F460601

General Info

Members Datasets Scaffolds Average Seq Length
534 302 528 203

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2524023250|2524610018
Length 224
Sequence TARRHGSKGACFIASRPGPYPMQKFTQLTGVAAPLRLMNVDTDMIIPADYLKTIKRTGLGAGLFASLRYKDGKAIEDFVLNKPAYAKASILIAGDNFGCGSSREHAPWALADYGIRCIIAPSFADIFFNNCFKNGILPIPMPVEVVERLMEAADNGANSTFTVDLETQKITLPDGSTIGFDVEPFRRECLLNGWDDIGLTLRNVDAIDSFEAKAKQDQSWLWAS

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
3 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
4 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
157 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
205 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
212 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
213 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
214 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
217 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
298 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
301 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
302 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0.94
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 0
Rhizoplane 1.5
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 7.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100289579 3300005329 Bacteria 1558
2 Ga0070690_100164253 3300005330 Bacteria 1524
3 Ga0070670_100051744 3300005331 Bacteria 3527
4 Ga0070670_100256582 3300005331 Bacteria 1523
5 Ga0070677_10015247 3300005333 Bacteria 2720
6 Ga0070677_10101605 3300005333 Bacteria 1269
7 Ga0068869_100371679 3300005334 Bacteria 1170
8 Ga0070666_10000210 3300005335 Bacteria 40037
9 Ga0070666_10018215 3300005335 Bacteria 4512
10 Ga0070680_100022779 3300005336 Bacteria 4991
11 Ga0070680_100469778 3300005336 Bacteria 1075
12 Ga0068868_100263827 3300005338 Bacteria 1453
13 Ga0070660_100024950 3300005339 Bacteria 4440
14 Ga0070660_100732446 3300005339 Bacteria 830
15 Ga0070689_100027470 3300005340 Bacteria 4290
16 Ga0070661_100000582 3300005344 Bacteria 27755
17 Ga0070669_100194816 3300005353 Bacteria 1591
18 Ga0070669_100623269 3300005353 Bacteria 905
19 Ga0070675_100084339 3300005354 Bacteria 2653
20 Ga0070675_100100537 3300005354 Bacteria 2435
21 Ga0070671_100223733 3300005355 Bacteria 1596
22 Ga0070671_100327818 3300005355 Bacteria 1305
23 Ga0070673_100037625 3300005364 Bacteria 3688
24 Ga0070673_100062317 3300005364 Bacteria 2962
25 Ga0070659_100061751 3300005366 Bacteria 2962
26 Ga0070709_10083677 3300005434 Bacteria 2087
27 Ga0070714_100051314 3300005435 Bacteria 3516
28 Ga0070714_100320356 3300005435 Bacteria 1450
29 Ga0070714_100602747 3300005435 Bacteria 1055
30 Ga0070714_100912710 3300005435 Bacteria 853
31 Ga0070713_100039903 3300005436 Bacteria 3814
32 Ga0070713_100071312 3300005436 Bacteria 2935
33 Ga0070713_100317582 3300005436 Bacteria 1438
34 Ga0070710_10398714 3300005437 Bacteria 922
35 Ga0070711_100111609 3300005439 Bacteria 2007
36 Ga0070700_100040182 3300005441 Bacteria 2862
37 Ga0070700_100272864 3300005441 Bacteria 1223
38 Ga0070678_100160356 3300005456 Bacteria 1821
39 Ga0070662_100442635 3300005457 Unclassified 1077
40 Ga0070681_10079213 3300005458 Bacteria 3242
41 Ga0070681_10090211 3300005458 Bacteria 3016
42 Ga0070681_10128651 3300005458 Bacteria 2465
43 Ga0070681_10208936 3300005458 Bacteria 1869
44 Ga0070681_10576859 3300005458 Bacteria 1039
45 Ga0068867_100191189 3300005459 Bacteria 1633
46 Ga0070679_100003831 3300005530 Bacteria 13806
47 Ga0070679_100302376 3300005530 Bacteria 1550
48 Ga0070697_100535664 3300005536 Bacteria 1026
49 Ga0068853_100387549 3300005539 Bacteria 1306
50 Ga0070672_100029815 3300005543 Bacteria 4094
51 Ga0070672_100178316 3300005543 Bacteria 1769
52 Ga0070686_100184851 3300005544 Bacteria 1483
53 Ga0070686_100602796 3300005544 Bacteria 866
54 Ga0070696_101079598 3300005546 Bacteria 674
55 Ga0070693_100458791 3300005547 Bacteria 896
