F460744

General Info

Members Datasets Scaffolds Average Seq Length
536 268 1072 330

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10063114|Ga0070691_100631142
Length 374
Sequence VKGRRIGATGEARGARRFLSRWKGLVRRTDIRYNKAIKIFVLYDWYQHIYFGQPVFFWLLLLVPLLIWWELKRDSAGQATVMVSSVRAFRGTRSWKNFLRPLLFILRLLTLVCLIIALARPQTHNDEQITNGEGIDIVLCLDISGSMLAQDFSPNRMEAAKNVAAEFIDNRPTDRIGLVIFSGEAFTMCPLTTDRNMLKSQLYSVQSGLLEDGTAIGSGLATGVDRLRNSPSKSKVIILLTDGENNGGLIDPNTAKEIAKSLGVKVYTVGMGTEGFAPVPVQTPNGVVMQREKVNIDEKLLTQIANETGGHYYRAKDNESLKDIYAEINRLEKSKIEITTNRRYAEQFFPFALAAALALFLELLLRWTVLRKFP

Samples

Sample ID Description Type Environment
1 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
155 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
156 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
193 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
194 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
195 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
196 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
197 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
220 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
231 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
232 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
233 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
234 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
235 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
238 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
239 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
240 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
241 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
242 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
243 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
257 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
258 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
259 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
265 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.99
Nodule 0
Rhizoplane 0.19
Rhizosphere 92.91
Stem 0
Stem Tuber 0
Unclassified 11.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070691_10063114 3300005341 Bacteria 1785
2 MRS1b_contig_6539228 2162886011 Unclassified 2232
3 rootH2_10012186 3300003320 Unclassified 2905
4 rootH2_10013956 3300003320 Bacteria 4923
5 rootH2_10015028 3300003320 Bacteria 19607
6 rootH2_10078726 3300003320 Bacteria 5368
7 rootH2_10110194 3300003320 Bacteria 9850
8 rootH1_10272168 3300003323 Bacteria 1224
9 rootH1_10377752 3300003323 Bacteria 1484
10 Ga0065714_10009854 3300005288 Bacteria 3705
11 Ga0065714_10016649 3300005288 Bacteria 2620
12 Ga0065704_10119013 3300005289 Bacteria 1806
13 Ga0065712_10069204 3300005290 Bacteria 7737
14 Ga0065712_10103470 3300005290 Bacteria 1984
15 Ga0065707_10087330 3300005295 Bacteria 5071
16 Ga0070676_10000064 3300005328 Bacteria 35148
17 Ga0070676_10113080 3300005328 Bacteria 1693
18 Ga0070683_100002318 3300005329 Bacteria 15100
19 Ga0070683_100003049 3300005329 Bacteria 13472
20 Ga0070690_100164835 3300005330 Bacteria 1521
21 Ga0070670_100018539 3300005331 Bacteria 5971
22 Ga0070670_100045308 3300005331 Bacteria 3780
23 Ga0070670_100068785 3300005331 Bacteria 3039
24 Ga0068869_100005945 3300005334 Bacteria 7712
25 Ga0070666_10000301 3300005335 Bacteria 31985
26 Ga0070666_10001016 3300005335 Bacteria 17198
27 Ga0070666_10074673 3300005335 Bacteria 2311
28 Ga0070682_100003563 3300005337 Bacteria 8616
29 Ga0068868_100002193 3300005338 Bacteria 13467
30 Ga0068868_100006992 3300005338 Bacteria 8022
31 Ga0068868_100148992 3300005338 Bacteria 1926
32 Ga0068868_100151701 3300005338 Bacteria 1908
33 Ga0068868_100215144 3300005338 Unclassified 1607
34 Ga0070689_100011825 3300005340 Bacteria 6265
35 Ga0070689_100250172 3300005340 Bacteria 1462
36 Ga0070691_10017659 3300005341 Bacteria 3283
37 Ga0070661_100035682 3300005344 Bacteria 3612
38 Ga0070661_100050568 3300005344 Bacteria 3041
39 Ga0070668_100000222 3300005347 Bacteria 36600
40 Ga0070668_100059867 3300005347 Unclassified 2948
41 Ga0070669_100002930 3300005353 Bacteria 12298
42 Ga0070669_100062761 3300005353 Bacteria 2733
43 Ga0070669_100286597 3300005353 Bacteria 1321
44 Ga0070675_100001118 3300005354 Bacteria 19352
45 Ga0070675_100017171 3300005354 Bacteria 5752
46 Ga0070675_100049542 3300005354 Bacteria 3448
47 Ga0070671_100007427 3300005355 Bacteria 8760
48 Ga0070671_100017140 3300005355 Bacteria 5861
49 Ga0070671_100024975 3300005355 Bacteria 4897
50 Ga0070671_100155084 3300005355 Bacteria 1935
51 Ga0070674_100023269 3300005356 Bacteria 4008
52 Ga0070674_100364199 3300005356 Bacteria 1171
53 Ga0070673_100000197 3300005364 Bacteria 29830
54 Ga0070673_100005388 3300005364 Bacteria 8179
55 Ga0070673_100021021 3300005364 Bacteria 4721
56 Ga0070673_100105098 3300005364 Bacteria 2332
57 Ga0070688_100022052 3300005365 Bacteria 3726
58 Ga0070688_100063954 3300005365 Bacteria 2334
59 Ga0070688_100169268 3300005365 Unclassified 1506
60 Ga0070659_100003766 3300005366 Bacteria 10819
61 Ga0070667_100000240 3300005367 Bacteria 62100
62 Ga0070667_100006066 3300005367 Bacteria 10034
63 Ga0070667_100019873 3300005367 Bacteria 5573
64 Ga0070667_100186303 3300005367 Bacteria 1837
65 Ga0070701_10010078 3300005438 Bacteria 4166
66 Ga0070711_100007160 3300005439 Bacteria 6772
67 Ga0070705_100077332 3300005440 Unclassified 2032
68 Ga0070700_100015391 3300005441 Bacteria 4336
69 Ga0070700_100077957 3300005441 Bacteria 2132
70 Ga0070708_100285638 3300005445 Unclassified 1553
71 Ga0070663_100248424 3300005455 Bacteria 1407
72 Ga0070678_100019978 3300005456 Bacteria 4384
73 Ga0070678_100100326 3300005456 Bacteria 2242
74 Ga0070662_100006697 3300005457 Bacteria 7444
75 Ga0070662_100006827 3300005457 Bacteria 7379
76 Ga0070662_100150604 3300005457 Bacteria 1811
77 Ga0070681_10189823 3300005458 Unclassified 1974
