186521 191
184 3300005328 Ga0070676_10138923 Ga0070676_101389232 191
185 3300005331 Ga0070670_100039018 Ga0070670_1000390182 191
186 3300005334 Ga0068869_100006863 Ga0068869_1000068634 191
187 3300005334 Ga0068869_100414881 Ga0068869_1004148812 191
188 3300005335 Ga0070666_10018125 Ga0070666_100181251 191
189 3300005338 Ga0068868_100283071 Ga0068868_1002830712 191
190 3300005340 Ga0070689_100001792 Ga0070689_10000179213 191
191 3300005344 Ga0070661_100002783 Ga0070661_1000027839 191
192 3300005347 Ga0070668_100064144 Ga0070668_1000641442 191
193 3300005353 Ga0070669_100011681 Ga0070669_1000116813 191
194 3300005353 Ga0070669_100347328 Ga0070669_1003473281 191
195 3300005354 Ga0070675_100007428 Ga0070675_1000074282 191
196 3300005354 Ga0070675_100017621 Ga0070675_1000176213 191
197 3300005356 Ga0070674_100016829 Ga0070674_1000168292 191
198 3300005356 Ga0070674_100439234 Ga0070674_1004392342 191
199 3300005364 Ga0070673_100015582 Ga0070673_1000155823 191
200 3300005365 Ga0070688_100022568 Ga0070688_1000225682 191
201 3300005438 Ga0070701_10044840 Ga0070701_100448402 191
202 3300005440 Ga0070705_100030509 Ga0070705_1000305092 191
203 3300005441 Ga0070700_100012796 Ga0070700_1000127964 191
204 3300005444 Ga0070694_100268031 Ga0070694_1002680312 191
205 3300005456 Ga0070678_100021459 Ga0070678_1000214591 191
206 3300005457 Ga0070662_100071818 Ga0070662_1000718182 191
207 3300005457 Ga0070662_100186994 Ga0070662_1001869942 191
208 3300005466 Ga0070685_10032672 Ga0070685_100326721 191
209 3300005535 Ga0070684_100000531 Ga0070684_10000053116 191
210 3300005543 Ga0070672_100004785 Ga0070672_1000047854 191
211 3300005544 Ga0070686_100006093 Ga0070686_1000060932 191
212 3300005547 Ga0070693_100052333 Ga0070693_1000523332 191
213 3300005548 Ga0070665_100072319 Ga0070665_1000723194 191
214 3300005564 Ga0070664_100018384 Ga0070664_1000183843 191
215 3300005577 Ga0068857_100011136 Ga0068857_1000111369 191
216 3300005577 Ga0068857_100062154 Ga0068857_1000621542 191
217 3300005615 Ga0070702_100002848 Ga0070702_1000028482 191
218 3300005617 Ga0068859_100341516 Ga0068859_1003415161 191
219 3300005618 Ga0068864_100017826 Ga0068864_1000178263 191
220 3300005719 Ga0068861_100003131 Ga0068861_1000031315 191
221 3300005719 Ga0068861_101210417 Ga0068861_1012104172 191
222 3300005840 Ga0068870_10003262 Ga0068870_100032623 191
223 3300005841 Ga0068863_100002472 Ga0068863_10000247213 191
224 3300005842 Ga0068858_100123255 Ga0068858_1001232553 191
225 3300005843 Ga0068860_100078868 Ga0068860_1000788682 191
226 3300005844 Ga0068862_100000444 Ga0068862_10000044423 191
227 3300005844 Ga0068862_100003520 Ga0068862_1000035202 191
228 3300005981 Ga0081538_10102868 Ga0081538_101028681 191
229 3300006237 Ga0097621_100012148 Ga0097621_1000121484 191
230 3300006358 Ga0068871_100046908 Ga0068871_1000469082 191
231 3300006844 Ga0075428_100010387 Ga0075428_1000103872 191
