F460688

General Info

Members Datasets Scaffolds Average Seq Length
535 335 1068 333

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0080604|Ga0436365_0080604_30835_31899
Length 354
Sequence MKRALAHHETFPGGSDMRKLLGVVAVSALAIAXXASSHAQGKKYVFALVPKNMNNPFFDQARDGCKKAETESKGALECMYIGPGEHGGGEEQVQVVDDLIAKKVDGIAVSASNAAAMGKALEGAKKAGIPVLTWDSDLLDKDKSLRIAYVGTHNYDIGVNLAKQVQEIKPKGGVICIQSGGAAAANHNERMQGIRDTLAGKKSAAAPGERLTGQNGWKEADGCPLYTDDDFPRSVQQMEDILGKYPTLDAFVPTGGFPQFIPQAYRKVAEKYKSRIQDGSLALVVADTLPVQMDLLKAGLSDGQVGQRPFEMGYKSMMFLKDVKDGKPAPSDPTYTGLDVCNAKNASTCVGGGS

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
278 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
279 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
283 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
290 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
291 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
292 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
295 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
308 2508501050 Microvirga lupini Lut6 Isolate Nodule
309 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
310 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
311 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
312 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
313 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
314 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
315 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
316 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
317 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
318 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
319 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
320 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
321 2909042592 Labrys sp. LIt4 Isolate Nodule
322 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
323 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
324 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
325 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
326 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
327 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
328 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
329 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
330 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
331 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
332 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
333 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
334 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
335 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.96
Metatranscriptomes 2.8
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.03
Nodule 3.93
Rhizoplane 3.36
Rhizosphere 67.48
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0080604 3300039437 Bacteria 50922
2 JGI24736J21556_1009148 3300001904 Bacteria 1639
3 JGI24740J21852_10038660 3300001979 Bacteria 1462
4 JGI25157J39369_1000053 3300002741 Bacteria 110228
5 JGI25153J46596_10000033 3300003215 Bacteria 194912
6 JGI25153J46596_10000047 3300003215 Bacteria 146400
7 Ga0007409J51694_1063596 3300003575 Bacteria 1123
8 Ga0055539_1007310 3300003752 Bacteria 1400
9 Ga0055531_10017727 3300003794 Bacteria 2986
10 Ga0058859_11644255 3300004798 Bacteria 1120
11 Ga0070670_100046548 3300005331 Bacteria 3730
12 Ga0068869_100297488 3300005334 Bacteria 1302
13 Ga0068868_100022036 3300005338 Bacteria 4803
14 Ga0070668_100061731 3300005347 Bacteria 2904
15 Ga0070669_100023933 3300005353 Bacteria 4375
16 Ga0070669_100024423 3300005353 Bacteria 4333
17 Ga0070671_100001821 3300005355 Bacteria 16218
18 Ga0070671_100052791 3300005355 Bacteria 3380
19 Ga0070674_100014204 3300005356 Bacteria 4945
20 Ga0070674_100040430 3300005356 Bacteria 3155
21 Ga0070667_100250959 3300005367 Bacteria 1582
22 Ga0070709_10032404 3300005434 Bacteria 3150
23 Ga0070709_10254262 3300005434 Bacteria 1267
24 Ga0070714_100118377 3300005435 Bacteria 2353
25 Ga0070713_100030748 3300005436 Bacteria 4269
26 Ga0070713_100065365 3300005436 Bacteria 3055
27 Ga0070713_100159587 3300005436 Bacteria 2012
28 Ga0070710_10001811 3300005437 Bacteria 10101
29 Ga0070711_100000775 3300005439 Bacteria 16660
30 Ga0070711_100023269 3300005439 Bacteria 4027
31 Ga0070708_100427556 3300005445 Bacteria 1249
32 Ga0070681_10357440 3300005458 Bacteria 1371
33 Ga0070706_100269969 3300005467 Bacteria 1587
34 Ga0070707_100166578 3300005468 Bacteria 2148
35 Ga0070698_100152117 3300005471 Bacteria 2261
36 Ga0070699_100064615 3300005518 Bacteria 3174
37 Ga0070699_100072825 3300005518 Bacteria 2989
38 Ga0070665_100111501 3300005548 Bacteria 2738
39 Ga0068856_100033930 3300005614 Bacteria 4998
40 Ga0068856_100066950 3300005614 Bacteria 3549
41 Ga0068864_100005685 3300005618 Bacteria 10219
42 Ga0068864_100118959 3300005618 Bacteria 2360
43 Ga0068863_100089005 3300005841 Bacteria 2926
44 Ga0068863_100108199 3300005841 Bacteria 2646
45 Ga0068863_100175827 3300005841 Bacteria 2054
46 Ga0068860_100000071 3300005843 Bacteria 178413
47 Ga0068860_100375530 3300005843 Bacteria 1403
48 Ga0068862_100004858 3300005844 Bacteria 11313
49 Ga0068862_100097814 3300005844 Bacteria 2563
50 Ga0068862_100118879 3300005844 Bacteria 2327