78 Ga0068867_100018038 3300005459 Bacteria 5015
79 Ga0070685_10301821 3300005466 Bacteria 1079
80 Ga0070679_100048614 3300005530 Bacteria 4225
81 Ga0070684_100018160 3300005535 Bacteria 5788
82 Ga0068853_100002568 3300005539 Bacteria 13649
83 Ga0068853_100003080 3300005539 Bacteria 12739
84 Ga0068853_100056506 3300005539 Unclassified 3384
85 Ga0068853_100083422 3300005539 Bacteria 2800
86 Ga0068853_100182957 3300005539 Bacteria 1901
87 Ga0068853_100243725 3300005539 Bacteria 1648
88 Ga0068853_100493790 3300005539 Bacteria 1155
89 Ga0070672_100008792 3300005543 Bacteria 6934
90 Ga0070672_100058630 3300005543 Bacteria 3027
91 Ga0070672_100088744 3300005543 Bacteria 2490
92 Ga0070672_100205764 3300005543 Bacteria 1647
93 Ga0070686_100088039 3300005544 Bacteria 2071
94 Ga0070693_100157577 3300005547 Bacteria 1443
95 Ga0070665_100000037 3300005548 Bacteria 312727
96 Ga0070665_100000805 3300005548 Bacteria 41003
97 Ga0068855_100002301 3300005563 Bacteria 23616
98 Ga0068855_100016778 3300005563 Bacteria 8806
99 Ga0070664_100000575 3300005564 Bacteria 27949
100 Ga0070664_100092413 3300005564 Bacteria 2620
101 Ga0070664_100092759 3300005564 Unclassified 2615
102 Ga0068857_100013599 3300005577 Bacteria 7090
103 Ga0068854_100114356 3300005578 Bacteria 2040
104 Ga0068856_100099473 3300005614 Bacteria 2899
105 Ga0068856_100150130 3300005614 Unclassified 2339
106 Ga0068856_100548335 3300005614 Bacteria 1177
107 Ga0070702_100028076 3300005615 Bacteria 3045
108 Ga0068852_100003210 3300005616 Bacteria 11418
109 Ga0068852_100010126 3300005616 Bacteria 7022
110 Ga0068852_100089812 3300005616 Bacteria 2746
111 Ga0068852_100110925 3300005616 Bacteria 2494
112 Ga0068852_100273374 3300005616 Bacteria 1626
113 Ga0068859_100000006 3300005617 Bacteria 421509
114 Ga0068859_100006362 3300005617 Bacteria 11981
115 Ga0068859_100006790 3300005617 Bacteria 11629
116 Ga0068859_100144875 3300005617 Bacteria 2450
117 Ga0068864_100027798 3300005618 Bacteria 4780
118 Ga0068864_100082230 3300005618 Bacteria 2825
119 Ga0068864_100108772 3300005618 Unclassified 2467
120 Ga0068864_100385333 3300005618 Bacteria 1329
121 Ga0068861_100002834 3300005719 Bacteria 11403
122 Ga0068861_100265978 3300005719 Bacteria 1470
123 Ga0068851_10001240 3300005834 Bacteria 11085
124 Ga0068851_10002872 3300005834 Bacteria 7612
125 Ga0068851_10033377 3300005834 Bacteria 2565
126 Ga0068870_10006453 3300005840 Bacteria 5172
127 Ga0068863_100000854 3300005841 Bacteria 30394
128 Ga0068863_100003034 3300005841 Bacteria 16603
129 Ga0068863_100029070 3300005841 Bacteria 5279
130 Ga0068863_100103952 3300005841 Bacteria 2702
131 Ga0068858_100000889 3300005842 Bacteria 31013
132 Ga0068858_100005950 3300005842 Bacteria 11912
133 Ga0068858_100066324 3300005842 Bacteria 3341
134 Ga0068858_100137448 3300005842 Bacteria 2294
135 Ga0068858_100449899 3300005842 Unclassified 1241
136 Ga0068860_100000064 3300005843 Bacteria 189323
137 Ga0068860_100001345 3300005843 Bacteria 26726
138 Ga0068860_100004206 3300005843 Bacteria 14751
139 Ga0068860_100007968 3300005843 Bacteria 10566
140 Ga0068862_100006209 3300005844 Bacteria 9952
141 Ga0081540_1034457 3300005983 Unclassified 2730
142 Ga0081539_10011293 3300005985 Bacteria 7091
143 Ga0070715_10116955 3300006163 Unclassified 1266
144 Ga0070712_100012555 3300006175 Bacteria 5386
145 Ga0075366_10023820 3300006195 Bacteria 3567
146 Ga0075366_10080374 3300006195 Bacteria 1947
147 Ga0097621_100001217 3300006237 Bacteria 17815
148 Ga0097621_100076320 3300006237 Bacteria 2780
149 Ga0068871_100002593 3300006358 Bacteria 12331
150 Ga0068871_100024170 3300006358 Unclassified 4708
151 Ga0068871_100063501 3300006358 Bacteria 3021
152 Ga0075430_100078110 3300006846 Bacteria 2775
153 Ga0075429_100055833 3300006880 Bacteria 3437
154 Ga0075429_100132006 3300006880 Unclassified 2185
155 Ga0068865_100013175 3300006881 Bacteria 5219
156 Ga0068865_100015113 3300006881 Bacteria 4919
157 Ga0068865_100168835 3300006881 Bacteria 1675
158 Ga0097620_100000006 3300006931 Bacteria 421509
159 Ga0097620_100006362 3300006931 Bacteria 11981
160 Ga0097620_100006790 3300006931 Bacteria 11629
161 Ga0097620_100144877 3300006931 Bacteria 2450
162 Ga0105240_10000457 3300009093 Bacteria 75275
163 Ga0105240_10004365 3300009093 Bacteria 21587
164 Ga0105240_10046824 3300009093 Bacteria 5476
165 Ga0105240_10074162 3300009093 Bacteria 4200
166 Ga0111539_10002482 3300009094 Bacteria 24467
167 Ga0111539_10020513 3300009094 Bacteria 8139
168 Ga0111539_10057252 3300009094 Bacteria 4630
169 Ga0111539_10078151 3300009094 Unclassified 3894
170 Ga0111539_10140345 3300009094 Archaea 2829
171 Ga0105247_10053065 3300009101 Bacteria 2500
172 Ga0114129_10046638 3300009147 Bacteria 6089
173 Ga0114129_10049053 3300009147 Bacteria 5933
174 Ga0105243_10026564 3300009148 Unclassified 4432
175 Ga0105243_10039003 3300009148 Bacteria 3702
176 Ga0105241_10015210 3300009174 Bacteria 5636
177 Ga0105241_10020383 3300009174 Bacteria 4898
178 Ga0105242_10034779 3300009176 Bacteria 4040
179 Ga0105248_10013442 3300009177 Bacteria 9012
180 Ga0105248_10239182 3300009177 Bacteria 2044
181 Ga0105248_10374392 3300009177 Bacteria 1603
182 Ga0105237_10003940 3300009545 Bacteria 17384
183 Ga0105237_10011351 3300009545 Bacteria 9426
184 Ga0105237_10014059 3300009545 Bacteria 8375
185 Ga0105237_10014983 3300009545 Bacteria 8081
186 Ga0105237_10018157 3300009545 Bacteria 7282
187 Ga0105237_10052052 3300009545 Bacteria 4111
188 Ga0105237_10180949 3300009545 Bacteria 2108
189 Ga0105237_10466156 3300009545 Bacteria 1269
190 Ga0105238_10006655 3300009551 Bacteria 11524
191 Ga0105238_10052228 3300009551 Bacteria 4109
192 Ga0105238_10091344 3300009551 Unclassified 3032
193 Ga0105249_10000382 3300009553 Bacteria 44030
194 Ga0105249_10010506 3300009553 Bacteria 8135
195 Ga0105249_10012752 3300009553 Bacteria 7409