232 3300006844 Ga0075428_100504718 Ga0075428_1005047182 191
233 3300006844 Ga0075428_100575528 Ga0075428_1005755282 191
234 3300006846 Ga0075430_100002675 Ga0075430_1000026752 191
235 3300006846 Ga0075430_100037006 Ga0075430_1000370062 191
236 3300006846 Ga0075430_100334171 Ga0075430_1003341712 191
237 3300006847 Ga0075431_100036273 Ga0075431_1000362732 191
238 3300006847 Ga0075431_100478361 Ga0075431_1004783612 191
239 3300006852 Ga0075433_10782701 Ga0075433_107827011 191
240 3300006880 Ga0075429_100001256 Ga0075429_10000125616 191
241 3300006881 Ga0068865_100201948 Ga0068865_1002019482 191
242 3300006931 Ga0097620_100341492 Ga0097620_1003414921 191
243 3300009092 Ga0105250_10049752 Ga0105250_100497522 191
244 3300009094 Ga0111539_10057872 Ga0111539_100578723 191
245 3300009094 Ga0111539_10149624 Ga0111539_101496242 191
246 3300009147 Ga0114129_10001392 Ga0114129_1000139222 191
247 3300009177 Ga0105248_10016715 Ga0105248_100167157 191
248 3300009553 Ga0105249_10007299 Ga0105249_100072993 191
249 3300011119 Ga0105246_10219023 Ga0105246_102190232 191
250 3300013297 Ga0157378_10038247 Ga0157378_100382472 191
251 3300013306 Ga0163162_10099243 Ga0163162_100992432 191
252 3300013308 Ga0157375_10079768 Ga0157375_100797683 191
253 3300014325 Ga0163163_10008519 Ga0163163_100085197 191
254 3300014326 Ga0157380_10002817 Ga0157380_100028173 191
255 3300014326 Ga0157380_10020050 Ga0157380_100200507 191
256 3300014326 Ga0157380_10166649 Ga0157380_101666491 191
257 3300014326 Ga0157380_10588166 Ga0157380_105881662 191
258 3300014745 Ga0157377_10016970 Ga0157377_100169702 191
259 3300014969 Ga0157376_10176347 Ga0157376_101763472 191
260 3300017792 Ga0163161_10124807 Ga0163161_101248072 191
261 3300017792 Ga0163161_10592947 Ga0163161_105929472 191
262 3300025711 Ga0207696_1107559 Ga0207696_11075591 191
263 3300025901 Ga0207688_10006633 Ga0207688_100066338 191
264 3300025901 Ga0207688_10307109 Ga0207688_103071091 191
265 3300025903 Ga0207680_10046347 Ga0207680_100463472 191
266 3300025907 Ga0207645_10100511 Ga0207645_101005112 191
267 3300025908 Ga0207643_10011994 Ga0207643_100119943 191
268 3300025918 Ga0207662_10015882 Ga0207662_100158823 191
269 3300025920 Ga0207649_10116123 Ga0207649_101161232 191
270 3300025923 Ga0207681_10604479 Ga0207681_106044791 191
271 3300025925 Ga0207650_10130841 Ga0207650_101308412 191
272 3300025925 Ga0207650_10168276 Ga0207650_101682762 191
273 3300025926 Ga0207659_10021152 Ga0207659_100211523 191
274 3300025931 Ga0207644_10057830 Ga0207644_100578302 191
275 3300025933 Ga0207706_10023512 Ga0207706_100235123 191
276 3300025935 Ga0207709_10179586 Ga0207709_101795862 191
277 3300025936 Ga0207670_10009960 Ga0207670_100099602 191
278 3300025937 Ga0207669_10094141 Ga0207669_100941412 191
279 3300025938 Ga0207704_10042952 Ga0207704_100429522 191
280 3300025940 Ga0207691_10001891 Ga0207691_100018917 191