51 Ga0081455_10004324 3300005937 Bacteria 15994
52 Ga0081455_10038463 3300005937 Bacteria 4237
53 Ga0081455_10058524 3300005937 Bacteria 3260
54 Ga0081538_10014432 3300005981 Bacteria 6188
55 Ga0081539_10004580 3300005985 Bacteria 15093
56 Ga0070717_10075318 3300006028 Bacteria 2823
57 Ga0075365_10038225 3300006038 Bacteria 3118
58 Ga0075365_10049867 3300006038 Bacteria 2760
59 Ga0075368_10000497 3300006042 Bacteria 11660
60 Ga0075368_10039176 3300006042 Bacteria 1857
61 Ga0075363_100019120 3300006048 Bacteria 3422
62 Ga0075364_10013847 3300006051 Bacteria 4970
63 Ga0075364_10176741 3300006051 Bacteria 1444
64 Ga0070716_100002789 3300006173 Bacteria 8121
65 Ga0070716_100111088 3300006173 Bacteria 1699
66 Ga0075362_10096608 3300006177 Bacteria 1377
67 Ga0075367_10005545 3300006178 Bacteria 6285
68 Ga0075369_10004466 3300006186 Bacteria 5169
69 Ga0075369_10007492 3300006186 Bacteria 4158
70 Ga0075366_10001925 3300006195 Bacteria 10502
71 Ga0075366_10039772 3300006195 Bacteria 2779
72 Ga0075370_10014816 3300006353 Bacteria 4163
73 Ga0075431_100001645 3300006847 Bacteria 20930
74 Ga0075429_100008179 3300006880 Bacteria 9091
75 Ga0075435_100051158 3300007076 Bacteria 3327
76 Ga0099795_10000562 3300007788 Bacteria 7010
77 Ga0099795_10001819 3300007788 Bacteria 4803
78 Ga0105240_10001110 3300009093 Bacteria 47386
79 Ga0111539_10160770 3300009094 Bacteria 2627
80 Ga0105245_10011532 3300009098 Bacteria 7698
81 Ga0105245_10307788 3300009098 Bacteria 1557
82 Ga0105247_10006831 3300009101 Bacteria 7031
83 Ga0105247_10087721 3300009101 Bacteria 1971
84 Ga0114129_10002004 3300009147 Bacteria 27885
85 Ga0114129_10063159 3300009147 Bacteria 5173
86 Ga0114129_10086362 3300009147 Bacteria 4351
87 Ga0114129_10609368 3300009147 Bacteria 1414
88 Ga0105243_10072844 3300009148 Bacteria 2782
89 Ga0105243_10104567 3300009148 Bacteria 2357
90 Ga0105243_10242277 3300009148 Bacteria 1605
91 Ga0105241_10014651 3300009174 Bacteria 5740
92 Ga0105241_10211752 3300009174 Bacteria 1624
93 Ga0105242_10279138 3300009176 Bacteria 1517
94 Ga0105248_10038130 3300009177 Bacteria 5377
95 Ga0105248_10119957 3300009177 Bacteria 2967
96 Ga0105237_10001437 3300009545 Bacteria 31477
97 Ga0105237_10018733 3300009545 Bacteria 7158
98 Ga0105237_10037163 3300009545 Bacteria 4923
99 Ga0105237_10136106 3300009545 Bacteria 2451
100 Ga0105237_10167184 3300009545 Bacteria 2198
101 Ga0105238_10009620 3300009551 Bacteria 9671
102 Ga0105238_10240358 3300009551 Bacteria 1788
103 Ga0105249_10167069 3300009553 Bacteria 2131
104 Ga0099796_10001356 3300010159 Bacteria 4879
105 Ga0099796_10043293 3300010159 Bacteria 1533
106 Ga0105239_10000745 3300010375 Bacteria 46221
107 Ga0105239_10026833 3300010375 Bacteria 6339
108 Ga0105239_10277704 3300010375 Bacteria 1885
109 Ga0105246_10013177 3300011119 Bacteria 5177
110 Ga0171462_1018 3300013250 Bacteria 157875
111 Ga0157374_10147453 3300013296 Bacteria 2286
112 Ga0157378_10055199 3300013297 Bacteria 3538
113 Ga0163162_10349330 3300013306 Bacteria 1612
114 Ga0157375_10302130 3300013308 Bacteria 1764
115 Ga0163163_10027568 3300014325 Bacteria 5443
116 Ga0163163_10044469 3300014325 Bacteria 4357
117 Ga0163163_10336774 3300014325 Bacteria 1564
118 Ga0157380_10002708 3300014326 Bacteria 12017
119 Ga0157380_10049965 3300014326 Bacteria 3301
120 Ga0182008_10013499 3300014497 Bacteria 4295
121 Ga0157379_10051127 3300014968 Bacteria 3691
122 Ga0206356_10374033 3300020070 Bacteria 2080
123 Ga0213872_10058457 3300021361 Bacteria 1746
124 Ga0213874_10008493 3300021377 Bacteria 2505
125 Ga0213874_10014532 3300021377 Bacteria 2060
126 Ga0213874_10035703 3300021377 Bacteria 1462
127 Ga0213874_10056785 3300021377 Bacteria 1216
128 Ga0213876_10001084 3300021384 Bacteria 17452
129 Ga0213876_10006877 3300021384 Bacteria 6200
130 Ga0213876_10010546 3300021384 Bacteria 4952
131 Ga0213876_10027134 3300021384 Bacteria 3022
132 Ga0213876_10054392 3300021384 Bacteria 2113
133 Ga0213876_10102126 3300021384 Bacteria 1520
134 Ga0213875_10001310 3300021388 Bacteria 16493
135 Ga0213871_10000427 3300021441 Bacteria 5646
136 Ga0209026_1000002 3300025250 Bacteria 1136158
137 Ga0209677_102414 3300025253 Bacteria 7065
138 Ga0209148_1005987 3300025254 Bacteria 2695
139 Ga0209759_1000156 3300025256 Bacteria 117222
140 Ga0209233_1007445 3300025261 Bacteria 3467
141 Ga0209455_1003921 3300025272 Bacteria 5069
142 Ga0209758_1000070 3300025297 Bacteria 284093
143 Ga0209257_1000296 3300025304 Bacteria 109517
144 Ga0209257_1010756 3300025304 Bacteria 4555
145 Ga0207697_10034355 3300025315 Bacteria 2076
146 Ga0207692_10002105 3300025898 Bacteria 7597
147 Ga0207710_10015391 3300025900 Bacteria 3231
148 Ga0207688_10028497 3300025901 Bacteria 3072
149 Ga0207688_10082873 3300025901 Bacteria 1833
150 Ga0207647_10092252 3300025904 Bacteria 1805
151 Ga0207699_10000342 3300025906 Bacteria 24743
152 Ga0207684_10073707 3300025910 Bacteria 2900
153 Ga0207695_10002742 3300025913 Bacteria 25690
154 Ga0207695_10144539 3300025913 Bacteria 2324
155 Ga0207671_10012515 3300025914 Bacteria 6815
156 Ga0207671_10034785 3300025914 Bacteria 3743
157 Ga0207693_10015759 3300025915 Bacteria 6057
158 Ga0207663_10002594 3300025916 Bacteria 8693
159 Ga0207663_10029475 3300025916 Bacteria 3223