196 Ga0105239_10000283 3300010375 Bacteria 74612
197 Ga0105239_10002212 3300010375 Bacteria 24980
198 Ga0105239_10002422 3300010375 Bacteria 23765
199 Ga0105239_10015511 3300010375 Bacteria 8438
200 Ga0105239_10296529 3300010375 Unclassified 1821
201 Ga0105239_10309811 3300010375 Unclassified 1779
202 Ga0105246_10098077 3300011119 Bacteria 2128
203 Ga0157373_10047559 3300013100 Unclassified 3059
204 Ga0157371_10057427 3300013102 Bacteria 2760
205 Ga0157371_10162356 3300013102 Bacteria 1596
206 Ga0157370_10028521 3300013104 Bacteria 5488
207 Ga0157370_10030174 3300013104 Bacteria 5315
208 Ga0157370_10032354 3300013104 Bacteria 5107
209 Ga0157370_10359479 3300013104 Unclassified 1342
210 Ga0157369_10081170 3300013105 Bacteria 3471
211 Ga0157369_10131206 3300013105 Unclassified 2655
212 Ga0157369_10576856 3300013105 Bacteria 1162
213 Ga0157374_10000311 3300013296 Bacteria 45181
214 Ga0157374_10008233 3300013296 Bacteria 8909
215 Ga0157378_10005516 3300013297 Bacteria 11087
216 Ga0157378_10008769 3300013297 Bacteria 8804
217 Ga0157378_10018424 3300013297 Bacteria 6131
218 Ga0157378_10072283 3300013297 Bacteria 3099
219 Ga0157378_10133149 3300013297 Bacteria 2303
220 Ga0157378_10220063 3300013297 Bacteria 1804
221 Ga0163162_10000175 3300013306 Bacteria 59209
222 Ga0163162_10001206 3300013306 Bacteria 24134
223 Ga0163162_10002221 3300013306 Bacteria 18233
224 Ga0163162_10006923 3300013306 Bacteria 10993
225 Ga0163162_10200818 3300013306 Bacteria 2122
226 Ga0163162_10480165 3300013306 Bacteria 1374
227 Ga0157372_10004531 3300013307 Bacteria 14808
228 Ga0157372_10016944 3300013307 Bacteria 7823
229 Ga0157372_10035513 3300013307 Bacteria 5488
230 Ga0157372_10053754 3300013307 Bacteria 4490
231 Ga0157372_10065725 3300013307 Bacteria 4073
232 Ga0157372_10089805 3300013307 Unclassified 3491
233 Ga0157372_10239288 3300013307 Bacteria 2106
234 Ga0157372_10244342 3300013307 Bacteria 2083
235 Ga0157372_10399258 3300013307 Bacteria 1602
236 Ga0157375_10000748 3300013308 Bacteria 28547
237 Ga0157375_10000773 3300013308 Bacteria 28047
238 Ga0157375_10156893 3300013308 Bacteria 2415
239 Ga0163163_10000202 3300014325 Bacteria 61701
240 Ga0163163_10000369 3300014325 Bacteria 43150
241 Ga0163163_10007952 3300014325 Bacteria 9378
242 Ga0157380_10004286 3300014326 Bacteria 9876
243 Ga0157380_10015400 3300014326 Bacteria 5620
244 Ga0157377_10006522 3300014745 Bacteria 5570
245 Ga0157377_10028710 3300014745 Bacteria 2996
246 Ga0157377_10068087 3300014745 Bacteria 2051
247 Ga0157379_10001465 3300014968 Bacteria 19448
248 Ga0157379_10006306 3300014968 Bacteria 10215
249 Ga0157379_10035570 3300014968 Bacteria 4441
250 Ga0157376_10000842 3300014969 Bacteria 20112
251 Ga0157376_10003719 3300014969 Bacteria 10545
252 Ga0157376_10004771 3300014969 Bacteria 9432
253 Ga0157376_10014822 3300014969 Bacteria 5868
254 Ga0157376_10094571 3300014969 Unclassified 2597
255 Ga0163161_10011062 3300017792 Bacteria 6250
256 Ga0163161_10264374 3300017792 Bacteria 1344
257 Ga0207697_10032906 3300025315 Bacteria 2123
258 Ga0207656_10010415 3300025321 Unclassified 3483
259 Ga0207680_10000855 3300025903 Bacteria 14362
260 Ga0207680_10019113 3300025903 Unclassified 3660
261 Ga0207647_10000096 3300025904 Bacteria 67468
262 Ga0207647_10114182 3300025904 Unclassified 1596
263 Ga0207645_10001164 3300025907 Bacteria 21705
264 Ga0207645_10132815 3300025907 Bacteria 1621
265 Ga0207705_10005354 3300025909 Bacteria 9593
266 Ga0207654_10001346 3300025911 Bacteria 13038
267 Ga0207654_10001813 3300025911 Bacteria 11092
268 Ga0207654_10048772 3300025911 Bacteria 2425
269 Ga0207695_10000051 3300025913 Bacteria 399641
270 Ga0207695_10000056 3300025913 Bacteria 382433
271 Ga0207695_10000066 3300025913 Bacteria 334103
272 Ga0207695_10000081 3300025913 Bacteria 284797
273 Ga0207695_10000156 3300025913 Bacteria 204576
274 Ga0207695_10001892 3300025913 Bacteria 32670
275 Ga0207695_10002630 3300025913 Bacteria 26273
276 Ga0207695_10021903 3300025913 Bacteria 7275
277 Ga0207695_10048955 3300025913 Bacteria 4459
278 Ga0207671_10006756 3300025914 Bacteria 10151
279 Ga0207671_10008035 3300025914 Bacteria 9021
280 Ga0207671_10016356 3300025914 Bacteria 5768
281 Ga0207671_10018945 3300025914 Bacteria 5273
282 Ga0207671_10019960 3300025914 Bacteria 5112
283 Ga0207671_10063768 3300025914 Bacteria 2738
284 Ga0207671_10084990 3300025914 Bacteria 2377
285 Ga0207693_10002592 3300025915 Bacteria 15712
286 Ga0207663_10013888 3300025916 Bacteria 4393
287 Ga0207649_10020773 3300025920 Bacteria 3770
288 Ga0207652_10001855 3300025921 Bacteria 18345
289 Ga0207646_10111001 3300025922 Bacteria 2461
290 Ga0207681_10002024 3300025923 Bacteria 13028
291 Ga0207681_10060180 3300025923 Bacteria 2606
292 Ga0207681_10062053 3300025923 Bacteria 2572
293 Ga0207694_10094511 3300025924 Bacteria 2362
294 Ga0207650_10011619 3300025925 Bacteria 6065
295 Ga0207650_10014889 3300025925 Bacteria 5411
296 Ga0207650_10030329 3300025925 Bacteria 3894
297 Ga0207650_10151649 3300025925 Bacteria 1829
298 Ga0207659_10022985 3300025926 Bacteria 4157
299 Ga0207644_10044247 3300025931 Bacteria 3162
300 Ga0207644_10151272 3300025931 Bacteria 1796
301 Ga0207690_10001171 3300025932 Bacteria 16575
302 Ga0207706_10006418 3300025933 Bacteria 10920
303 Ga0207706_10009811 3300025933 Bacteria 8784
304 Ga0207706_10071292 3300025933 Bacteria 3056
305 Ga0207709_10033448 3300025935 Unclassified 3019
306 Ga0207670_10002141 3300025936 Bacteria 10336
307 Ga0207669_10006308 3300025937 Bacteria 5408
308 Ga0207669_10038216 3300025937 Unclassified 2762
309 Ga0207704_10059756 3300025938 Bacteria 2355
310 Ga0207691_10000076 3300025940 Bacteria 83005
311 Ga0207691_10023963 3300025940 Bacteria 5741
312 Ga0207711_10259933 3300025941 Bacteria 1595
313 Ga0207689_10002845 3300025942 Bacteria 15974
314 Ga0207689_10109094 3300025942 Bacteria 2274