281 3300025941 Ga0207711_10056088 Ga0207711_100560882 191
282 3300025942 Ga0207689_10004017 Ga0207689_100040175 191
283 3300025942 Ga0207689_10461935 Ga0207689_104619352 191
284 3300025945 Ga0207679_10018032 Ga0207679_100180323 191
285 3300025960 Ga0207651_10112263 Ga0207651_101122632 191
286 3300025960 Ga0207651_10133688 Ga0207651_101336881 191
287 3300025961 Ga0207712_10861898 Ga0207712_108618981 191
288 3300025972 Ga0207668_10100371 Ga0207668_101003712 191
289 3300025972 Ga0207668_10440793 Ga0207668_104407932 191
290 3300025981 Ga0207640_10209841 Ga0207640_102098412 191
291 3300026035 Ga0207703_10069493 Ga0207703_100694932 191
292 3300026075 Ga0207708_10081957 Ga0207708_100819572 191
293 3300026088 Ga0207641_10011688 Ga0207641_100116884 191
294 3300026095 Ga0207676_10027715 Ga0207676_100277153 191
295 3300026116 Ga0207674_10023693 Ga0207674_100236932 191
296 3300026116 Ga0207674_10108197 Ga0207674_101081973 191
297 3300026118 Ga0207675_100011449 Ga0207675_1000114495 191
298 3300026118 Ga0207675_100016093 Ga0207675_1000160934 191
299 3300026118 Ga0207675_100021963 Ga0207675_1000219638 191
300 3300026142 Ga0207698_10625886 Ga0207698_106258862 191
301 3300027907 Ga0207428_10115937 Ga0207428_101159372 191
302 3300027907 Ga0207428_10192210 Ga0207428_101922102 191
303 3300028379 Ga0268266_10235644 Ga0268266_102356442 191
304 3300028380 Ga0268265_10001895 Ga0268265_100018959 191
305 3300028380 Ga0268265_10200333 Ga0268265_102003332 191
306 3300028381 Ga0268264_10115062 Ga0268264_101150622 191
307 3300028381 Ga0268264_10474033 Ga0268264_104740332 191
308 3300031548 Ga0307408_100102451 Ga0307408_1001024512 191
309 3300031548 Ga0307408_100122670 Ga0307408_1001226702 191
310 3300031548 Ga0307408_100599632 Ga0307408_1005996321 191
311 3300031731 Ga0307405_10027065 Ga0307405_100270652 191
312 3300031824 Ga0307413_10456953 Ga0307413_104569532 191
313 3300031852 Ga0307410_10069758 Ga0307410_100697583 191
314 3300031901 Ga0307406_10135844 Ga0307406_101358442 191
315 3300031911 Ga0307412_10011233 Ga0307412_100112333 191
316 3300031911 Ga0307412_10038038 Ga0307412_100380384 191
317 3300031911 Ga0307412_10226865 Ga0307412_102268652 191
318 3300031911 Ga0307412_10722473 Ga0307412_107224731 191
319 3300031995 Ga0307409_100464555 Ga0307409_1004645552 191
320 3300032002 Ga0307416_100014743 Ga0307416_1000147432 191
321 3300032002 Ga0307416_100273925 Ga0307416_1002739252 191
322 3300032004 Ga0307414_10966776 Ga0307414_109667761 191
323 3300032005 Ga0307411_10336845 Ga0307411_103368452 191
324 3300032005 Ga0307411_10433175 Ga0307411_104331752 191
325 3300032126 Ga0307415_100013848 Ga0307415_1000138484 191
326 3300032126 Ga0307415_100279803 Ga0307415_1002798032 191
327 3300035114 Ga0373939_0096966 Ga0373939_0096966_45_629 191
328 3300035242 Ga0373962_0158119 Ga0373962_0158119_86_670 191
329 3300042002 Ga0439442_025557 Ga0439442_025557_357_941 191