160 Ga0207646_10169474 3300025922 Bacteria 1972
161 Ga0207694_10036316 3300025924 Bacteria 3782
162 Ga0207694_10122923 3300025924 Bacteria 2074
163 Ga0207650_10106835 3300025925 Bacteria 2162
164 Ga0207687_10013924 3300025927 Bacteria 5256
165 Ga0207687_10201082 3300025927 Bacteria 1557
166 Ga0207700_10014343 3300025928 Bacteria 5191
167 Ga0207700_10027158 3300025928 Bacteria 4004
168 Ga0207700_10131681 3300025928 Bacteria 2043
169 Ga0207644_10006900 3300025931 Bacteria 7394
170 Ga0207686_10101308 3300025934 Bacteria 1924
171 Ga0207704_10187444 3300025938 Bacteria 1501
172 Ga0207665_10005896 3300025939 Bacteria 8151
173 Ga0207665_10071081 3300025939 Bacteria 2375
174 Ga0207665_10090516 3300025939 Bacteria 2120
175 Ga0207711_10170307 3300025941 Bacteria 1976
176 Ga0207712_10349576 3300025961 Bacteria 1228
177 Ga0207658_10210976 3300025986 Bacteria 1627
178 Ga0207677_10242485 3300026023 Bacteria 1459
179 Ga0207703_10077629 3300026035 Bacteria 2757
180 Ga0207678_10481631 3300026067 Bacteria 1080
181 Ga0207702_10038849 3300026078 Bacteria 3987
182 Ga0207702_10059641 3300026078 Bacteria 3250
183 Ga0207641_10035203 3300026088 Bacteria 4170
184 Ga0207641_10078841 3300026088 Bacteria 2854
185 Ga0207641_10157477 3300026088 Bacteria 2062
186 Ga0207676_10061246 3300026095 Bacteria 2979
187 Ga0209179_1000445 3300027512 Bacteria 4177
188 Ga0209588_1000761 3300027671 Bacteria 8174
189 Ga0209813_10005925 3300027866 Bacteria 2999
190 Ga0268266_10091833 3300028379 Bacteria 2663
191 Ga0268266_10180407 3300028379 Bacteria 1922
192 Ga0268266_10294747 3300028379 Bacteria 1512
193 Ga0268266_10370282 3300028379 Bacteria 1349
194 Ga0268266_10402798 3300028379 Bacteria 1294
195 Ga0268265_10028318 3300028380 Bacteria 4010
196 Ga0268265_10091693 3300028380 Bacteria 2430
197 Ga0268264_10000073 3300028381 Bacteria 260615
198 Ga0307517_10000102 3300028786 Bacteria 123775
199 Ga0265339_10011213 3300031249 Bacteria 5531
200 Ga0307513_10027790 3300031456 Bacteria 6484
201 Ga0307509_10081172 3300031507 Bacteria 3351
202 Ga0307408_100207820 3300031548 Bacteria 1589
203 Ga0265313_10003998 3300031595 Bacteria 11545
204 Ga0265313_10063937 3300031595 Bacteria 1713
205 Ga0307508_10001119 3300031616 Bacteria 31027
206 Ga0307508_10012324 3300031616 Bacteria 7819
207 Ga0307508_10120972 3300031616 Bacteria 2220
208 Ga0307516_10002286 3300031730 Bacteria 25850
209 Ga0307516_10012185 3300031730 Bacteria 9284
210 Ga0307516_10020911 3300031730 Bacteria 6753
211 Ga0307516_10047076 3300031730 Bacteria 4252
212 Ga0307413_10025079 3300031824 Bacteria 3262
213 Ga0307410_10135939 3300031852 Bacteria 1812
214 Ga0307410_10294560 3300031852 Bacteria 1278
215 Ga0307406_10190313 3300031901 Bacteria 1501
216 Ga0307407_10076779 3300031903 Bacteria 2007
217 Ga0307407_10193157 3300031903 Bacteria 1359
218 Ga0307409_100001154 3300031995 Bacteria 12575
219 Ga0307409_100018544 3300031995 Bacteria 4682
220 Ga0307409_100550605 3300031995 Bacteria 1132
221 Ga0307416_100028819 3300032002 Bacteria 4137
222 Ga0307416_100094703 3300032002 Bacteria 2576
223 Ga0307414_10031227 3300032004 Bacteria 3492
224 Ga0307414_10212217 3300032004 Bacteria 1583
225 Ga0307411_10072761 3300032005 Bacteria 2335
226 Ga0307411_10156256 3300032005 Bacteria 1702
227 Ga0307415_100259040 3300032126 Bacteria 1418
228 Ga0307507_10009514 3300033179 Bacteria 12901
229 Ga0307510_10026169 3300033180 Bacteria 6714
230 Ga0307510_10093380 3300033180 Bacteria 2840
231 Ga0307510_10161899 3300033180 Bacteria 1833
232 Ga0307510_10179293 3300033180 Bacteria 1684
233 Ga0373936_0013779 3300035113 Bacteria 3086
234 Ga0373936_0080801 3300035113 Bacteria 1353
235 Ga0373957_0021283 3300035120 Bacteria 2301
236 Ga0373957_0088542 3300035120 Bacteria 1228
237 Ga0373943_0025043 3300035170 Bacteria 2786
238 Ga0373943_0093329 3300035170 Bacteria 1562
239 Ga0373946_0017193 3300035171 Bacteria 2764
240 Ga0373946_0024914 3300035171 Bacteria 2350
241 Ga0373955_0047675 3300035172 Bacteria 2321
242 Ga0373931_0219196 3300035691 Bacteria 1145
243 Ga0373935_0001741 3300035692 Bacteria 12210
244 Ga0373935_0056915 3300035692 Bacteria 2494
245 Ga0373927_0001969 3300035695 Bacteria 15149
246 Ga0373927_0021434 3300035695 Bacteria 4236
247 Ga0373927_0068407 3300035695 Bacteria 2298
248 Ga0373933_0167981 3300035724 Bacteria 1395
249 Ga0373947_0001689 3300035725 Bacteria 13524
250 Ga0373947_0023523 3300035725 Bacteria 3585
251 Ga0310104_04004 3300036242 Bacteria 1271
252 Ga0373937_0039005 3300036401 Bacteria 4328
253 Ga0373937_0061257 3300036401 Bacteria 3459
254 Ga0373937_0146168 3300036401 Bacteria 2213
255 Ga0373925_0014218 3300037068 Bacteria 5759
256 Ga0373925_0289969 3300037068 Bacteria 1319
257 Ga0436364_0129896 3300037853 Bacteria 6203
258 Ga0436364_0852425 3300037853 Bacteria 1654
259 Ga0436364_1222998 3300037853 Bacteria 2691
260 Ga0436364_1244484 3300037853 Bacteria 1986
261 Ga0436364_1332447 3300037853 Bacteria 1941
262 Ga0436364_1407022 3300037853 Bacteria 2695
263 Ga0400483_099887 3300039062 Bacteria 2742
264 Ga0400483_199574 3300039062 Bacteria 1627
265 Ga0400483_202169 3300039062 Bacteria 8497
266 Ga0436365_0026609 3300039437 Bacteria 3160
267 Ga0436365_0291258 3300039437 Bacteria 51712
268 Ga0436365_0709674 3300039437 Bacteria 6817