315 Ga0207661_10011917 3300025944 Bacteria 6314
316 Ga0207661_10015045 3300025944 Bacteria 5683
317 Ga0207679_10006687 3300025945 Bacteria 7299
318 Ga0207679_10132003 3300025945 Bacteria 2005
319 Ga0207667_10001351 3300025949 Bacteria 30791
320 Ga0207667_10005458 3300025949 Bacteria 15498
321 Ga0207667_10024941 3300025949 Bacteria 6555
322 Ga0207651_10006333 3300025960 Bacteria 6183
323 Ga0207651_10029899 3300025960 Unclassified 3460
324 Ga0207651_10106090 3300025960 Bacteria 2097
325 Ga0207651_10163182 3300025960 Bacteria 1749
326 Ga0207712_10002253 3300025961 Bacteria 12531
327 Ga0207712_10006648 3300025961 Bacteria 7296
328 Ga0207668_10001805 3300025972 Bacteria 12490
329 Ga0207668_10023559 3300025972 Bacteria 3960
330 Ga0207668_10471786 3300025972 Bacteria 1075
331 Ga0207640_10098186 3300025981 Bacteria 2047
332 Ga0207658_10000312 3300025986 Bacteria 49332
333 Ga0207658_10026478 3300025986 Bacteria 4066
334 Ga0207658_10100525 3300025986 Unclassified 2264
335 Ga0207658_10288552 3300025986 Bacteria 1409
336 Ga0207677_10003959 3300026023 Bacteria 7891
337 Ga0207677_10017068 3300026023 Bacteria 4317
338 Ga0207703_10003451 3300026035 Bacteria 13240
339 Ga0207703_10037048 3300026035 Bacteria 3885
340 Ga0207703_10134345 3300026035 Bacteria 2140
341 Ga0207639_10004850 3300026041 Bacteria 9068
342 Ga0207639_10025977 3300026041 Bacteria 4252
343 Ga0207639_10103790 3300026041 Bacteria 2304
344 Ga0207639_10153317 3300026041 Bacteria 1932
345 Ga0207639_10181418 3300026041 Bacteria 1791
346 Ga0207678_10141710 3300026067 Bacteria 2052
347 Ga0207678_10235344 3300026067 Bacteria 1568
348 Ga0207708_10021819 3300026075 Bacteria 4832
349 Ga0207708_10187096 3300026075 Bacteria 1646
350 Ga0207702_10189108 3300026078 Bacteria 1901
351 Ga0207702_10413252 3300026078 Bacteria 1303
352 Ga0207641_10002871 3300026088 Bacteria 15625
353 Ga0207641_10006623 3300026088 Bacteria 9727
354 Ga0207641_10018235 3300026088 Bacteria 5753
355 Ga0207641_10093403 3300026088 Bacteria 2637
356 Ga0207648_10002106 3300026089 Bacteria 21685
357 Ga0207648_10028816 3300026089 Bacteria 4922
358 Ga0207676_10001764 3300026095 Bacteria 15852
359 Ga0207676_10006412 3300026095 Bacteria 8313
360 Ga0207676_10093435 3300026095 Unclassified 2476
361 Ga0207676_10269997 3300026095 Bacteria 1540
362 Ga0207674_10005257 3300026116 Bacteria 15410
363 Ga0207674_10020982 3300026116 Bacteria 7046
364 Ga0207675_100000085 3300026118 Bacteria 73716
365 Ga0207675_100269506 3300026118 Bacteria 1652
366 Ga0207675_100280564 3300026118 Bacteria 1619
367 Ga0207675_100357447 3300026118 Unclassified 1432
368 Ga0207683_10025802 3300026121 Bacteria 5069
369 Ga0207683_10049894 3300026121 Unclassified 3664
370 Ga0207698_10032156 3300026142 Bacteria 3797
371 Ga0207698_10128976 3300026142 Bacteria 2157
372 Ga0207428_10020638 3300027907 Bacteria 5591
373 Ga0268266_10000022 3300028379 Bacteria 508060
374 Ga0268266_10000046 3300028379 Bacteria 312745
375 Ga0268266_10005829 3300028379 Bacteria 11401
376 Ga0268265_10042747 3300028380 Unclassified 3364
377 Ga0268264_10000082 3300028381 Bacteria 246913
378 Ga0268264_10004767 3300028381 Bacteria 11512
379 Ga0265319_1019963 3300028563 Bacteria 2492
380 Ga0265323_10002835 3300028653 Bacteria 7801
381 Ga0265323_10024983 3300028653 Bacteria 2267
382 Ga0265322_10002353 3300028654 Bacteria 5850
383 Ga0265336_10007713 3300028666 Bacteria 3817
384 Ga0307517_10175198 3300028786 Bacteria 1399
385 Ga0307515_10000001 3300028794 Bacteria 4259510
386 Ga0307515_10000021 3300028794 Bacteria 406008
387 Ga0265338_10000128 3300028800 Bacteria 138764
388 Ga0265338_10056290 3300028800 Unclassified 3489
389 Ga0265338_10099076 3300028800 Bacteria 2382
390 Ga0265338_10315604 3300028800 Bacteria 1133
391 Ga0307511_10000027 3300030521 Bacteria 109500
392 Ga0265330_10005387 3300031235 Bacteria 6378
393 Ga0265330_10013998 3300031235 Unclassified 3727
394 Ga0265332_10001670 3300031238 Bacteria 12115
395 Ga0265328_10023472 3300031239 Unclassified 2341
396 Ga0265320_10083611 3300031240 Unclassified 1487
397 Ga0265339_10074804 3300031249 Unclassified 1799
398 Ga0265331_10000060 3300031250 Bacteria 170322
399 Ga0265327_10024702 3300031251 Bacteria 3521
400 Ga0265316_10000237 3300031344 Bacteria 63588
401 Ga0265316_10015849 3300031344 Bacteria 6563
402 Ga0307513_10141081 3300031456 Bacteria 2336
403 Ga0307513_10180788 3300031456 Bacteria 1973
404 Ga0307509_10110060 3300031507 Bacteria 2762
405 Ga0307408_100119146 3300031548 Bacteria 2042
406 Ga0307508_10003578 3300031616 Bacteria 15652
407 Ga0265314_10000744 3300031711 Bacteria 39089
408 Ga0265314_10039574 3300031711 Bacteria 3394
409 Ga0316576_10228015 3300031727 Bacteria 1401
410 Ga0307516_10000119 3300031730 Bacteria 92189
411 Ga0307516_10069859 3300031730 Unclassified 3377
412 Ga0307516_10270148 3300031730 Bacteria 1387
413 Ga0307411_10180452 3300032005 Bacteria 1602
414 Ga0307507_10105710 3300033179 Bacteria 2329
415 Ga0373926_0049298 3300035083 Bacteria 1516
416 Ga0373934_0011152 3300035086 Unclassified 3383
417 Ga0373945_0075088 3300035116 Bacteria 1286
418 Ga0373956_0036887 3300035119 Bacteria 2159
419 Ga0373943_0097807 3300035170 Bacteria 1530
420 Ga0373935_0019347 3300035692 Bacteria 4152
421 Ga0373927_0014847 3300035695 Bacteria 5151
422 Ga0373927_0077302 3300035695 Bacteria 2156
423 Ga0373927_0084732 3300035695 Bacteria 2056
424 Ga0373947_0015097 3300035725 Bacteria 4434
425 Ga0373925_0008649 3300037068 Bacteria 7417
426 Ga0395900_0121527 3300037418 Unclassified 2679
427 Ga0395905_0003378 3300037471 Bacteria 17099
428 Ga0439436_0001482 3300041404 Bacteria 6824
429 Ga0439439_0004149 3300041406 Bacteria 3244
430 Ga0439439_0017441 3300041406 Bacteria 1765
431 Ga0451843_0283973 3300041509 Bacteria 1191
432 Ga0439445_0006263 3300042004 Bacteria 2733
433 Ga0439449_0028896 3300042007 Bacteria 2066