56 Ga0070665_100147560 3300005548 Bacteria 2355
57 Ga0070665_100369592 3300005548 Bacteria 1441
58 Ga0070665_100928013 3300005548 Bacteria 883
59 Ga0068855_100033235 3300005563 Bacteria 6157
60 Ga0068855_100123435 3300005563 Bacteria 2963
61 Ga0068855_100169302 3300005563 Bacteria 2475
62 Ga0068855_100287912 3300005563 Bacteria 1822
63 Ga0068855_100887579 3300005563 Bacteria 943
64 Ga0070664_100208071 3300005564 Bacteria 1748
65 Ga0070664_100290462 3300005564 Bacteria 1476
66 Ga0068857_100091306 3300005577 Bacteria 2726
67 Ga0068857_100448668 3300005577 Bacteria 1206
68 Ga0068856_100000522 3300005614 Bacteria 42457
69 Ga0068856_100130094 3300005614 Bacteria 2522
70 Ga0068856_100193534 3300005614 Bacteria 2047
71 Ga0068856_100393265 3300005614 Bacteria 1406
72 Ga0068852_100069237 3300005616 Bacteria 3092
73 Ga0068852_100466117 3300005616 Bacteria 1253
74 Ga0068852_101111772 3300005616 Unclassified 810
75 Ga0068859_100233362 3300005617 Bacteria 1928
76 Ga0068859_100321747 3300005617 Bacteria 1641
77 Ga0068864_100154841 3300005618 Bacteria 2079
78 Ga0068864_100673073 3300005618 Bacteria 1009
79 Ga0068861_100189384 3300005719 Unclassified 1718
80 Ga0068861_100834066 3300005719 Bacteria 868
81 Ga0068858_100311324 3300005842 Bacteria 1504
82 Ga0068862_100041570 3300005844 Bacteria 3912
83 Ga0068862_100454045 3300005844 Bacteria 1209
84 Ga0081455_10020970 3300005937 Bacteria 6140
85 Ga0081455_10577011 3300005937 Bacteria 738
86 Ga0081540_1009776 3300005983 Bacteria 6567
87 Ga0081539_10001781 3300005985 Bacteria 34193
88 Ga0081539_10004863 3300005985 Bacteria 14362
89 Ga0081539_10230982 3300005985 Bacteria 835
90 Ga0070717_10809040 3300006028 Bacteria 853
91 Ga0075365_10411625 3300006038 Bacteria 954
92 Ga0075364_10119452 3300006051 Bacteria 1764
93 Ga0070716_100302118 3300006173 Bacteria 1114
94 Ga0070712_100316092 3300006175 Bacteria 1269
95 Ga0075362_10005496 3300006177 Bacteria 4644
96 Ga0075362_10142092 3300006177 Bacteria 1147
97 Ga0075369_10003345 3300006186 Bacteria 5828
98 Ga0097621_100077322 3300006237 Bacteria 2762
99 Ga0097621_100316007 3300006237 Bacteria 1382
100 Ga0068871_100190287 3300006358 Bacteria 1767
101 Ga0068871_100296292 3300006358 Bacteria 1418
102 Ga0075428_100624626 3300006844 Bacteria 1150
103 Ga0075430_100283390 3300006846 Bacteria 1371
104 Ga0075431_100000858 3300006847 Bacteria 26654
105 Ga0075431_100008974 3300006847 Bacteria 10023
106 Ga0075433_10220634 3300006852 Bacteria 1684
107 Ga0075434_100223443 3300006871 Bacteria 1903
108 Ga0068865_100482960 3300006881 Bacteria 1030
109 Ga0075436_100101722 3300006914 Bacteria 2001
110 Ga0075436_100618192 3300006914 Bacteria 799
111 Ga0097620_100233351 3300006931 Bacteria 1928
112 Ga0097620_100321738 3300006931 Bacteria 1641
113 Ga0099795_10006310 3300007788 Bacteria 3227
114 Ga0099795_10016354 3300007788 Bacteria 2345
115 Ga0099795_10034401 3300007788 Bacteria 1765
116 Ga0105240_10123291 3300009093 Bacteria 3118
117 Ga0105240_10159953 3300009093 Bacteria 2676
118 Ga0105240_10233952 3300009093 Bacteria 2133
119 Ga0105240_10309285 3300009093 Bacteria 1805
120 Ga0105240_10523932 3300009093 Bacteria 1315
121 Ga0105240_10764847 3300009093 Bacteria 1049
122 Ga0111539_10026091 3300009094 Bacteria 7152
123 Ga0105245_10561765 3300009098 Bacteria 1164
124 Ga0114129_10065525 3300009147 Bacteria 5070
125 Ga0114129_10505255 3300009147 Bacteria 1578
126 Ga0105243_10126213 3300009148 Bacteria 2165
127 Ga0105242_10065378 3300009176 Bacteria 3000
128 Ga0105248_10272001 3300009177 Bacteria 1908
129 Ga0105248_11725806 3300009177 Bacteria 710
130 Ga0105237_10000304 3300009545 Bacteria 68213
131 Ga0105237_10201296 3300009545 Bacteria 1991
132 Ga0105237_10274715 3300009545 Bacteria 1688
133 Ga0105237_10388505 3300009545 Bacteria 1400
134 Ga0105237_11404928 3300009545 Bacteria 704
135 Ga0105238_10848401 3300009551 Bacteria 931
136 Ga0105249_10229596 3300009553 Bacteria 1830