269 Ga0436365_0929115 3300039437 Bacteria 7638
270 Ga0436365_1455492 3300039437 Bacteria 2340
271 Ga0436365_1601812 3300039437 Bacteria 16232
272 Ga0436365_1604205 3300039437 Bacteria 1260
273 Ga0436360_0018179 3300039438 Bacteria 1375
274 Ga0436360_0133944 3300039438 Bacteria 15410
275 Ga0436360_0544469 3300039438 Bacteria 1987
276 Ga0436360_1007049 3300039438 Bacteria 5400
277 Ga0436360_1340806 3300039438 Bacteria 1754
278 Ga0436361_0090772 3300039447 Bacteria 4977
279 Ga0436363_0250085 3300039450 Bacteria 26739
280 Ga0436363_0288203 3300039450 Bacteria 1848
281 Ga0436363_0551334 3300039450 Bacteria 2377
282 Ga0436363_0816820 3300039450 Bacteria 2307
283 Ga0436363_0963507 3300039450 Bacteria 5047
284 Ga0436363_0988615 3300039450 Bacteria 2175
285 Ga0436363_1286681 3300039450 Bacteria 2447
286 Ga0436362_0090040 3300039453 Bacteria 2201
287 Ga0436362_0674326 3300039453 Bacteria 1607
288 Ga0436362_1130295 3300039453 Bacteria 10966
289 Ga0439453_0007850 3300041408 Bacteria 1703
290 Ga0439451_026702 3300042009 Unclassified 1164
291 Ga0439435_0006553 3300042436 Bacteria 2620
292 Ga0466969_0061895 3300044656 Bacteria 1817
293 Ga0466966_0043460 3300044684 Bacteria 2880
294 Ga0466961_0114476 3300044693 Bacteria 1695
295 Ga0466959_0012848 3300045049 Bacteria 6059
296 Ga0466958_0218131 3300045836 Bacteria 1217
297 Ga0495592_0177217 3300046454 Bacteria 1455
298 Ga0495638_0010023 3300046460 Bacteria 6606
299 Ga0495638_0120645 3300046460 Bacteria 1550
300 Ga0495651_0061787 3300046462 Bacteria 2867
301 Ga0495580_0075734 3300046472 Bacteria 2347
302 Ga0495582_0033522 3300046473 Bacteria 2823
303 Ga0495639_0025115 3300046475 Bacteria 2626
304 Ga0495662_0045534 3300046476 Bacteria 2118
305 Ga0495664_0001193 3300046477 Bacteria 13561
306 Ga0495664_0003872 3300046477 Bacteria 8165
307 Ga0495664_0098904 3300046477 Bacteria 1757
308 Ga0495584_0111252 3300046491 Bacteria 1386
309 Ga0495606_0016578 3300046507 Bacteria 5610
310 Ga0495606_0045366 3300046507 Bacteria 2913
311 Ga0495606_0073650 3300046507 Bacteria 2142
312 Ga0495606_0177038 3300046507 Bacteria 1233
313 Ga0495608_0118336 3300046511 Bacteria 1700
314 Ga0495610_0057869 3300046512 Bacteria 1857
315 Ga0495616_0050169 3300046513 Bacteria 2088
316 Ga0495618_0117496 3300046514 Bacteria 1703
317 Ga0495620_0065854 3300046515 Bacteria 1494
318 Ga0495630_0002691 3300046517 Bacteria 12335
319 Ga0495632_0078858 3300046519 Bacteria 1573
320 Ga0495632_0119103 3300046519 Bacteria 1235
321 Ga0495643_0008781 3300046522 Bacteria 6367
322 Ga0495648_0023891 3300046524 Bacteria 4175
323 Ga0495666_0016302 3300046526 Bacteria 3701
324 Ga0495652_0095734 3300046529 Bacteria 2419
325 Ga0495665_0080390 3300046531 Bacteria 1715
326 Ga0495587_0036275 3300046536 Bacteria 2966
327 Ga0495598_0001316 3300046537 Bacteria 4867
328 Ga0495645_0067290 3300046543 Bacteria 2587
329 Ga0495667_0013502 3300046559 Bacteria 5526
330 Ga0495656_0001707 3300046615 Bacteria 7194
331 Ga0495668_0056045 3300046616 Bacteria 2176
332 Ga0495668_0116110 3300046616 Bacteria 1464
333 Ga0495625_0036421 3300046660 Bacteria 3617
334 Ga0495635_0052420 3300046663 Bacteria 2811
335 Ga0495599_0066225 3300046678 Bacteria 2257
336 Ga0495613_0143540 3300046689 Bacteria 1705
337 Ga0495624_0117790 3300046690 Bacteria 1632
338 Ga0495600_0014445 3300046809 Bacteria 4977
339 Ga0495581_0039925 3300047315 Bacteria 2717
340 Ga0495581_0087061 3300047315 Bacteria 1811
341 Ga0495604_0017364 3300047317 Bacteria 5760
342 Ga0495674_0003734 3300047319 Bacteria 14802
343 Ga0495676_0073042 3300047321 Bacteria 2632
344 Ga0495683_0104604 3300047323 Bacteria 1358
345 Ga0495687_004649 3300047443 Bacteria 9164
346 Ga0495675_0016660 3300047444 Bacteria 4646
347 Ga0495686_0192624 3300047472 Bacteria 1174
348 Ga0495593_0027093 3300047673 Bacteria 3157
349 Ga0495602_0004753 3300048088 Bacteria 14201
350 Ga0496102_0015818 3300048905 Bacteria 6577
351 Ga0496103_0005144 3300048906 Bacteria 7874
352 Ga0496104_0018081 3300048907 Bacteria 6427
353 Ga0496104_0019696 3300048907 Bacteria 6178
354 Ga0496104_0461524 3300048907 Unclassified 1182
355 Ga0496105_0009183 3300048908 Bacteria 7719
356 Ga0496105_0044619 3300048908 Bacteria 3657
357 Ga0496106_0003823 3300048909 Bacteria 11227
358 Ga0496108_0062679 3300048911 Bacteria 3131
359 Ga0496108_0070864 3300048911 Bacteria 2941
360 Ga0496109_0167865 3300048912 Bacteria 2058
361 Ga0496110_0017537 3300048913 Bacteria 5989
362 Ga0496110_0026967 3300048913 Bacteria 4921
363 Ga0496111_0120804 3300048914 Bacteria 1935
364 Ga0496112_0002011 3300048915 Bacteria 16082
365 Ga0496113_0017762 3300048916 Bacteria 4945
366 Ga0496114_0382063 3300048917 Bacteria 1247
367 Ga0496115_0017915 3300048918 Bacteria 5426
368 Ga0496117_0105658 3300048920 Bacteria 1769
369 Ga0496117_0116647 3300048920 Bacteria 1650
370 Ga0496118_0049073 3300048921 Bacteria 3253
371 Ga0496118_0054636 3300048921 Bacteria 3023
372 Ga0496118_0064424 3300048921 Bacteria 2689
373 Ga0496119_0047131 3300048922 Bacteria 2684
374 Ga0496121_0012571 3300048924 Bacteria 9209
375 Ga0496121_0165055 3300048924 Bacteria 1615
376 Ga0496121_0191704 3300048924 Bacteria 1465
377 Ga0496124_0004856 3300048927 Bacteria 15458
378 Ga0496125_0051589 3300048928 Bacteria 3391