330 3300042013 Ga0439456_037407 Ga0439456_037407_152_736 191
331 3300042015 Ga0439462_0036341 Ga0439462_0036341_550_1134 191
332 3300042016 Ga0439463_068155 Ga0439463_068155_121_705 191
333 3300042122 Ga0450920_001622 Ga0450920_001622_1894_2478 191
334 3300042125 Ga0450923_001052 Ga0450923_001052_2843_3427 191
335 3300042125 Ga0450923_002489 Ga0450923_002489_1482_2066 191
336 3300042133 Ga0450896_000353 Ga0450896_000353_3316_3900 191
337 3300042133 Ga0450896_030379 Ga0450896_030379_147_731 191
338 3300042134 Ga0450898_007083 Ga0450898_007083_29_613 191
339 3300042134 Ga0450898_060096 Ga0450898_060096_132_716 191
340 3300042147 Ga0450910_003052 Ga0450910_003052_618_1202 191
341 3300042147 Ga0450910_008091 Ga0450910_008091_593_1177 191
342 3300042156 Ga0439446_0000178 Ga0439446_0000178_9054_9638 191
343 3300042156 Ga0439446_0129856 Ga0439446_0129856_24_608 191
344 3300042435 Ga0439434_0019384 Ga0439434_0019384_1082_1666 191
345 3300042436 Ga0439435_0010341 Ga0439435_0010341_1399_1983 191
346 3300042436 Ga0439435_0165185 Ga0439435_0165185_88_672 191
347 3300042461 Ga0439460_0013435 Ga0439460_0013435_334_918 191
348 3300042530 Ga0450916_025270 Ga0450916_025270_95_679 191
349 3300042531 Ga0450918_011032 Ga0450918_011032_701_1285 191
350 3300042531 Ga0450918_030058 Ga0450918_030058_135_719 191
351 3300045051 Ga0451576_0116465 Ga0451576_0116465_135_719 191
352 3300046460 Ga0495638_0009520 Ga0495638_0009520_936_1520 191
353 3300046517 Ga0495630_0109824 Ga0495630_0109824_301_882 191
354 3300046533 Ga0495640_0269204 Ga0495640_0269204_449_1036 191
355 3300046535 Ga0495586_0031171 Ga0495586_0031171_1371_1952 191
356 3300046616 Ga0495668_0206632 Ga0495668_0206632_269_853 191
357 3300046660 Ga0495625_0059514 Ga0495625_0059514_2030_2614 191
358 3300046690 Ga0495624_0346496 Ga0495624_0346496_227_808 191
359 3300048909 Ga0496106_0178523 Ga0496106_0178523_239_823 191
360 3300048913 Ga0496110_0821209 Ga0496110_0821209_71_655 191
361 3300048914 Ga0496111_0320202 Ga0496111_0320202_498_1082 191
362 3300048915 Ga0496112_0014495 Ga0496112_0014495_3591_4175 191
363 3300048916 Ga0496113_0115687 Ga0496113_0115687_58_642 191
364 3300048917 Ga0496114_0137874 Ga0496114_0137874_47_634 191
365 3300048924 Ga0496121_0027777 Ga0496121_0027777_4237_4821 191
366 3300049522 Ga0501299_015714 Ga0501299_015714_26_610 191
367 3300049523 Ga0501300_015709 Ga0501300_015709_410_994 191
368 3300049524 Ga0501301_012949 Ga0501301_012949_122_706 191
369 3300049568 Ga0501031_0159332 Ga0501031_0159332_483_1067 191
370 3300049569 Ga0501032_0291802 Ga0501032_0291802_329_913 191
371 3300049572 Ga0501036_0023698 Ga0501036_0023698_3206_3790 191
372 3300049573 Ga0501037_0100106 Ga0501037_0100106_970_1554 191
373 3300049574 Ga0501038_0040077 Ga0501038_0040077_1422_2006 191
374 3300049575 Ga0501039_0005001 Ga0501039_0005001_1937_2521 191
375 3300049575 Ga0501039_0160469 Ga0501039_0160469_1000_1584 191