434 Ga0439457_000013 3300042014 Bacteria 36480
435 Ga0439457_021948 3300042014 Bacteria 1414
436 Ga0439462_0011911 3300042015 Bacteria 2218
437 Ga0450898_013646 3300042134 Bacteria 1357
438 Ga0439434_0004966 3300042435 Bacteria 3888
439 Ga0466972_0000471 3300044658 Bacteria 20416
440 Ga0466972_0014581 3300044658 Bacteria 3935
441 Ga0466972_0076280 3300044658 Unclassified 1597
442 Ga0466966_0120019 3300044684 Bacteria 1616
443 Ga0466961_0129343 3300044693 Bacteria 1583
444 Ga0453684_0223142 3300044712 Bacteria 2181
445 Ga0466971_0063980 3300044719 Bacteria 1665
446 Ga0466957_0004387 3300044842 Bacteria 7848
447 Ga0466959_0000004 3300045049 Bacteria 216815
448 Ga0466959_0006661 3300045049 Bacteria 8028
449 Ga0495638_0020704 3300046460 Bacteria 4343
450 Ga0495638_0105609 3300046460 Unclassified 1678
451 Ga0495580_0115863 3300046472 Unclassified 1861
452 Ga0495606_0004080 3300046507 Bacteria 14847
453 Ga0495610_0063813 3300046512 Bacteria 1743
454 Ga0495648_0007376 3300046524 Bacteria 8810
455 Ga0495668_0002015 3300046616 Bacteria 17737
456 Ga0495611_0003548 3300046648 Bacteria 6857
457 Ga0495625_0046543 3300046660 Bacteria 3130
458 Ga0495625_0056274 3300046660 Bacteria 2801
459 Ga0495672_0017324 3300047320 Bacteria 4822
460 Ga0495672_0023247 3300047320 Bacteria 4016
461 Ga0495672_0028124 3300047320 Unclassified 3563
462 Ga0495687_000179 3300047443 Bacteria 92387
463 Ga0495686_0000010 3300047472 Bacteria 573229
464 Ga0495602_0182404 3300048088 Bacteria 1618
465 Ga0496106_0125438 3300048909 Bacteria 2010
466 Ga0501296_006268 3300049519 Bacteria 1345
467 Ga0501298_004652 3300049521 Bacteria 2171
468 Ga0501032_0011633 3300049569 Bacteria 6310
469 Ga0501034_0026580 3300049571 Bacteria 5893
470 Ga0501036_0037235 3300049572 Bacteria 4116
471 Ga0501037_0004005 3300049573 Bacteria 10681
472 Ga0501038_0034057 3300049574 Bacteria 4481
473 Ga0501039_0006261 3300049575 Bacteria 9040
474 Ga0501043_0009779 3300049579 Bacteria 7516
475 Ga0501043_0285920 3300049579 Bacteria 1263
476 Ga0501047_0063394 3300049581 Unclassified 3566
477 Ga0501047_0073934 3300049581 Bacteria 3281
478 Ga0501047_0114596 3300049581 Unclassified 2578
479 Ga0501047_0138646 3300049581 Bacteria 2311
480 Ga0501069_0069024 3300049585 Bacteria 1978
481 Ga0501198_008867 3300049649 Bacteria 1467
482 Ga0501201_003462 3300049651 Bacteria 1448
483 Ga0501202_001600 3300049652 Unclassified 3661
484 Ga0501202_012270 3300049652 Bacteria 1614
485 Ga0501207_000266 3300049654 Bacteria 5438
486 Ga0501217_000569 3300049661 Bacteria 6207
487 Ga0501223_007953 3300049663 Bacteria 2163
488 Ga0501235_008284 3300049669 Bacteria 2268
489 Ga0501242_001159 3300049674 Bacteria 2585
490 Ga0501242_001163 3300049674 Bacteria 2584
491 Ga0501243_004798 3300049675 Bacteria 2031
492 Ga0501252_006635 3300049682 Bacteria 1292
493 Ga0501253_000883 3300049683 Bacteria 2820
494 Ga0501257_039928 3300049686 Bacteria 1150
495 Ga0501257_040065 3300049686 Unclassified 1149
496 Ga0501259_000277 3300049688 Bacteria 8095
497 Ga0501259_000597 3300049688 Bacteria 5776
498 Ga0501221_000520 3300049704 Bacteria 6098
499 Ga0501225_0002343 3300049705 Bacteria 5843
500 Ga0501234_000383 3300049707 Bacteria 6574
501 Ga0501234_005925 3300049707 Bacteria 1912
502 Ga0501080_0095061 3300049742 Bacteria 2767
503 Ga0501264_001889 3300049761 Bacteria 2056
504 Ga0501035_0003214 3300049822 Bacteria 15661
505 Ga0501044_0000920 3300049823 Bacteria 35464
506 Ga0501044_0012419 3300049823 Bacteria 9222
507 Ga0501044_0124754 3300049823 Unclassified 2573
508 Ga0501044_0137748 3300049823 Bacteria 2431
509 Ga0501044_0287362 3300049823 Unclassified 1577
510 Ga0501212_000894 3300049851 Bacteria 3136
511 nmdc:mga05p37_140948_c1 3300050507 Bacteria 2954
512 nmdc:mga05p37_535563_c1 3300050507 Bacteria 1336
513 nmdc:mga05p37_94229_c1 3300050507 Bacteria 1794
514 nmdc:mga0qj67_234933_c1 3300050509 Bacteria 1487
515 nmdc:mga08y16_105148_c1 3300050511 Unclassified 2939
516 nmdc:mga08y16_227424_c1 3300050511 Unclassified 1930
517 nmdc:mga08y16_5811_c1 3300050511 Bacteria 12927
518 nmdc:mga08y16_5833_c1 3300050511 Bacteria 12904
519 nmdc:mga0n895_338145_c1 3300050512 Unclassified 1525
520 Ga0500578_0000010 3300053086 Bacteria 217642
521 Ga0500578_0115482 3300053086 Bacteria 1690
522 Ga0500644_0065708 3300053088 Bacteria 1292
523 Ga0500583_0002019 3300053092 Bacteria 5986
524 Ga0500583_0026222 3300053092 Bacteria 2499
525 Ga0500618_001073 3300053125 Bacteria 13489
526 Ga0500658_0104730 3300053134 Bacteria 1239
527 Ga0500568_0002456 3300053139 Bacteria 10896
528 Ga0500568_0007629 3300053139 Bacteria 5286
529 Ga0500604_0013520 3300053151 Bacteria 2213
530 Ga0500616_0003610 3300053153 Bacteria 11664
531 Ga0500622_0003267 3300053156 Bacteria 10992
532 Ga0500637_0060454 3300053178 Bacteria 2170
533 Ga0500611_000039 3300053727 Bacteria 68825
534 Ga0501084_0012909 3300054114 Bacteria 6916
535 Ga0466962_0012040 3300061719 Bacteria 4161
536 2738724666 2738541278 Bacteria 9755573
537 Ga0070691_10063114
538 MRS1b_contig_6539228
539 rootH2_10012186
540 rootH2_10013956
541 rootH2_10015028
542 rootH2_10078726
543 rootH2_10110194
544 rootH1_10272168
545 rootH1_10377752
546 Ga0065714_10009854
547 Ga0065714_10016649
548 Ga0065704_10119013
549 Ga0065712_10069204
550 Ga0065712_10103470
551 Ga0065707_10087330
552 Ga0070676_10000064
553 Ga0070676_10113080
554 Ga0070683_100002318
555 Ga0070683_100003049
556 Ga0070690_100164835
557 Ga0070670_100018539
558 Ga0070670_100045308
559 Ga0070670_100068785
560 Ga0068869_100005945
561 Ga0070666_10000301
562 Ga0070666_10001016
563 Ga0070666_10074673
564 Ga0070682_100003563
565 Ga0068868_100002193
566 Ga0068868_100006992
567 Ga0068868_100148992
568 Ga0068868_100151701
569 Ga0068868_100215144
570 Ga0070689_100011825
571 Ga0070689_100250172
572 Ga0070691_10017659
573 Ga0070661_100035682
574 Ga0070661_100050568