379 Ga0496125_0127664 3300048928 Bacteria 1798
380 Ga0496126_0015119 3300048929 Bacteria 7773
381 Ga0496126_0072528 3300048929 Bacteria 3063
382 Ga0496126_0162074 3300048929 Bacteria 1910
383 Ga0495682_0006074 3300049460 Bacteria 4925
384 Ga0501031_0033795 3300049568 Bacteria 3338
385 Ga0501032_0048607 3300049569 Bacteria 2864
386 Ga0501033_0184967 3300049570 Bacteria 1493
387 Ga0501034_0010066 3300049571 Bacteria 9869
388 Ga0501034_0067853 3300049571 Bacteria 3578
389 Ga0501034_0126538 3300049571 Bacteria 2540
390 Ga0501036_0042110 3300049572 Bacteria 3866
391 Ga0501036_0050115 3300049572 Bacteria 3536
392 Ga0501036_0177351 3300049572 Bacteria 1794
393 Ga0501037_0017772 3300049573 Bacteria 5234
394 Ga0501037_0017892 3300049573 Bacteria 5217
395 Ga0501038_0027477 3300049574 Bacteria 5062
396 Ga0501038_0039605 3300049574 Bacteria 4121
397 Ga0501039_0004433 3300049575 Bacteria 10598
398 Ga0501039_0035713 3300049575 Bacteria 3837
399 Ga0501040_0026385 3300049576 Bacteria 3907
400 Ga0501040_0243854 3300049576 Bacteria 1281
401 Ga0501041_0089585 3300049577 Bacteria 1899
402 Ga0501042_0131844 3300049578 Bacteria 1801
403 Ga0501043_0032719 3300049579 Bacteria 4089
404 Ga0501043_0036619 3300049579 Bacteria 3861
405 Ga0501043_0048713 3300049579 Bacteria 3331
406 Ga0501046_0030365 3300049580 Bacteria 4386
407 Ga0501046_0071971 3300049580 Bacteria 2685
408 Ga0501046_0187823 3300049580 Bacteria 1543
409 Ga0501047_0026623 3300049581 Bacteria 5565
410 Ga0501047_0068877 3300049581 Bacteria 3408
411 Ga0501047_0122786 3300049581 Bacteria 2478
412 Ga0501067_0069889 3300049583 Bacteria 1944
413 Ga0501068_0009831 3300049584 Bacteria 5357
414 Ga0501068_0016664 3300049584 Bacteria 4238
415 Ga0501068_0155658 3300049584 Bacteria 1439
416 Ga0501070_0015517 3300049586 Bacteria 6407
417 Ga0501070_0094945 3300049586 Bacteria 2468
418 Ga0501070_0361341 3300049586 Bacteria 1178
419 Ga0501071_0025604 3300049587 Bacteria 4135
420 Ga0501072_0037641 3300049588 Bacteria 3794
421 Ga0501072_0074360 3300049588 Bacteria 2687
422 Ga0501073_0004250 3300049589 Bacteria 10740
423 Ga0501073_0008806 3300049589 Bacteria 7463
424 Ga0501073_0019992 3300049589 Bacteria 4829
425 Ga0501073_0115360 3300049589 Bacteria 1862
426 Ga0501073_0118303 3300049589 Bacteria 1836
427 Ga0501074_0095198 3300049590 Bacteria 2132
428 Ga0501074_0132831 3300049590 Bacteria 1780
429 Ga0501074_0356240 3300049590 Bacteria 1038
430 Ga0501075_0036091 3300049591 Bacteria 3689
431 Ga0501075_0046906 3300049591 Bacteria 3246
432 Ga0501076_0191899 3300049592 Bacteria 1667
433 Ga0501079_0024115 3300049741 Bacteria 4668
434 Ga0501079_0191242 3300049741 Bacteria 1597
435 Ga0501080_0036427 3300049742 Bacteria 4592
436 Ga0501080_0172301 3300049742 Bacteria 1995
437 Ga0501080_0256330 3300049742 Bacteria 1594
438 Ga0501081_0004975 3300049743 Bacteria 8554
439 Ga0501081_0046301 3300049743 Bacteria 2989
440 Ga0501081_0262292 3300049743 Bacteria 1263
441 Ga0501083_0105429 3300049744 Bacteria 1856
442 Ga0501035_0083352 3300049822 Bacteria 2821
443 Ga0501035_0092559 3300049822 Bacteria 2660
444 Ga0501044_0028299 3300049823 Bacteria 5915
445 Ga0501044_0051091 3300049823 Bacteria 4264
446 Ga0501044_0077724 3300049823 Bacteria 3365
447 Ga0501044_0434340 3300049823 Bacteria 1222
448 nmdc:mga03n38_120773_c1 3300050490 Bacteria 1287
449 nmdc:mga00v17_115981_c1 3300050491 Bacteria 1702
450 nmdc:mga00v17_43233_c1 3300050491 Bacteria 2712
451 nmdc:mga0yw44_120880_c1 3300050492 Bacteria 1687
452 nmdc:mga0yw44_34852_c1 3300050492 Bacteria 2953
453 nmdc:mga0yw44_5085_c1 3300050492 Bacteria 6149
454 nmdc:mga0k408_4087_c1 3300050493 Bacteria 7746
455 nmdc:mga06z11_263493_c1 3300050494 Bacteria 1018
456 nmdc:mga06z11_4875_c1 3300050494 Bacteria 5320
457 nmdc:mga04h51_28882_c1 3300050495 Bacteria 1733
458 nmdc:mga04h51_3374_c1 3300050495 Bacteria 3879
459 nmdc:mga07m45_15562_c1 3300050496 Bacteria 4062
460 nmdc:mga07m45_65855_c1 3300050496 Bacteria 2058
461 nmdc:mga05p37_254205_c1 3300050507 Bacteria 2106
462 nmdc:mga05p37_47532_c1 3300050507 Bacteria 5277
463 nmdc:mga06r32_35621_c1 3300050510 Bacteria 4696
464 nmdc:mga0sz30_2709_c1 3300050516 Bacteria 6320
465 nmdc:mga0sz30_4086_c1 3300050516 Bacteria 5255
466 Ga0495601_0000401 3300053077 Bacteria 22929
467 Ga0495601_0037293 3300053077 Bacteria 3039
468 Ga0495601_0100802 3300053077 Bacteria 1865
469 Ga0495612_0004593 3300053078 Bacteria 5724
470 Ga0500610_0021213 3300053079 Bacteria 3184
471 Ga0495655_0012846 3300053083 Bacteria 1717
472 Ga0495595_0018010 3300053084 Bacteria 3046
473 Ga0495619_0156498 3300053085 Bacteria 1573
474 Ga0500644_0094347 3300053088 Bacteria 1126
475 Ga0500566_0053510 3300053094 Bacteria 2304
476 Ga0500641_0001034 3300053096 Bacteria 9888
477 Ga0500595_001200 3300053119 Bacteria 14322
478 Ga0500595_019950 3300053119 Bacteria 2422
479 Ga0500658_0007094 3300053134 Bacteria 4146
480 Ga0500658_0028153 3300053134 Bacteria 2178
481 Ga0500568_0000415 3300053139 Bacteria 32506
482 Ga0500568_0005175 3300053139 Bacteria 6797
483 Ga0500573_0007623 3300053140 Bacteria 5914
484 Ga0500588_0001609 3300053146 Bacteria 4352
485 Ga0500604_0000410 3300053151 Bacteria 11781
486 Ga0500604_0002740 3300053151 Bacteria 4786
487 Ga0500627_0066119 3300053158 Bacteria 1596