137 Ga0099796_10026910 3300010159 Bacteria 1832
138 Ga0105246_10393844 3300011119 Bacteria 1148
139 Ga0157373_10306940 3300013100 Bacteria 1127
140 Ga0157371_10435177 3300013102 Bacteria 963
141 Ga0157370_10003211 3300013104 Bacteria 19328
142 Ga0157370_10026609 3300013104 Bacteria 5709
143 Ga0157370_10203548 3300013104 Bacteria 1836
144 Ga0157370_10209146 3300013104 Bacteria 1808
145 Ga0157370_10385956 3300013104 Bacteria 1290
146 Ga0157370_10612062 3300013104 Bacteria 997
147 Ga0157369_10014337 3300013105 Bacteria 8950
148 Ga0157369_10018323 3300013105 Bacteria 7851
149 Ga0157369_10061648 3300013105 Bacteria 4042
150 Ga0157369_10412526 3300013105 Bacteria 1400
151 Ga0157369_10919463 3300013105 Bacteria 897
152 Ga0157374_10132066 3300013296 Bacteria 2417
153 Ga0157374_10248049 3300013296 Bacteria 1752
154 Ga0163162_10119742 3300013306 Bacteria 2736
155 Ga0163162_10153579 3300013306 Bacteria 2421
156 Ga0157372_10060527 3300013307 Bacteria 4237
157 Ga0157372_10080366 3300013307 Bacteria 3688
158 Ga0157372_10179804 3300013307 Bacteria 2448
159 Ga0157372_11544630 3300013307 Bacteria 764
160 Ga0157375_10029144 3300013308 Bacteria 5186
161 Ga0157375_10039658 3300013308 Bacteria 4534
162 Ga0163163_10313989 3300014325 Bacteria 1621
163 Ga0157380_10045818 3300014326 Bacteria 3434
164 Ga0182008_10000171 3300014497 Bacteria 50744
165 Ga0182008_10091792 3300014497 Bacteria 1497
166 Ga0157379_10011036 3300014968 Bacteria 7874
167 Ga0157379_10076995 3300014968 Bacteria 2987
168 Ga0157379_10266928 3300014968 Bacteria 1556
169 Ga0163161_10257803 3300017792 Bacteria 1361
170 Ga0206355_1529234 3300020076 Bacteria 1106
171 Ga0213876_10060261 3300021384 Bacteria 2002
172 Ga0213876_10160791 3300021384 Bacteria 1194
173 Ga0213875_10000863 3300021388 Bacteria 22384
174 Ga0213875_10005044 3300021388 Bacteria 7154
175 Ga0224712_10089146 3300022467 Bacteria 1289
176 Ga0207673_1000811 3300025290 Bacteria 3375
177 Ga0207697_10083223 3300025315 Bacteria 1350
178 Ga0207682_10015551 3300025893 Bacteria 2963
179 Ga0207692_10412431 3300025898 Bacteria 844
180 Ga0207688_10015305 3300025901 Bacteria 4162
181 Ga0207688_10531688 3300025901 Bacteria 738
182 Ga0207680_10000318 3300025903 Bacteria 23043
183 Ga0207647_10076848 3300025904 Bacteria 2008
184 Ga0207699_10041749 3300025906 Bacteria 2652
185 Ga0207645_10278454 3300025907 Bacteria 1110
186 Ga0207707_10014668 3300025912 Bacteria 6829
187 Ga0207707_10077292 3300025912 Bacteria 2906
188 Ga0207707_10081496 3300025912 Bacteria 2825
189 Ga0207707_10241547 3300025912 Bacteria 1570
190 Ga0207695_10077314 3300025913 Bacteria 3381
191 Ga0207695_10166990 3300025913 Bacteria 2128
192 Ga0207695_10221076 3300025913 Bacteria 1801
193 Ga0207695_10370602 3300025913 Bacteria 1318
194 Ga0207695_10502989 3300025913 Bacteria 1094
195 Ga0207671_10001956 3300025914 Bacteria 22727
196 Ga0207671_10270766 3300025914 Bacteria 1338
197 Ga0207671_10372587 3300025914 Bacteria 1134
198 Ga0207693_10012149 3300025915 Bacteria 6958
199 Ga0207693_10046205 3300025915 Bacteria 3420
200 Ga0207663_10299579 3300025916 Bacteria 1201
201 Ga0207660_10260073 3300025917 Bacteria 1372
202 Ga0207662_10062967 3300025918 Bacteria 2230
203 Ga0207657_10095173 3300025919 Bacteria 2478
204 Ga0207649_10000036 3300025920 Bacteria 132545
205 Ga0207652_10048090 3300025921 Bacteria 3645
206 Ga0207652_10509323 3300025921 Bacteria 1083
207 Ga0207681_10048651 3300025923 Bacteria 2863
208 Ga0207681_10378476 3300025923 Bacteria 1139
209 Ga0207694_10023854 3300025924 Bacteria 4645
210 Ga0207694_10467016 3300025924 Bacteria 1055
211 Ga0207650_10021483 3300025925 Bacteria 4561
212 Ga0207650_10195200 3300025925 Bacteria 1619
213 Ga0207659_10048971 3300025926 Bacteria 2995
214 Ga0207700_10012180 3300025928 Bacteria 5532
215 Ga0207700_10022784 3300025928 Bacteria 4302
216 Ga0207700_10087330 3300025928 Bacteria 2453
217 Ga0207700_10091490 3300025928 Bacteria 2403