376 3300049575 Ga0501039_0262503 Ga0501039_0262503_663_1247 191
377 3300049575 Ga0501039_0314916 Ga0501039_0314916_78_662 191
378 3300049576 Ga0501040_0030186 Ga0501040_0030186_2470_3054 191
379 3300049576 Ga0501040_0041347 Ga0501040_0041347_2407_2991 191
380 3300049577 Ga0501041_0085229 Ga0501041_0085229_1182_1766 191
381 3300049577 Ga0501041_0090484 Ga0501041_0090484_254_838 191
382 3300049577 Ga0501041_0285174 Ga0501041_0285174_413_997 191
383 3300049578 Ga0501042_0055657 Ga0501042_0055657_1231_1815 191
384 3300049578 Ga0501042_0221103 Ga0501042_0221103_582_1166 191
385 3300049580 Ga0501046_0056726 Ga0501046_0056726_438_1022 191
386 3300049583 Ga0501067_0013431 Ga0501067_0013431_981_1565 191
387 3300049583 Ga0501067_0149359 Ga0501067_0149359_529_1119 191
388 3300049585 Ga0501069_0086002 Ga0501069_0086002_289_873 191
389 3300049587 Ga0501071_0008854 Ga0501071_0008854_2043_2627 191
390 3300049587 Ga0501071_0057503 Ga0501071_0057503_819_1403 191
391 3300049587 Ga0501071_0126341 Ga0501071_0126341_709_1293 191
392 3300049589 Ga0501073_0017008 Ga0501073_0017008_2220_2804 191
393 3300049589 Ga0501073_0077091 Ga0501073_0077091_1116_1700 191
394 3300049589 Ga0501073_0485396 Ga0501073_0485396_215_799 191
395 3300049590 Ga0501074_0303745 Ga0501074_0303745_175_759 191
396 3300049591 Ga0501075_0021462 Ga0501075_0021462_1204_1788 191
397 3300049591 Ga0501075_0054327 Ga0501075_0054327_1874_2458 191
398 3300049591 Ga0501075_0097123 Ga0501075_0097123_1036_1620 191
399 3300049592 Ga0501076_0072658 Ga0501076_0072658_1997_2581 191
400 3300049592 Ga0501076_0174020 Ga0501076_0174020_12_596 191
401 3300049592 Ga0501076_0308004 Ga0501076_0308004_263_847 191
402 3300049593 Ga0501077_0026028 Ga0501077_0026028_1950_2534 191
403 3300049593 Ga0501077_0383612 Ga0501077_0383612_262_846 191
404 3300049655 Ga0501208_002223 Ga0501208_002223_1361_1957 191
405 3300049741 Ga0501079_0047893 Ga0501079_0047893_2236_2820 191
406 3300049741 Ga0501079_0192343 Ga0501079_0192343_450_1034 191
407 3300049741 Ga0501079_0203980 Ga0501079_0203980_608_1192 191
408 3300049741 Ga0501079_0249420 Ga0501079_0249420_346_930 191
409 3300049743 Ga0501081_0016037 Ga0501081_0016037_1864_2448 191
410 3300049743 Ga0501081_0047391 Ga0501081_0047391_464_1048 191
411 3300049743 Ga0501081_0207569 Ga0501081_0207569_828_1412 191
412 3300049822 Ga0501035_0576269 Ga0501035_0576269_270_854 191
413 3300049822 Ga0501035_0721715 Ga0501035_0721715_186_770 191
414 3300049823 Ga0501044_1099859 Ga0501044_1099859_26_610 191
415 3300049824 Ga0501045_0059434 Ga0501045_0059434_1342_1926 191
416 3300049824 Ga0501045_0094035 Ga0501045_0094035_1502_2086 191
417 3300050507 nmdc:mga05p37_1259_c1 nmdc:mga05p37_1259_c1_19473_20057 191
418 3300050508 nmdc:mga09592_132415_c1 nmdc:mga09592_132415_c1_935_1519 191
419 3300050508 nmdc:mga09592_960_c1 nmdc:mga09592_960_c1_2847_3431 191