488 Ga0500596_004766 3300053735 Bacteria 2454
489 Ga0501084_0006518 3300054114 Bacteria 9592
490 Ga0501084_0115226 3300054114 Bacteria 2259
491 Ga0500661_002103 3300055283 Bacteria 3760
492 Ga0587084_010914 3300059477 Bacteria 1200
493 Ga0587073_0010929 3300059492 Bacteria 1538
494 Ga0587082_011103 3300059504 Bacteria 1312
495 Ga0587083_0019350 3300059505 Bacteria 1242
496 Ga0587085_012564 3300059506 Bacteria 1164
497 Ga0587091_017946 3300059511 Bacteria 1198
498 Ga0587067_018423 3300059640 Bacteria 1171
499 Ga0587069_005207 3300059642 Bacteria 1504
500 Ga0587078_005740 3300059646 Bacteria 1333
501 Ga0587079_021595 3300059647 Bacteria 1160
502 Ga0587111_0017062 3300060346 Bacteria 1348
503 Ga0501082_0004076 3300060353 Bacteria 12749
504 Ga0501082_0060048 3300060353 Bacteria 3275
505 Ga0530510_0023880 3300061734 Bacteria 4360
506 Ga0530510_0088728 3300061734 Bacteria 2254
507 2508731202 2508501050 Bacteria 9633614
508 2509116230 2508501123 Bacteria 6283661
509 2509143831 2508501127 Bacteria 7037543
510 2513611594 2513237090 Bacteria 7096802
511 2513644237 2513237094 Bacteria 8789602
512 2513718956 2513237104 Bacteria 10034502
513 2514591841 2513237351 Bacteria 6968952
514 2597812977 2597489875 Bacteria 7010078
515 2776261010 2775506901 Bacteria 9631051
516 2844012110 2844009547 Bacteria 6728125
517 2856344226 2856342000 Bacteria 7176905
518 2874126379 2874123672 Bacteria 7238285
519 2894236497 2894232714 Bacteria 8834183
520 2909046988 2909042592 Bacteria 6499737
521 2917703686 2917699015 Bacteria 7043791
522 2924760584 2924754689 Bacteria 6774424
523 2924765921 2924762789 Bacteria 6561353
524 2932795590 2932794094 Bacteria 7915132
525 2932807814 2932801729 Bacteria 7987968
526 2935885991 2935883170 Bacteria 7964738
527 2937828009 2937822353 Bacteria 7290551
528 2970528255 2970524798 Bacteria 6840927
529 2977872103 2977864932 Bacteria 7534097
530 2987673247 2987666974 Bacteria 6509233
531 2996338060 2996336353 Bacteria 5511628
532 8004398878 8004395343 Bacteria 6620908
533 8016589702 8016583857 Bacteria 10421953
534 8054567355 8054563764 Bacteria 5592885
535 Ga0436365_0080604
536 JGI24736J21556_1009148
537 JGI24740J21852_10038660
538 JGI25157J39369_1000053
539 JGI25153J46596_10000033
540 JGI25153J46596_10000047
541 Ga0007409J51694_1063596
542 Ga0055539_1007310
543 Ga0055531_10017727
544 Ga0058859_11644255
545 Ga0070670_100046548
546 Ga0068869_100297488
547 Ga0068868_100022036
548 Ga0070668_100061731
549 Ga0070669_100023933
550 Ga0070669_100024423
551 Ga0070671_100001821
552 Ga0070671_100052791
553 Ga0070674_100014204
554 Ga0070674_100040430
555 Ga0070667_100250959
556 Ga0070709_10032404
557 Ga0070709_10254262
558 Ga0070714_100118377
559 Ga0070713_100030748
560 Ga0070713_100065365
561 Ga0070713_100159587
562 Ga0070710_10001811
563 Ga0070711_100000775
564 Ga0070711_100023269
565 Ga0070708_100427556
566 Ga0070681_10357440
567 Ga0070706_100269969
568 Ga0070707_100166578
569 Ga0070698_100152117
570 Ga0070699_100064615
571 Ga0070699_100072825
572 Ga0070665_100111501
573 Ga0068856_100033930
574 Ga0068856_100066950
575 Ga0068864_100005685
576 Ga0068864_100118959
577 Ga0068863_100089005
578 Ga0068863_100108199
579 Ga0068863_100175827
580 Ga0068860_100000071
581 Ga0068860_100375530
582 Ga0068862_100004858
583 Ga0068862_100097814
584 Ga0068862_100118879
585 Ga0081455_10004324
586 Ga0081455_10038463
587 Ga0081455_10058524
588 Ga0081538_10014432
589 Ga0081539_10004580
590 Ga0070717_10075318
591 Ga0075365_10038225
592 Ga0075365_10049867
593 Ga0075368_10000497
594 Ga0075368_10039176
595 Ga0075363_100019120
596 Ga0075364_10013847
597 Ga0075364_10176741
598 Ga0070716_100002789
599 Ga0070716_100111088
600 Ga0075362_10096608
601 Ga0075367_10005545
602 Ga0075369_10004466
603 Ga0075369_10007492
604 Ga0075366_10001925
605 Ga0075366_10039772
606 Ga0075370_10014816
607 Ga0075431_100001645
608 Ga0075429_100008179
609 Ga0075435_100051158
610 Ga0099795_10000562
611 Ga0099795_10001819
612 Ga0105240_10001110
613 Ga0111539_10160770
614 Ga0105245_10011532
615 Ga0105245_10307788
616 Ga0105247_10006831
617 Ga0105247_10087721
618 Ga0114129_10002004
619 Ga0114129_10063159
620 Ga0114129_10086362
621 Ga0114129_10609368
622 Ga0105243_10072844
623 Ga0105243_10104567
624 Ga0105243_10242277
625 Ga0105241_10014651
626 Ga0105241_10211752
627 Ga0105242_10279138
628 Ga0105248_10038130
629 Ga0105248_10119957
630 Ga0105237_10001437
631 Ga0105237_10018733
632 Ga0105237_10037163
633 Ga0105237_10136106
634 Ga0105237_10167184
635 Ga0105238_10009620
636 Ga0105238_10240358
637 Ga0105249_10167069
638 Ga0099796_10001356
639 Ga0099796_10043293
640 Ga0105239_10000745
641 Ga0105239_10026833
642 Ga0105239_10277704
643 Ga0105246_10013177
644 Ga0171462_1018
645 Ga0157374_10147453
646 Ga0157378_10055199
647 Ga0163162_10349330
648 Ga0157375_10302130
649 Ga0163163_10027568
650 Ga0163163_10044469
651 Ga0163163_10336774
652 Ga0157380_10002708
653 Ga0157380_10049965
654 Ga0182008_10013499
655 Ga0157379_10051127
656 Ga0206356_10374033
657 Ga0213872_10058457
658 Ga0213874_10008493
659 Ga0213874_10014532
660 Ga0213874_10035703
661 Ga0213874_10056785
662 Ga0213876_10001084
663 Ga0213876_10006877
664 Ga0213876_10010546
665 Ga0213876_10027134
666 Ga0213876_10054392
667 Ga0213876_10102126