218 Ga0207700_10147626 3300025928 Bacteria 1940
219 Ga0207700_10261100 3300025928 Bacteria 1483
220 Ga0207664_10128770 3300025929 Bacteria 2128
221 Ga0207664_10381599 3300025929 Bacteria 1251
222 Ga0207709_10361063 3300025935 Bacteria 1100
223 Ga0207669_10011067 3300025937 Bacteria 4374
224 Ga0207691_10135303 3300025940 Bacteria 2174
225 Ga0207691_10147738 3300025940 Bacteria 2068
226 Ga0207711_10253299 3300025941 Bacteria 1617
227 Ga0207689_10062348 3300025942 Bacteria 3066
228 Ga0207661_10133363 3300025944 Bacteria 2131
229 Ga0207661_10393330 3300025944 Bacteria 1256
230 Ga0207679_10092082 3300025945 Bacteria 2348
231 Ga0207667_10089982 3300025949 Bacteria 3172
232 Ga0207667_10327015 3300025949 Bacteria 1565
233 Ga0207667_10507699 3300025949 Bacteria 1222
234 Ga0207667_10587014 3300025949 Bacteria 1124
235 Ga0207640_10091261 3300025981 Bacteria 2110
236 Ga0207677_10133911 3300026023 Bacteria 1886
237 Ga0207703_10040606 3300026035 Bacteria 3724
238 Ga0207639_10522071 3300026041 Bacteria 1087
239 Ga0207678_10309592 3300026067 Bacteria 1358
240 Ga0207708_10046860 3300026075 Bacteria 3292
241 Ga0207702_10000014 3300026078 Bacteria 253304
242 Ga0207702_10136553 3300026078 Bacteria 2213
243 Ga0207641_10063753 3300026088 Bacteria 3148
244 Ga0207641_10118280 3300026088 Bacteria 2360
245 Ga0207641_10974885 3300026088 Bacteria 844
246 Ga0207648_10040461 3300026089 Bacteria 4096
247 Ga0207676_10012081 3300026095 Bacteria 6179
248 Ga0207676_10571858 3300026095 Bacteria 1082
249 Ga0207676_10769914 3300026095 Bacteria 937
250 Ga0207674_10030475 3300026116 Bacteria 5670
251 Ga0207674_10324747 3300026116 Bacteria 1488
252 Ga0207674_11288899 3300026116 Bacteria 700
253 Ga0207675_100024271 3300026118 Bacteria 5638
254 Ga0207675_100858476 3300026118 Bacteria 923
255 Ga0207683_10501860 3300026121 Bacteria 1121
256 Ga0207698_10052846 3300026142 Bacteria 3115
257 Ga0207698_10096453 3300026142 Bacteria 2437
258 Ga0209966_1088460 3300027695 Bacteria 692
259 Ga0207428_10012127 3300027907 Bacteria 7582
260 Ga0268266_10099352 3300028379 Bacteria 2562
261 Ga0268266_10273283 3300028379 Bacteria 1569
262 Ga0268265_10029583 3300028380 Bacteria 3934
263 Ga0268265_10043021 3300028380 Bacteria 3355
264 Ga0268265_10402822 3300028380 Bacteria 1265
265 Ga0268265_11339332 3300028380 Bacteria 717
266 Ga0265319_1005645 3300028563 Bacteria 5949
267 Ga0265319_1070464 3300028563 Bacteria 1121
268 Ga0265334_10000242 3300028573 Bacteria 31502
269 Ga0265318_10000024 3300028577 Bacteria 159801
270 Ga0307517_10108323 3300028786 Bacteria 2134
271 Ga0307515_10050694 3300028794 Bacteria 6209
272 Ga0265338_10033908 3300028800 Bacteria 4945
273 Ga0265338_10082115 3300028800 Bacteria 2699
274 Ga0307512_10031923 3300030522 Bacteria 4555
275 Ga0265762_1037011 3300030760 Bacteria 944
276 Ga0265760_10072497 3300031090 Bacteria 1058
277 Ga0265330_10002684 3300031235 Bacteria 9616
278 Ga0265332_10014578 3300031238 Bacteria 3477
279 Ga0265332_10041515 3300031238 Bacteria 1990
280 Ga0265328_10007268 3300031239 Bacteria 4628
281 Ga0265328_10036071 3300031239 Bacteria 1827
282 Ga0265320_10008638 3300031240 Bacteria 6214
283 Ga0265320_10022856 3300031240 Bacteria 3338
284 Ga0265320_10086039 3300031240 Bacteria 1462
285 Ga0265325_10006476 3300031241 Bacteria 7098
286 Ga0265329_10000807 3300031242 Bacteria 15917
287 Ga0265329_10033083 3300031242 Bacteria 1672
288 Ga0265340_10004949 3300031247 Bacteria 7407
289 Ga0265340_10012368 3300031247 Bacteria 4510
290 Ga0265339_10007816 3300031249 Bacteria 6867
291 Ga0265339_10019827 3300031249 Bacteria 3939
292 Ga0265339_10059572 3300031249 Bacteria 2059
293 Ga0265331_10005325 3300031250 Bacteria 7783
294 Ga0265331_10005675 3300031250 Bacteria 7496
295 Ga0265331_10031957 3300031250 Bacteria 2612
296 Ga0307513_10013624 3300031456 Bacteria 9969
297 Ga0307509_10071030 3300031507 Bacteria 3633
298 Ga0265313_10003524 3300031595 Bacteria 12621