420 3300050509 nmdc:mga0qj67_121932_c1 nmdc:mga0qj67_121932_c1_642_1226 191
421 3300050509 nmdc:mga0qj67_2202_c1 nmdc:mga0qj67_2202_c1_3122_3706 191
422 3300050510 nmdc:mga06r32_19902_c1 nmdc:mga06r32_19902_c1_4067_4651 191
423 3300050510 nmdc:mga06r32_227796_c1 nmdc:mga06r32_227796_c1_1258_1842 191
424 3300050510 nmdc:mga06r32_444957_c1 nmdc:mga06r32_444957_c1_630_1214 191
425 3300050510 nmdc:mga06r32_5694_c1 nmdc:mga06r32_5694_c1_1987_2571 191
426 3300050510 nmdc:mga06r32_84738_c1 nmdc:mga06r32_84738_c1_2455_3039 191
427 3300050511 nmdc:mga08y16_263181_c1 nmdc:mga08y16_263181_c1_484_1068 191
428 3300050511 nmdc:mga08y16_760276_c1 nmdc:mga08y16_760276_c1_205_789 191
429 3300050515 nmdc:mga0a205_667508_c1 nmdc:mga0a205_667508_c1_28_612 191
430 3300054114 Ga0501084_0021439 Ga0501084_0021439_2057_2641 191
431 3300054114 Ga0501084_0214325 Ga0501084_0214325_851_1435 191
432 3300060353 Ga0501082_0004506 Ga0501082_0004506_2047_2631 191
433 3300060353 Ga0501082_0019334 Ga0501082_0019334_911_1495 191
434 3300060353 Ga0501082_0355618 Ga0501082_0355618_610_1194 191
435 3300060353 Ga0501082_0492805 Ga0501082_0492805_437_1021 191
436 3300060353 Ga0501082_0572194 Ga0501082_0572194_119_703 191
437 3300061734 Ga0530510_0057977 Ga0530510_0057977_1290_1874 191
438 3300061734 Ga0530510_0286996 Ga0530510_0286996_122_706 191
439 3300005290 Ga0065712_10273480 Ga0065712_102734802 192
440 3300005293 Ga0065715_10306465 Ga0065715_103064652 192
441 3300005331 Ga0070670_100209720 Ga0070670_1002097202 192
442 3300005334 Ga0068869_100384888 Ga0068869_1003848881 192
443 3300005438 Ga0070701_10423798 Ga0070701_104237981 192
444 3300005439 Ga0070711_100569297 Ga0070711_1005692971 192
445 3300005577 Ga0068857_100486181 Ga0068857_1004861811 192
446 3300005617 Ga0068859_100043672 Ga0068859_1000436721 192
447 3300005618 Ga0068864_100207660 Ga0068864_1002076603 192
448 3300005841 Ga0068863_100038589 Ga0068863_1000385894 192
449 3300005841 Ga0068863_100068076 Ga0068863_1000680764 192
450 3300005983 Ga0081540_1008676 Ga0081540_10086768 192
451 3300006931 Ga0097620_100043673 Ga0097620_1000436731 192
452 3300009177 Ga0105248_10105783 Ga0105248_101057833 192
453 3300009177 Ga0105248_10238337 Ga0105248_102383372 192
454 3300009553 Ga0105249_10288331 Ga0105249_102883312 192
455 3300011119 Ga0105246_10657674 Ga0105246_106576742 192
456 3300013104 Ga0157370_10827318 Ga0157370_108273181 192
457 3300013296 Ga0157374_10658585 Ga0157374_106585852 192
458 3300013297 Ga0157378_10385066 Ga0157378_103850662 192
459 3300014326 Ga0157380_10199208 Ga0157380_101992082 192
460 3300014969 Ga0157376_10285127 Ga0157376_102851272 192
461 3300025916 Ga0207663_10343489 Ga0207663_103434892 192
462 3300025919 Ga0207657_10593766 Ga0207657_105937662 192
463 3300025925 Ga0207650_10347220 Ga0207650_103472202 192
464 3300025927 Ga0207687_10505703 Ga0207687_105057031 192