668 Ga0213875_10001310
669 Ga0213871_10000427
670 Ga0209026_1000002
671 Ga0209677_102414
672 Ga0209148_1005987
673 Ga0209759_1000156
674 Ga0209233_1007445
675 Ga0209455_1003921
676 Ga0209758_1000070
677 Ga0209257_1000296
678 Ga0209257_1010756
679 Ga0207697_10034355
680 Ga0207692_10002105
681 Ga0207710_10015391
682 Ga0207688_10028497
683 Ga0207688_10082873
684 Ga0207647_10092252
685 Ga0207699_10000342
686 Ga0207684_10073707
687 Ga0207695_10002742
688 Ga0207695_10144539
689 Ga0207671_10012515
690 Ga0207671_10034785
691 Ga0207693_10015759
692 Ga0207663_10002594
693 Ga0207663_10029475
694 Ga0207646_10169474
695 Ga0207694_10036316
696 Ga0207694_10122923
697 Ga0207650_10106835
698 Ga0207687_10013924
699 Ga0207687_10201082
700 Ga0207700_10014343
701 Ga0207700_10027158
702 Ga0207700_10131681
703 Ga0207644_10006900
704 Ga0207686_10101308
705 Ga0207704_10187444
706 Ga0207665_10005896
707 Ga0207665_10071081
708 Ga0207665_10090516
709 Ga0207711_10170307
710 Ga0207712_10349576
711 Ga0207658_10210976
712 Ga0207677_10242485
713 Ga0207703_10077629
714 Ga0207678_10481631
715 Ga0207702_10038849
716 Ga0207702_10059641
717 Ga0207641_10035203
718 Ga0207641_10078841
719 Ga0207641_10157477
720 Ga0207676_10061246
721 Ga0209179_1000445
722 Ga0209588_1000761
723 Ga0209813_10005925
724 Ga0268266_10091833
725 Ga0268266_10180407
726 Ga0268266_10294747
727 Ga0268266_10370282
728 Ga0268266_10402798
729 Ga0268265_10028318
730 Ga0268265_10091693
731 Ga0268264_10000073
732 Ga0307517_10000102
733 Ga0265339_10011213
734 Ga0307513_10027790
735 Ga0307509_10081172
736 Ga0307408_100207820
737 Ga0265313_10003998
738 Ga0265313_10063937
739 Ga0307508_10001119
740 Ga0307508_10012324
741 Ga0307508_10120972
742 Ga0307516_10002286
743 Ga0307516_10012185
744 Ga0307516_10020911
745 Ga0307516_10047076
746 Ga0307413_10025079
747 Ga0307410_10135939
748 Ga0307410_10294560
749 Ga0307406_10190313
750 Ga0307407_10076779
751 Ga0307407_10193157
752 Ga0307409_100001154
753 Ga0307409_100018544
754 Ga0307409_100550605
755 Ga0307416_100028819
756 Ga0307416_100094703
757 Ga0307414_10031227
758 Ga0307414_10212217
759 Ga0307411_10072761
760 Ga0307411_10156256
761 Ga0307415_100259040
762 Ga0307507_10009514
763 Ga0307510_10026169
764 Ga0307510_10093380
765 Ga0307510_10161899
766 Ga0307510_10179293
767 Ga0373936_0013779
768 Ga0373936_0080801
769 Ga0373957_0021283
770 Ga0373957_0088542
771 Ga0373943_0025043
772 Ga0373943_0093329
773 Ga0373946_0017193
774 Ga0373946_0024914
775 Ga0373955_0047675
776 Ga0373931_0219196
777 Ga0373935_0001741
778 Ga0373935_0056915
779 Ga0373927_0001969
780 Ga0373927_0021434
781 Ga0373927_0068407
782 Ga0373933_0167981
783 Ga0373947_0001689
784 Ga0373947_0023523
785 Ga0310104_04004
786 Ga0373937_0039005
787 Ga0373937_0061257
788 Ga0373937_0146168
789 Ga0373925_0014218
790 Ga0373925_0289969
791 Ga0436364_0129896
792 Ga0436364_0852425
793 Ga0436364_1222998
794 Ga0436364_1244484
795 Ga0436364_1332447
796 Ga0436364_1407022
797 Ga0400483_099887
798 Ga0400483_199574
799 Ga0400483_202169
800 Ga0436365_0026609
801 Ga0436365_0291258
802 Ga0436365_0709674
803 Ga0436365_0929115
804 Ga0436365_1455492
805 Ga0436365_1601812
806 Ga0436365_1604205
807 Ga0436360_0018179
808 Ga0436360_0133944
809 Ga0436360_0544469
810 Ga0436360_1007049
811 Ga0436360_1340806
812 Ga0436361_0090772
813 Ga0436363_0250085
814 Ga0436363_0288203
815 Ga0436363_0551334
816 Ga0436363_0816820
817 Ga0436363_0963507
818 Ga0436363_0988615
819 Ga0436363_1286681
820 Ga0436362_0090040
821 Ga0436362_0674326
822 Ga0436362_1130295
823 Ga0439453_0007850
824 Ga0439451_026702
825 Ga0439435_0006553
826 Ga0466969_0061895
827 Ga0466966_0043460
828 Ga0466961_0114476
829 Ga0466959_0012848
830 Ga0466958_0218131
831 Ga0495592_0177217
832 Ga0495638_0010023
833 Ga0495638_0120645
834 Ga0495651_0061787
835 Ga0495580_0075734
836 Ga0495582_0033522
837 Ga0495639_0025115
838 Ga0495662_0045534
839 Ga0495664_0001193
840 Ga0495664_0003872
841 Ga0495664_0098904
842 Ga0495584_0111252
843 Ga0495606_0016578
844 Ga0495606_0045366
845 Ga0495606_0073650
846 Ga0495606_0177038
847 Ga0495608_0118336
848 Ga0495610_0057869
849 Ga0495616_0050169
850 Ga0495618_0117496
851 Ga0495620_0065854
852 Ga0495630_0002691
853 Ga0495632_0078858
854 Ga0495632_0119103
855 Ga0495643_0008781
856 Ga0495648_0023891
857 Ga0495666_0016302
858 Ga0495652_0095734
859 Ga0495665_0080390
860 Ga0495587_0036275
861 Ga0495598_0001316
862 Ga0495645_0067290
863 Ga0495667_0013502
864 Ga0495656_0001707
865 Ga0495668_0056045
866 Ga0495668_0116110
867 Ga0495625_0036421
868 Ga0495635_0052420
869 Ga0495599_0066225
870 Ga0495613_0143540
871 Ga0495624_0117790
872 Ga0495600_0014445
873 Ga0495581_0039925
874 Ga0495581_0087061
875 Ga0495604_0017364
876 Ga0495674_0003734
877 Ga0495676_0073042
878 Ga0495683_0104604
879 Ga0495687_004649
880 Ga0495675_0016660
881 Ga0495686_0192624
882 Ga0495593_0027093
883 Ga0495602_0004753
884 Ga0496102_0015818
885 Ga0496103_0005144
886 Ga0496104_0018081
887 Ga0496104_0019696
888 Ga0496104_0461524
889 Ga0496105_0009183
890 Ga0496105_0044619
891 Ga0496106_0003823
892 Ga0496108_0062679
893 Ga0496108_0070864
894 Ga0496109_0167865
895 Ga0496110_0017537
896 Ga0496110_0026967
897 Ga0496111_0120804
898 Ga0496112_0002011
899 Ga0496113_0017762
900 Ga0496114_0382063