299 Ga0307508_10000358 3300031616 Bacteria 55352
300 Ga0265314_10002039 3300031711 Bacteria 21396
301 Ga0265314_10028433 3300031711 Bacteria 4168
302 Ga0265314_10030196 3300031711 Bacteria 4015
303 Ga0265342_10010141 3300031712 Bacteria 6565
304 Ga0265342_10012608 3300031712 Bacteria 5719
305 Ga0316576_10008993 3300031727 Bacteria 6419
306 Ga0316045_117561 3300031815 Bacteria 718
307 Ga0307416_100438232 3300032002 Bacteria 1356
308 Ga0307415_100368680 3300032126 Bacteria 1215
309 Ga0316580_10095074 3300032139 Bacteria 912
310 Ga0307510_10202843 3300033180 Bacteria 1515
311 Ga0307510_10267875 3300033180 Bacteria 1186
312 Ga0316212_1021453 3300033547 Bacteria 906
313 Ga0373934_0057809 3300035086 Bacteria 1543
314 Ga0373944_0089018 3300035089 Bacteria 1030
315 Ga0373923_0047470 3300035111 Bacteria 1790
316 Ga0373945_0032316 3300035116 Bacteria 1854
317 Ga0373945_0309426 3300035116 Bacteria 678
318 Ga0373953_0216421 3300035117 Bacteria 830
319 Ga0373954_0072677 3300035118 Bacteria 1636
320 Ga0373954_0072697 3300035118 Bacteria 1636
321 Ga0373943_0126819 3300035170 Bacteria 1362
322 Ga0373943_0177257 3300035170 Bacteria 1170
323 Ga0373943_0303924 3300035170 Bacteria 906
324 Ga0373946_0080103 3300035171 Bacteria 1428
325 Ga0373955_0007276 3300035172 Bacteria 5082
326 Ga0373955_0306411 3300035172 Bacteria 958
327 Ga0373961_0140530 3300035241 Bacteria 815
328 Ga0373962_0090821 3300035242 Bacteria 940
329 Ga0373931_0063931 3300035691 Bacteria 1990
330 Ga0373931_0085098 3300035691 Bacteria 1752
331 Ga0373931_0264685 3300035691 Bacteria 1050
332 Ga0373935_0037739 3300035692 Bacteria 3024
333 Ga0373935_0502843 3300035692 Bacteria 880
334 Ga0373927_0488090 3300035695 Bacteria 814
335 Ga0373933_0023643 3300035724 Bacteria 3513
336 Ga0373933_0093860 3300035724 Bacteria 1855
337 Ga0373933_0157650 3300035724 Bacteria 1440
338 Ga0373947_0160997 3300035725 Bacteria 1451
339 Ga0373937_0008874 3300036401 Bacteria 8728
340 Ga0373937_0012551 3300036401 Bacteria 7454
341 Ga0373937_0066253 3300036401 Bacteria 3325
342 Ga0373937_0146600 3300036401 Bacteria 2210
343 Ga0373937_0676124 3300036401 Unclassified 978
344 Ga0316584_0727267 3300036712 Bacteria 679
345 Ga0373925_0169343 3300037068 Bacteria 1724
346 Ga0373925_0531226 3300037068 Bacteria 967
347 Ga0373925_0826561 3300037068 Bacteria 764
348 Ga0395900_0012540 3300037418 Bacteria 8671
349 Ga0395900_0041489 3300037418 Bacteria 4744
350 Ga0395898_0050370 3300037466 Bacteria 4076
351 Ga0395898_0130361 3300037466 Bacteria 2409
352 Ga0395898_0424249 3300037466 Bacteria 1267
353 Ga0395898_0568404 3300037466 Bacteria 1076
354 Ga0436364_0208031 3300037853 Bacteria 1213
355 Ga0436364_0607465 3300037853 Bacteria 39411
356 Ga0436364_0972465 3300037853 Bacteria 5964
357 Ga0436364_0992577 3300037853 Bacteria 61189
358 Ga0436364_1529531 3300037853 Bacteria 1939
359 Ga0395901_0255746 3300038443 Bacteria 1824
360 Ga0395901_0270011 3300038443 Bacteria 1769
361 Ga0395901_0436821 3300038443 Bacteria 1340
362 Ga0395901_0584254 3300038443 Bacteria 1128
363 Ga0400486_25950 3300038742 Bacteria 4507
364 Ga0400487_45699 3300039110 Bacteria 2123
365 Ga0436365_0197362 3300039437 Bacteria 7050
366 Ga0436365_0709051 3300039437 Bacteria 32416
367 Ga0436365_0712452 3300039437 Bacteria 2949
368 Ga0436365_1592530 3300039437 Bacteria 1101
369 Ga0436365_1744068 3300039437 Bacteria 686
370 Ga0436365_1792009 3300039437 Bacteria 1613
371 Ga0436360_0608677 3300039438 Bacteria 742
372 Ga0436360_1045365 3300039438 Bacteria 745
373 Ga0436360_1199485 3300039438 Bacteria 1466
374 Ga0436361_0238240 3300039447 Bacteria 2158
375 Ga0436361_0524149 3300039447 Bacteria 3429
376 Ga0436361_0638706 3300039447 Bacteria 2394
377 Ga0436363_0556338 3300039450 Bacteria 932
378 Ga0436363_0834227 3300039450 Bacteria 701
379 Ga0436362_0170569 3300039453 Bacteria 1311
380 Ga0439438_002468 3300041405 Bacteria 7866
381 Ga0439447_002751 3300041407 Bacteria 6356