575 Ga0070668_100000222
576 Ga0070668_100059867
577 Ga0070669_100002930
578 Ga0070669_100062761
579 Ga0070669_100286597
580 Ga0070675_100001118
581 Ga0070675_100017171
582 Ga0070675_100049542
583 Ga0070671_100007427
584 Ga0070671_100017140
585 Ga0070671_100024975
586 Ga0070671_100155084
587 Ga0070674_100023269
588 Ga0070674_100364199
589 Ga0070673_100000197
590 Ga0070673_100005388
591 Ga0070673_100021021
592 Ga0070673_100105098
593 Ga0070688_100022052
594 Ga0070688_100063954
595 Ga0070688_100169268
596 Ga0070659_100003766
597 Ga0070667_100000240
598 Ga0070667_100006066
599 Ga0070667_100019873
600 Ga0070667_100186303
601 Ga0070701_10010078
602 Ga0070711_100007160
603 Ga0070705_100077332
604 Ga0070700_100015391
605 Ga0070700_100077957
606 Ga0070708_100285638
607 Ga0070663_100248424
608 Ga0070678_100019978
609 Ga0070678_100100326
610 Ga0070662_100006697
611 Ga0070662_100006827
612 Ga0070662_100150604
613 Ga0070681_10189823
614 Ga0068867_100018038
615 Ga0070685_10301821
616 Ga0070679_100048614
617 Ga0070684_100018160
618 Ga0068853_100002568
619 Ga0068853_100003080
620 Ga0068853_100056506
621 Ga0068853_100083422
622 Ga0068853_100182957
623 Ga0068853_100243725
624 Ga0068853_100493790
625 Ga0070672_100008792
626 Ga0070672_100058630
627 Ga0070672_100088744
628 Ga0070672_100205764
629 Ga0070686_100088039
630 Ga0070693_100157577
631 Ga0070665_100000037
632 Ga0070665_100000805
633 Ga0068855_100002301
634 Ga0068855_100016778
635 Ga0070664_100000575
636 Ga0070664_100092413
637 Ga0070664_100092759
638 Ga0068857_100013599
639 Ga0068854_100114356
640 Ga0068856_100099473
641 Ga0068856_100150130
642 Ga0068856_100548335
643 Ga0070702_100028076
644 Ga0068852_100003210
645 Ga0068852_100010126
646 Ga0068852_100089812
647 Ga0068852_100110925
648 Ga0068852_100273374
649 Ga0068859_100000006
650 Ga0068859_100006362
651 Ga0068859_100006790
652 Ga0068859_100144875
653 Ga0068864_100027798
654 Ga0068864_100082230
655 Ga0068864_100108772
656 Ga0068864_100385333
657 Ga0068861_100002834
658 Ga0068861_100265978
659 Ga0068851_10001240
660 Ga0068851_10002872
661 Ga0068851_10033377
662 Ga0068870_10006453
663 Ga0068863_100000854
664 Ga0068863_100003034
665 Ga0068863_100029070
666 Ga0068863_100103952
667 Ga0068858_100000889
668 Ga0068858_100005950
669 Ga0068858_100066324
670 Ga0068858_100137448
671 Ga0068858_100449899
672 Ga0068860_100000064
673 Ga0068860_100001345
674 Ga0068860_100004206
675 Ga0068860_100007968
676 Ga0068862_100006209
677 Ga0081540_1034457
678 Ga0081539_10011293
679 Ga0070715_10116955
680 Ga0070712_100012555
681 Ga0075366_10023820
682 Ga0075366_10080374
683 Ga0097621_100001217
684 Ga0097621_100076320
685 Ga0068871_100002593
686 Ga0068871_100024170
687 Ga0068871_100063501
688 Ga0075430_100078110
689 Ga0075429_100055833
690 Ga0075429_100132006
691 Ga0068865_100013175
692 Ga0068865_100015113
693 Ga0068865_100168835
694 Ga0097620_100000006
695 Ga0097620_100006362
696 Ga0097620_100006790
697 Ga0097620_100144877
698 Ga0105240_10000457
699 Ga0105240_10004365
700 Ga0105240_10046824
701 Ga0105240_10074162
702 Ga0111539_10002482
703 Ga0111539_10020513
704 Ga0111539_10057252
705 Ga0111539_10078151
706 Ga0111539_10140345
707 Ga0105247_10053065
708 Ga0114129_10046638
709 Ga0114129_10049053
710 Ga0105243_10026564
711 Ga0105243_10039003
712 Ga0105241_10015210
713 Ga0105241_10020383
714 Ga0105242_10034779
715 Ga0105248_10013442
716 Ga0105248_10239182
717 Ga0105248_10374392
718 Ga0105237_10003940
719 Ga0105237_10011351
720 Ga0105237_10014059
721 Ga0105237_10014983
722 Ga0105237_10018157
723 Ga0105237_10052052
724 Ga0105237_10180949
725 Ga0105237_10466156
726 Ga0105238_10006655
727 Ga0105238_10052228
728 Ga0105238_10091344
729 Ga0105249_10000382
730 Ga0105249_10010506
731 Ga0105249_10012752
732 Ga0105239_10000283
733 Ga0105239_10002212
734 Ga0105239_10002422
735 Ga0105239_10015511
736 Ga0105239_10296529
737 Ga0105239_10309811
738 Ga0105246_10098077
739 Ga0157373_10047559
740 Ga0157371_10057427
741 Ga0157371_10162356
742 Ga0157370_10028521
743 Ga0157370_10030174
744 Ga0157370_10032354
745 Ga0157370_10359479
746 Ga0157369_10081170
747 Ga0157369_10131206
748 Ga0157369_10576856
749 Ga0157374_10000311
750 Ga0157374_10008233
751 Ga0157378_10005516
752 Ga0157378_10008769
753 Ga0157378_10018424
754 Ga0157378_10072283
755 Ga0157378_10133149
756 Ga0157378_10220063
757 Ga0163162_10000175
758 Ga0163162_10001206
759 Ga0163162_10002221
760 Ga0163162_10006923
761 Ga0163162_10200818
762 Ga0163162_10480165
763 Ga0157372_10004531
764 Ga0157372_10016944
765 Ga0157372_10035513
766 Ga0157372_10053754
767 Ga0157372_10065725
768 Ga0157372_10089805
769 Ga0157372_10239288
770 Ga0157372_10244342
771 Ga0157372_10399258
772 Ga0157375_10000748
773 Ga0157375_10000773
774 Ga0157375_10156893
775 Ga0163163_10000202
776 Ga0163163_10000369
777 Ga0163163_10007952
778 Ga0157380_10004286
779 Ga0157380_10015400
780 Ga0157377_10006522
781 Ga0157377_10028710
782 Ga0157377_10068087
783 Ga0157379_10001465
784 Ga0157379_10006306
785 Ga0157379_10035570
786 Ga0157376_10000842
787 Ga0157376_10003719
788 Ga0157376_10004771
789 Ga0157376_10014822
790 Ga0157376_10094571
791 Ga0163161_10011062
792 Ga0163161_10264374
793 Ga0207697_10032906
794 Ga0207656_10010415
795 Ga0207680_10000855
796 Ga0207680_10019113
797 Ga0207647_10000096
798 Ga0207647_10114182
799 Ga0207645_10001164
800 Ga0207645_10132815
801 Ga0207705_10005354
802 Ga0207654_10001346
803 Ga0207654_10001813
804 Ga0207654_10048772
805 Ga0207695_10000051
806 Ga0207695_10000056
807 Ga0207695_10000066
808 Ga0207695_10000081
809 Ga0207695_10000156
810 Ga0207695_10001892
811 Ga0207695_10002630
812 Ga0207695_10021903
813 Ga0207695_10048955
814 Ga0207671_10006756
815 Ga0207671_10008035
816 Ga0207671_10016356
817 Ga0207671_10018945
818 Ga0207671_10019960
819 Ga0207671_10063768
820 Ga0207671_10084990
821 Ga0207693_10002592