465 3300025944 Ga0207661_10289099 Ga0207661_102890992 192
466 3300026089 Ga0207648_10172604 Ga0207648_101726043 192
467 3300026095 Ga0207676_10023142 Ga0207676_100231423 192
468 3300026118 Ga0207675_100474460 Ga0207675_1004744602 192
469 3300027364 Ga0209967_1002913 Ga0209967_10029132 192
470 3300028380 Ga0268265_10014776 Ga0268265_100147764 192
471 3300028653 Ga0265323_10043849 Ga0265323_100438491 192
472 3300030731 Ga0316177_1002664 Ga0316177_10026642 192
473 3300030732 Ga0316176_1216601 Ga0316176_12166011 192
474 3300030733 Ga0314311_1264832 Ga0314311_12648322 192
475 3300030735 Ga0316178_1087300 Ga0316178_10873002 192
476 3300031344 Ga0265316_10075444 Ga0265316_100754441 192
477 3300031712 Ga0265342_10273331 Ga0265342_102733311 192
478 3300031730 Ga0307516_10355145 Ga0307516_103551452 192
479 3300031824 Ga0307413_10209326 Ga0307413_102093261 192
480 3300031824 Ga0307413_10290049 Ga0307413_102900492 192
481 3300031852 Ga0307410_10338108 Ga0307410_103381082 192
482 3300032004 Ga0307414_10015964 Ga0307414_100159644 192
483 3300032004 Ga0307414_10035256 Ga0307414_100352562 192
484 3300032004 Ga0307414_10038249 Ga0307414_100382492 192
485 3300032004 Ga0307414_10093162 Ga0307414_100931622 192
486 3300032004 Ga0307414_10198944 Ga0307414_101989442 192
487 3300032004 Ga0307414_10845751 Ga0307414_108457511 192
488 3300032005 Ga0307411_10195196 Ga0307411_101951961 192
489 3300039062 Ga0400483_237371 Ga0400483_237371_5538_6125 192
490 3300041404 Ga0439436_0091254 Ga0439436_0091254_10_606 192
491 3300041406 Ga0439439_0017147 Ga0439439_0017147_215_811 192
492 3300041503 Ga0451847_0627597 Ga0451847_0627597_324_911 192
493 3300042006 Ga0439432_011614 Ga0439432_011614_560_1156 192
494 3300042007 Ga0439449_0053008 Ga0439449_0053008_195_791 192
495 3300042015 Ga0439462_0009379 Ga0439462_0009379_1580_2176 192
496 3300042145 Ga0450906_044703 Ga0450906_044703_53_649 192
497 3300042156 Ga0439446_0000028 Ga0439446_0000028_2034_2630 192
498 3300045051 Ga0451576_0301636 Ga0451576_0301636_989_1576 192
499 3300046535 Ga0495586_0333030 Ga0495586_0333030_158_754 192
500 3300046681 Ga0495647_0285653 Ga0495647_0285653_132_719 192
501 3300046681 Ga0495647_0293188 Ga0495647_0293188_98_685 192
502 3300046691 Ga0495670_0054740 Ga0495670_0054740_58_654 192
503 3300047322 Ga0495680_0402936 Ga0495680_0402936_227_814 192
504 3300047472 Ga0495686_0004699 Ga0495686_0004699_7339_7926 192
505 3300048921 Ga0496118_0000513 Ga0496118_0000513_58287_58874 192
506 3300048929 Ga0496126_0401838 Ga0496126_0401838_209_796 192
507 3300049586 Ga0501070_0143110 Ga0501070_0143110_1081_1668 192
508 3300049674 Ga0501242_024419 Ga0501242_024419_37_633 192
509 3300049742 Ga0501080_0345853 Ga0501080_0345853_611_1198 192
510 3300049775 Ga0501279_018635 Ga0501279_018635_186_782 192
511 3300053079 Ga0500610_0001963 Ga0500610_0001963_1715_2302 192
512 3300053080 Ga0500635_0151449 Ga0500635_0151449_67_654 192