382 Ga0439466_0012459 3300041411 Bacteria 3131
383 Ga0451798_0255457 3300041458 Bacteria 811
384 Ga0451807_2272789 3300041486 Bacteria 1591
385 Ga0439452_003688 3300042010 Bacteria 5300
386 Ga0439446_0142206 3300042156 Bacteria 784
387 Ga0451577_0000212 3300042876 Bacteria 122106
388 Ga0451577_0060680 3300042876 Bacteria 3371
389 Ga0451577_0216096 3300042876 Bacteria 1732
390 Ga0453683_0154790 3300044673 Bacteria 1449
391 Ga0466963_0512272 3300044694 Bacteria 847
392 Ga0453684_0274560 3300044712 Bacteria 1925
393 Ga0451576_0050890 3300045051 Bacteria 4344
394 Ga0451576_0340790 3300045051 Bacteria 1569
395 Ga0466967_0043866 3300045976 Bacteria 3875
396 Ga0466967_0136191 3300045976 Bacteria 2284
397 Ga0466967_0238372 3300045976 Bacteria 1734
398 Ga0495627_023956 3300046453 Bacteria 1994
399 Ga0495580_0126543 3300046472 Bacteria 1773
400 Ga0495580_0153360 3300046472 Bacteria 1596
401 Ga0495582_0170241 3300046473 Bacteria 1240
402 Ga0495605_0066281 3300046474 Bacteria 1716
403 Ga0495618_0043537 3300046514 Bacteria 2832
404 Ga0495628_0072972 3300046516 Bacteria 2674
405 Ga0495628_0132824 3300046516 Bacteria 1903
406 Ga0495628_0183720 3300046516 Bacteria 1581
407 Ga0495630_0031777 3300046517 Bacteria 3932
408 Ga0495630_0428336 3300046517 Bacteria 1014
409 Ga0495630_0575695 3300046517 Bacteria 863
410 Ga0495631_0037460 3300046518 Bacteria 2160
411 Ga0495632_0002900 3300046519 Bacteria 12607
412 Ga0495648_0131146 3300046524 Bacteria 1332
413 Ga0495652_0154176 3300046529 Bacteria 1791
414 Ga0495640_0318911 3300046533 Bacteria 963
415 Ga0495587_0146743 3300046536 Bacteria 1345
416 Ga0495667_0459457 3300046559 Bacteria 799
417 Ga0495634_0215100 3300046642 Bacteria 1188
418 Ga0495625_0145458 3300046660 Bacteria 1596
419 Ga0495635_0268043 3300046663 Bacteria 1149
420 Ga0495599_0375446 3300046678 Bacteria 849
421 Ga0495658_0031792 3300046683 Bacteria 2877
422 Ga0495624_0449856 3300046690 Bacteria 772
423 Ga0495649_0003265 3300046694 Bacteria 11048
424 Ga0495581_0277487 3300047315 Bacteria 980
425 Ga0495604_0410684 3300047317 Bacteria 890
426 Ga0495604_0431334 3300047317 Bacteria 864
427 Ga0495680_0280771 3300047322 Bacteria 1174
428 Ga0495687_001187 3300047443 Bacteria 25022
429 Ga0495675_0153738 3300047444 Bacteria 1420
430 Ga0495626_0117695 3300048091 Bacteria 1145
431 Ga0496104_0052190 3300048907 Bacteria 3862
432 Ga0496109_0598560 3300048912 Unclassified 1039
433 Ga0496112_0430021 3300048915 Bacteria 1259
434 Ga0496113_0069705 3300048916 Bacteria 2671
435 Ga0496115_0019339 3300048918 Bacteria 5240
436 Ga0496115_0086389 3300048918 Bacteria 2559
437 Ga0496126_0000406 3300048929 Bacteria 87599
438 Ga0496126_0007049 3300048929 Bacteria 12393
439 Ga0496126_0129350 3300048929 Bacteria 2183
440 Ga0496126_0138488 3300048929 Bacteria 2097
441 Ga0496126_0274726 3300048929 Bacteria 1397
442 Ga0496126_0388045 3300048929 Bacteria 1135
443 Ga0501031_0113567 3300049568 Bacteria 1769
444 Ga0501031_0247837 3300049568 Bacteria 1158
445 Ga0501032_0051088 3300049569 Bacteria 2787
446 Ga0501033_0051426 3300049570 Bacteria 3054
447 Ga0501033_0066735 3300049570 Bacteria 2646
448 Ga0501034_0000374 3300049571 Bacteria 76280
449 Ga0501034_0009431 3300049571 Bacteria 10215
450 Ga0501034_0041569 3300049571 Bacteria 4652
451 Ga0501034_0136934 3300049571 Bacteria 2429
452 Ga0501034_0137215 3300049571 Bacteria 2427
453 Ga0501034_0335616 3300049571 Bacteria 1442
454 Ga0501036_0001435 3300049572 Bacteria 18318
455 Ga0501036_0044095 3300049572 Bacteria 3777
456 Ga0501038_0023734 3300049574 Bacteria 5480
457 Ga0501038_0246512 3300049574 Bacteria 1416
458 Ga0501038_0354477 3300049574 Bacteria 1142
459 Ga0501038_0651623 3300049574 Bacteria 793
460 Ga0501039_0007451 3300049575 Bacteria 8352
461 Ga0501042_0014148 3300049578 Bacteria 5442
462 Ga0501043_0002453 3300049579 Bacteria 15684
463 Ga0501043_0160371 3300049579 Bacteria 1757
464 Ga0501043_0412765 3300049579 Bacteria 1019