822 Ga0207663_10013888
823 Ga0207649_10020773
824 Ga0207652_10001855
825 Ga0207646_10111001
826 Ga0207681_10002024
827 Ga0207681_10060180
828 Ga0207681_10062053
829 Ga0207694_10094511
830 Ga0207650_10011619
831 Ga0207650_10014889
832 Ga0207650_10030329
833 Ga0207650_10151649
834 Ga0207659_10022985
835 Ga0207644_10044247
836 Ga0207644_10151272
837 Ga0207690_10001171
838 Ga0207706_10006418
839 Ga0207706_10009811
840 Ga0207706_10071292
841 Ga0207709_10033448
842 Ga0207670_10002141
843 Ga0207669_10006308
844 Ga0207669_10038216
845 Ga0207704_10059756
846 Ga0207691_10000076
847 Ga0207691_10023963
848 Ga0207711_10259933
849 Ga0207689_10002845
850 Ga0207689_10109094
851 Ga0207661_10011917
852 Ga0207661_10015045
853 Ga0207679_10006687
854 Ga0207679_10132003
855 Ga0207667_10001351
856 Ga0207667_10005458
857 Ga0207667_10024941
858 Ga0207651_10006333
859 Ga0207651_10029899
860 Ga0207651_10106090
861 Ga0207651_10163182
862 Ga0207712_10002253
863 Ga0207712_10006648
864 Ga0207668_10001805
865 Ga0207668_10023559
866 Ga0207668_10471786
867 Ga0207640_10098186
868 Ga0207658_10000312
869 Ga0207658_10026478
870 Ga0207658_10100525
871 Ga0207658_10288552
872 Ga0207677_10003959
873 Ga0207677_10017068
874 Ga0207703_10003451
875 Ga0207703_10037048
876 Ga0207703_10134345
877 Ga0207639_10004850
878 Ga0207639_10025977
879 Ga0207639_10103790
880 Ga0207639_10153317
881 Ga0207639_10181418
882 Ga0207678_10141710
883 Ga0207678_10235344
884 Ga0207708_10021819
885 Ga0207708_10187096
886 Ga0207702_10189108
887 Ga0207702_10413252
888 Ga0207641_10002871
889 Ga0207641_10006623
890 Ga0207641_10018235
891 Ga0207641_10093403
892 Ga0207648_10002106
893 Ga0207648_10028816
894 Ga0207676_10001764
895 Ga0207676_10006412
896 Ga0207676_10093435
897 Ga0207676_10269997
898 Ga0207674_10005257
899 Ga0207674_10020982
900 Ga0207675_100000085
901 Ga0207675_100269506
902 Ga0207675_100280564
903 Ga0207675_100357447
904 Ga0207683_10025802
905 Ga0207683_10049894
906 Ga0207698_10032156
907 Ga0207698_10128976
908 Ga0207428_10020638
909 Ga0268266_10000022
910 Ga0268266_10000046
911 Ga0268266_10005829
912 Ga0268265_10042747
913 Ga0268264_10000082
914 Ga0268264_10004767
915 Ga0265319_1019963
916 Ga0265323_10002835
917 Ga0265323_10024983
918 Ga0265322_10002353
919 Ga0265336_10007713
920 Ga0307517_10175198
921 Ga0307515_10000001
922 Ga0307515_10000021
923 Ga0265338_10000128
924 Ga0265338_10056290
925 Ga0265338_10099076
926 Ga0265338_10315604
927 Ga0307511_10000027
928 Ga0265330_10005387
929 Ga0265330_10013998
930 Ga0265332_10001670
931 Ga0265328_10023472
932 Ga0265320_10083611
933 Ga0265339_10074804
934 Ga0265331_10000060
935 Ga0265327_10024702
936 Ga0265316_10000237
937 Ga0265316_10015849
938 Ga0307513_10141081
939 Ga0307513_10180788
940 Ga0307509_10110060
941 Ga0307408_100119146
942 Ga0307508_10003578
943 Ga0265314_10000744
944 Ga0265314_10039574
945 Ga0316576_10228015
946 Ga0307516_10000119
947 Ga0307516_10069859
948 Ga0307516_10270148
949 Ga0307411_10180452
950 Ga0307507_10105710
951 Ga0373926_0049298
952 Ga0373934_0011152
953 Ga0373945_0075088
954 Ga0373956_0036887
955 Ga0373943_0097807
956 Ga0373935_0019347
957 Ga0373927_0014847
958 Ga0373927_0077302
959 Ga0373927_0084732
960 Ga0373947_0015097
961 Ga0373925_0008649
962 Ga0395900_0121527
963 Ga0395905_0003378
964 Ga0439436_0001482
965 Ga0439439_0004149
966 Ga0439439_0017441
967 Ga0451843_0283973
968 Ga0439445_0006263
969 Ga0439449_0028896
970 Ga0439457_000013
971 Ga0439457_021948
972 Ga0439462_0011911
973 Ga0450898_013646
974 Ga0439434_0004966
975 Ga0466972_0000471
976 Ga0466972_0014581
977 Ga0466972_0076280
978 Ga0466966_0120019
979 Ga0466961_0129343
980 Ga0453684_0223142
981 Ga0466971_0063980
982 Ga0466957_0004387
983 Ga0466959_0000004
984 Ga0466959_0006661
985 Ga0495638_0020704
986 Ga0495638_0105609
987 Ga0495580_0115863
988 Ga0495606_0004080
989 Ga0495610_0063813
990 Ga0495648_0007376
991 Ga0495668_0002015
992 Ga0495611_0003548
993 Ga0495625_0046543
994 Ga0495625_0056274
995 Ga0495672_0017324
996 Ga0495672_0023247
997 Ga0495672_0028124
998 Ga0495687_000179
999 Ga0495686_0000010
1000 Ga0495602_0182404
1001 Ga0496106_0125438
1002 Ga0501296_006268
1003 Ga0501298_004652
1004 Ga0501032_0011633
1005 Ga0501034_0026580
1006 Ga0501036_0037235
1007 Ga0501037_0004005
1008 Ga0501038_0034057
1009 Ga0501039_0006261
1010 Ga0501043_0009779
1011 Ga0501043_0285920
1012 Ga0501047_0063394
1013 Ga0501047_0073934
1014 Ga0501047_0114596
1015 Ga0501047_0138646
1016 Ga0501069_0069024
1017 Ga0501198_008867
1018 Ga0501201_003462
1019 Ga0501202_001600
1020 Ga0501202_012270
1021 Ga0501207_000266
1022 Ga0501217_000569
1023 Ga0501223_007953
1024 Ga0501235_008284
1025 Ga0501242_001159
1026 Ga0501242_001163
1027 Ga0501243_004798
1028 Ga0501252_006635
1029 Ga0501253_000883
1030 Ga0501257_039928
1031 Ga0501257_040065
1032 Ga0501259_000277
1033 Ga0501259_000597
1034 Ga0501221_000520
1035 Ga0501225_0002343
1036 Ga0501234_000383
1037 Ga0501234_005925
1038 Ga0501080_0095061
1039 Ga0501264_001889
1040 Ga0501035_0003214
1041 Ga0501044_0000920
1042 Ga0501044_0012419
1043 Ga0501044_0124754
1044 Ga0501044_0137748
1045 Ga0501044_0287362
1046 Ga0501212_000894
1047 nmdc:mga05p37_140948_c1
1048 nmdc:mga05p37_535563_c1
1049 nmdc:mga05p37_94229_c1
1050 nmdc:mga0qj67_234933_c1
1051 nmdc:mga08y16_105148_c1
1052 nmdc:mga08y16_227424_c1
1053 nmdc:mga08y16_5811_c1
1054 nmdc:mga08y16_5833_c1
1055 nmdc:mga0n895_338145_c1
1056 Ga0500578_0000010
1057 Ga0500578_0115482
1058 Ga0500644_0065708
1059 Ga0500583_0002019
1060 Ga0500583_0026222
1061 Ga0500618_001073
1062 Ga0500658_0104730
1063 Ga0500568_0002456
1064 Ga0500568_0007629
1065 Ga0500604_0013520
1066 Ga0500616_0003610
1067 Ga0500622_0003267
1068 Ga0500637_0060454
1069 Ga0500611_000039
1070 Ga0501084_0012909
1071 Ga0466962_0012040
1072 2738724666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13519