513 3300053087 Ga0500643_014094 Ga0500643_014094_290_877 192
514 3300053120 Ga0500597_061536 Ga0500597_061536_513_1100 192
515 3300060353 Ga0501082_0001130 Ga0501082_0001130_4996_5583 192
516 3300032133 Ga0316583_10188631 Ga0316583_101886311 193
517 3300042007 Ga0439449_0070960 Ga0439449_0070960_415_1020 194
518 iso_pu_bacteria 2920107658 2920109520 194
519 3300053103 Ga0500555_000003 Ga0500555_000003_76674_77267 195
520 3300053153 Ga0500616_0024825 Ga0500616_0024825_1228_1821 195
521 3300006847 Ga0075431_100236133 Ga0075431_1002361332 196
522 3300006880 Ga0075429_100713182 Ga0075429_1007131821 196
523 3300050508 nmdc:mga09592_473564_c1 nmdc:mga09592_473564_c1_92_697 196
524 3300050510 nmdc:mga06r32_65685_c1 nmdc:mga06r32_65685_c1_2458_3063 196
525 3300005272 Ga0065703_1020324 Ga0065703_10203242 197
526 3300005340 Ga0070689_100107373 Ga0070689_1001073733 197
527 3300005440 Ga0070705_100079135 Ga0070705_1000791352 197
528 3300005544 Ga0070686_100094357 Ga0070686_1000943572 197
529 3300005547 Ga0070693_100635625 Ga0070693_1006356251 197
530 3300006175 Ga0070712_100199407 Ga0070712_1001994072 197
531 3300009098 Ga0105245_10849780 Ga0105245_108497801 197
532 3300014969 Ga0157376_10230563 Ga0157376_102305632 197
533 3300035170 Ga0373943_0645631 Ga0373943_0645631_22_615 197
534 3300049742 Ga0501080_0262376 Ga0501080_0262376_347_1039 198
535 3300000545 CNXas_1000896 CNXas_10008962 199
536 3300031456 Ga0307513_10028087 Ga0307513_100280874 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

69

229

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.8615 28 184
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.828 28 184
2lqg-assembly1.cif.gz_A solution structure of the r4 domain of talin 0.7028 37 156
7ocf-assembly1.cif.gz_J active state glua1/a2 ampa receptor in complex with tarp gamma 8 and cnih2 (lbd-tmd) 0.6307 68 153
2lqg-assembly1.cif.gz_A solution structure of the r4 domain of talin 0.6215 37 156
ID Description Score Start End Superfamily
4iggA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.8999 62 122 1.10.287.160
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.859 20 199 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8497 20 199 1.20.1440.20
4iggA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.8114 62 122 1.10.287.160
4onsC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7809 35 122 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A076MQI9-F1-model_v4 LemA family protein 0.9925 5 169 GO:0016020
AF-A0A293NEM5-F1-model_v4 LemA family protein 0.984 3 182 GO:0016020
AF-A0A7C3RR29-F1-model_v4 LemA family protein 0.9787 5 194 GO:0016020
AF-A0A076MQI9-F1-model_v4 LemA family protein 0.9749 5 169 GO:0016020
AF-A0A848Z4X2-F1-model_v4 LemA family protein 0.973 1 185 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.56 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map