465 Ga0501046_0051089 3300049580 Bacteria 3264
466 Ga0501047_0000234 3300049581 Bacteria 65759
467 Ga0501047_0011934 3300049581 Bacteria 8222
468 Ga0501047_0023022 3300049581 Bacteria 5980
469 Ga0501047_0082351 3300049581 Bacteria 3093
470 Ga0501048_0000051 3300049582 Bacteria 57320
471 Ga0501048_0286460 3300049582 Bacteria 1171
472 Ga0501048_0672293 3300049582 Bacteria 744
473 Ga0501068_0089059 3300049584 Bacteria 1902
474 Ga0501069_0034537 3300049585 Bacteria 2785
475 Ga0501070_0001845 3300049586 Bacteria 18698
476 Ga0501070_0068595 3300049586 Bacteria 2935
477 Ga0501070_0142819 3300049586 Bacteria 1976
478 Ga0501072_0198332 3300049588 Bacteria 1600
479 Ga0501073_0018322 3300049589 Bacteria 5059
480 Ga0501073_0030914 3300049589 Bacteria 3823
481 Ga0501073_0484370 3300049589 Bacteria 855
482 Ga0501074_0036705 3300049590 Bacteria 3549
483 Ga0501076_0160063 3300049592 Bacteria 1834
484 Ga0501076_0222847 3300049592 Bacteria 1541
485 Ga0501076_0669307 3300049592 Bacteria 857
486 Ga0501077_0216912 3300049593 Bacteria 1216
487 Ga0501079_0051628 3300049741 Bacteria 3175
488 Ga0501079_0332919 3300049741 Bacteria 1189
489 Ga0501079_0466112 3300049741 Bacteria 992
490 Ga0501080_0000383 3300049742 Bacteria 34102
491 Ga0501080_0032801 3300049742 Bacteria 4844
492 Ga0501083_0356014 3300049744 Bacteria 952
493 Ga0501083_0358200 3300049744 Bacteria 948
494 Ga0501035_0049770 3300049822 Bacteria 3755
495 Ga0501035_0076395 3300049822 Bacteria 2962
496 Ga0501044_0005993 3300049823 Bacteria 13431
497 Ga0501044_0053131 3300049823 Bacteria 4169
498 Ga0501044_0065692 3300049823 Bacteria 3699
499 Ga0501044_0076178 3300049823 Bacteria 3406
500 Ga0501044_0086296 3300049823 Bacteria 3170
501 Ga0501044_0183687 3300049823 Bacteria 2057
502 Ga0501045_0243629 3300049824 Bacteria 1338
503 nmdc:mga00v17_159308_c1 3300050491 Bacteria 1452
504 nmdc:mga0yw44_359981_c1 3300050492 Bacteria 980
505 nmdc:mga0yw44_553354_c1 3300050492 Bacteria 781
506 nmdc:mga0yw44_63689_c1 3300050492 Bacteria 2268
507 nmdc:mga07m45_148644_c1 3300050496 Bacteria 1358
508 nmdc:mga05p37_177785_c1 3300050507 Bacteria 2591
509 nmdc:mga09592_110955_c1 3300050508 Bacteria 2353
510 nmdc:mga06r32_64259_c1 3300050510 Bacteria 3539
511 nmdc:mga08y16_29920_c1 3300050511 Bacteria 5735
512 nmdc:mga08y16_403739_c1 3300050511 Bacteria 1398
513 nmdc:mga08y16_61504_c1 3300050511 Bacteria 3921
514 nmdc:mga08y16_79260_c1 3300050511 Bacteria 3423
515 nmdc:mga08x19_99056_c1 3300050514 Bacteria 1932
516 nmdc:mga0a205_126357_c1 3300050515 Bacteria 2457
517 nmdc:mga0sz30_9199_c1 3300050516 Bacteria 3751
518 Ga0495595_0237165 3300053084 Bacteria 912
519 Ga0500646_0231094 3300053090 Bacteria 645
520 Ga0500651_0107846 3300053093 Bacteria 1702
521 Ga0500651_0119881 3300053093 Bacteria 1598
522 Ga0500568_0010673 3300053139 Bacteria 4291
523 Ga0500603_077755 3300053150 Bacteria 956
524 Ga0500616_0000541 3300053153 Bacteria 47231
525 Ga0501084_0000512 3300054114 Bacteria 29772
526 Ga0501084_0520305 3300054114 Bacteria 1006
527 Ga0530510_0072370 3300061734 Bacteria 2502
528 Ga0530510_0329883 3300061734 Bacteria 1144

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0584254 Ga0395901_0584254_572_1111 169
2 3300049584 Ga0501068_0089059 Ga0501068_0089059_824_1486 172
3 3300050492 nmdc:mga0yw44_63689_c1 nmdc:mga0yw44_63689_c1_13_570 175
4 3300031250 Ga0265331_10031957 Ga0265331_100319573 176
5 3300035117 Ga0373953_0216421 Ga0373953_0216421_257_817 176
6 3300035692 Ga0373935_0502843 Ga0373935_0502843_285_845 176
7 3300046559 Ga0495667_0459457 Ga0495667_0459457_221_781 176
8 3300050508 nmdc:mga09592_110955_c1 nmdc:mga09592_110955_c1_604_1158 176
9 3300050510 nmdc:mga06r32_64259_c1 nmdc:mga06r32_64259_c1_1313_1867 176
10 3300053090 Ga0500646_0231094 Ga0500646_0231094_66_632 177
11 iso_pu_bacteria 2916971899 2916974959 177
12 3300039450 Ga0436363_0834227 Ga0436363_0834227_17_583 178