VWA_2

von Willebrand factor type A domain

137

244

0.98

PF00092

VWA

von Willebrand factor type A domain

136

327

0.94

PF07584

BatA

Aerotolerance regulator N-terminal

49

121

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nmi-assembly1.cif.gz_E cryo-em structure of the human tfiih core complex 0.8659 80 278
8gxq-assembly1.cif.gz_HG pic-mediator in complex with +1 nucleosome (t40n) in mh-binding state 0.853 81 278
7egb-assembly1.cif.gz_2 tfiid-based holo pic on scp promoter 0.853 81 278
8ebw-assembly1.cif.gz_E initial dna-lesion (ap) binding by xpc and tfiih complex2 0.8446 80 278
4wfq-assembly1.cif.gz_A crystal structure of tfiih subunit 0.8443 80 278
ID Description Score Start End Superfamily
af_P34567_58_244_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8778 80 278 3.40.50.410
af_Q13888_54_241_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8709 80 278 3.40.50.410
af_Q86KZ2_92_277_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8617 80 275 3.40.50.410
af_Q8IEG6_79_264_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8528 81 278 3.40.50.410
af_I1LHY4_78_263_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8506 81 278 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A3M2FVC1-F1-model_v4 VWA domain-containing protein 0.9038 80 282 GO:0016020
AF-A0A1W1BA98-F1-model_v4 BatA (Bacteroides aerotolerance operon) 0.8904 80 282 GO:0016020
AF-A0A662GY86-F1-model_v4 VWFA domain-containing protein 0.8817 80 282 GO:0005576
AF-A0A7C6T9F2-F1-model_v4 VWA domain-containing protein 0.8699 80 284 GO:0016020
AF-A0A7X9BNQ9-F1-model_v4 VWA domain-containing protein 0.8696 80 282 GO:0016020

Map