901 Ga0496115_0017915
902 Ga0496117_0105658
903 Ga0496117_0116647
904 Ga0496118_0049073
905 Ga0496118_0054636
906 Ga0496118_0064424
907 Ga0496119_0047131
908 Ga0496121_0012571
909 Ga0496121_0165055
910 Ga0496121_0191704
911 Ga0496124_0004856
912 Ga0496125_0051589
913 Ga0496125_0127664
914 Ga0496126_0015119
915 Ga0496126_0072528
916 Ga0496126_0162074
917 Ga0495682_0006074
918 Ga0501031_0033795
919 Ga0501032_0048607
920 Ga0501033_0184967
921 Ga0501034_0010066
922 Ga0501034_0067853
923 Ga0501034_0126538
924 Ga0501036_0042110
925 Ga0501036_0050115
926 Ga0501036_0177351
927 Ga0501037_0017772
928 Ga0501037_0017892
929 Ga0501038_0027477
930 Ga0501038_0039605
931 Ga0501039_0004433
932 Ga0501039_0035713
933 Ga0501040_0026385
934 Ga0501040_0243854
935 Ga0501041_0089585
936 Ga0501042_0131844
937 Ga0501043_0032719
938 Ga0501043_0036619
939 Ga0501043_0048713
940 Ga0501046_0030365
941 Ga0501046_0071971
942 Ga0501046_0187823
943 Ga0501047_0026623
944 Ga0501047_0068877
945 Ga0501047_0122786
946 Ga0501067_0069889
947 Ga0501068_0009831
948 Ga0501068_0016664
949 Ga0501068_0155658
950 Ga0501070_0015517
951 Ga0501070_0094945
952 Ga0501070_0361341
953 Ga0501071_0025604
954 Ga0501072_0037641
955 Ga0501072_0074360
956 Ga0501073_0004250
957 Ga0501073_0008806
958 Ga0501073_0019992
959 Ga0501073_0115360
960 Ga0501073_0118303
961 Ga0501074_0095198
962 Ga0501074_0132831
963 Ga0501074_0356240
964 Ga0501075_0036091
965 Ga0501075_0046906
966 Ga0501076_0191899
967 Ga0501079_0024115
968 Ga0501079_0191242
969 Ga0501080_0036427
970 Ga0501080_0172301
971 Ga0501080_0256330
972 Ga0501081_0004975
973 Ga0501081_0046301
974 Ga0501081_0262292
975 Ga0501083_0105429
976 Ga0501035_0083352
977 Ga0501035_0092559
978 Ga0501044_0028299
979 Ga0501044_0051091
980 Ga0501044_0077724
981 Ga0501044_0434340
982 nmdc:mga03n38_120773_c1
983 nmdc:mga00v17_115981_c1
984 nmdc:mga00v17_43233_c1
985 nmdc:mga0yw44_120880_c1
986 nmdc:mga0yw44_34852_c1
987 nmdc:mga0yw44_5085_c1
988 nmdc:mga0k408_4087_c1
989 nmdc:mga06z11_263493_c1
990 nmdc:mga06z11_4875_c1
991 nmdc:mga04h51_28882_c1
992 nmdc:mga04h51_3374_c1
993 nmdc:mga07m45_15562_c1
994 nmdc:mga07m45_65855_c1
995 nmdc:mga05p37_254205_c1
996 nmdc:mga05p37_47532_c1
997 nmdc:mga06r32_35621_c1
998 nmdc:mga0sz30_2709_c1
999 nmdc:mga0sz30_4086_c1
1000 Ga0495601_0000401
1001 Ga0495601_0037293
1002 Ga0495601_0100802
1003 Ga0495612_0004593
1004 Ga0500610_0021213
1005 Ga0495655_0012846
1006 Ga0495595_0018010
1007 Ga0495619_0156498
1008 Ga0500644_0094347
1009 Ga0500566_0053510
1010 Ga0500641_0001034
1011 Ga0500595_001200
1012 Ga0500595_019950
1013 Ga0500658_0007094
1014 Ga0500658_0028153
1015 Ga0500568_0000415
1016 Ga0500568_0005175
1017 Ga0500573_0007623
1018 Ga0500588_0001609
1019 Ga0500604_0000410
1020 Ga0500604_0002740
1021 Ga0500627_0066119
1022 Ga0500596_004766
1023 Ga0501084_0006518
1024 Ga0501084_0115226
1025 Ga0500661_002103
1026 Ga0587084_010914
1027 Ga0587073_0010929
1028 Ga0587082_011103
1029 Ga0587083_0019350
1030 Ga0587085_012564
1031 Ga0587091_017946
1032 Ga0587067_018423
1033 Ga0587069_005207
1034 Ga0587078_005740
1035 Ga0587079_021595
1036 Ga0587111_0017062
1037 Ga0501082_0004076
1038 Ga0501082_0060048
1039 Ga0530510_0023880
1040 Ga0530510_0088728
1041 2508731202
1042 2509116230
1043 2509143831
1044 2513611594
1045 2513644237
1046 2513718956
1047 2514591841
1048 2597812977
1049 2776261010
1050 2844012110
1051 2856344226
1052 2874126379
1053 2894236497
1054 2909046988
1055 2917703686
1056 2924760584
1057 2924765921
1058 2932795590
1059 2932807814
1060 2935885991
1061 2937828009
1062 2970528255
1063 2977872103
1064 2987673247
1065 2996338060
1066 8004398878
1067 8016589702
1068 8054567355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

46

328

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wut-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose 0.9224 27 330
4zjp-assembly1.cif.gz_A structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose 0.9155 25 324
1drj-assembly1.cif.gz_A probing protein-protein interactions: the ribose-binding protein in bacterial transport and chemotaxis 0.9121 25 324
4zjp-assembly1.cif.gz_A structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose 0.9058 25 324
6gq0-assembly1.cif.gz_A crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus 0.9052 25 326
ID Description Score Start End Superfamily
af_P76142_29_128_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9439 28 131 3.40.50.2300
6dspB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9365 27 132 3.40.50.2300
3ksmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9332 28 131 3.40.50.2300
3rotB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9241 25 134 3.40.50.2300
3brsB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9225 28 134 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A531LFP3-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9741 130 334 GO:0030246
GO:0030288
AF-A0A531LFP3-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9694 130 334 GO:0030246
GO:0030288
AF-A0A532C8Q1-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9425 176 334
AF-A0A4Q6YFG6-F1-model_v4 deleted 0.933 22 331
AF-A0A532C8Q1-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9204 176 334

Map