13 3300027695 Ga0209966_1088460 Ga0209966_10884601 180
14 3300036712 Ga0316584_0727267 Ga0316584_0727267_67_642 180
15 3300041458 Ga0451798_0255457 Ga0451798_0255457_60_620 180
16 3300041486 Ga0451807_2272789 Ga0451807_2272789_549_1118 180
17 3300006051 Ga0075364_10119452 Ga0075364_101194522 181
18 3300006871 Ga0075434_100223443 Ga0075434_1002234432 181
19 3300011119 Ga0105246_10393844 Ga0105246_103938441 181
20 3300035170 Ga0373943_0303924 Ga0373943_0303924_240_812 181
21 3300035171 Ga0373946_0080103 Ga0373946_0080103_658_1230 181
22 3300035172 Ga0373955_0007276 Ga0373955_0007276_3449_4021 181
23 3300036401 Ga0373937_0676124 Ga0373937_0676124_315_887 181
24 3300037418 Ga0395900_0012540 Ga0395900_0012540_7973_8536 181
25 3300037466 Ga0395898_0568404 Ga0395898_0568404_492_1055 181
26 3300044673 Ga0453683_0154790 Ga0453683_0154790_564_1181 181
27 3300046514 Ga0495618_0043537 Ga0495618_0043537_371_943 181
28 3300046516 Ga0495628_0072972 Ga0495628_0072972_972_1544 181
29 3300046517 Ga0495630_0031777 Ga0495630_0031777_879_1451 181
30 3300046642 Ga0495634_0215100 Ga0495634_0215100_206_778 181
31 3300050491 nmdc:mga00v17_159308_c1 nmdc:mga00v17_159308_c1_671_1246 181
32 iso_pu_bacteria 2687453341 2688392344 181
33 3300005548 Ga0070665_100928013 Ga0070665_1009280132 182
34 3300005563 Ga0068855_100033235 Ga0068855_1000332356 182
35 3300026088 Ga0207641_10974885 Ga0207641_109748852 182
36 3300028563 Ga0265319_1005645 Ga0265319_10056454 182
37 3300028573 Ga0265334_10000242 Ga0265334_1000024215 182
38 3300028577 Ga0265318_10000024 Ga0265318_1000002490 182
39 3300028800 Ga0265338_10033908 Ga0265338_100339083 182
40 3300031235 Ga0265330_10002684 Ga0265330_100026847 182
41 3300031238 Ga0265332_10014578 Ga0265332_100145783 182
42 3300031239 Ga0265328_10007268 Ga0265328_100072683 182
43 3300031240 Ga0265320_10008638 Ga0265320_100086383 182
44 3300031241 Ga0265325_10006476 Ga0265325_100064765 182
45 3300031242 Ga0265329_10000807 Ga0265329_1000080714 182
46 3300031247 Ga0265340_10012368 Ga0265340_100123684 182
47 3300031249 Ga0265339_10007816 Ga0265339_100078164 182
48 3300031250 Ga0265331_10005325 Ga0265331_100053254 182
49 3300031595 Ga0265313_10003524 Ga0265313_100035247 182
50 3300031727 Ga0316576_10008993 Ga0316576_100089933 182
51 3300032139 Ga0316580_10095074 Ga0316580_100950742 182
52 3300042876 Ga0451577_0000212 Ga0451577_0000212_21618_22205 182
53 3300005536 Ga0070697_100535664 Ga0070697_1005356641 183
54 3300005544 Ga0070686_100602796 Ga0070686_1006027961 183
55 3300006846 Ga0075430_100283390 Ga0075430_1002833902 183
56 3300006847 Ga0075431_100000858 Ga0075431_10000085816 183
57 3300009094 Ga0111539_10026091 Ga0111539_100260912 183
58 3300026118 Ga0207675_100858476 Ga0207675_1008584762 183
59 3300027907 Ga0207428_10012127 Ga0207428_100121273 183
60 3300035118 Ga0373954_0072697 Ga0373954_0072697_549_1139 183
61 3300035241 Ga0373961_0140530 Ga0373961_0140530_190_780 183
62 3300035242 Ga0373962_0090821 Ga0373962_0090821_134_724 183
63 3300036401 Ga0373937_0146600 Ga0373937_0146600_1155_1745 183
64 3300037068 Ga0373925_0826561 Ga0373925_0826561_38_628 183
65 3300046516 Ga0495628_0132824 Ga0495628_0132824_221_811 183
66 3300046524 Ga0495648_0131146 Ga0495648_0131146_32_637 183
67 3300046678 Ga0495599_0375446 Ga0495599_0375446_73_663 183
68 3300049571 Ga0501034_0137215 Ga0501034_0137215_679_1269 183
69 3300049582 Ga0501048_0672293 Ga0501048_0672293_149_730 183
70 3300050496 nmdc:mga07m45_148644_c1 nmdc:mga07m45_148644_c1_746_1327 183
71 3300050511 nmdc:mga08y16_29920_c1 nmdc:mga08y16_29920_c1_583_1173 183
72 3300013104 Ga0157370_10003211 Ga0157370_1000321119 184
73 3300035691 Ga0373931_0264685 Ga0373931_0264685_260_937 184
74 3300039438 Ga0436360_0608677 Ga0436360_0608677_27_611 184
75 iso_pu_bacteria 2837678835 2837678914 184
76 iso_pu_bacteria 8054563764 8054568732 184
77 3300005618 Ga0068864_100673073 Ga0068864_1006730732 185
78 3300026095 Ga0207676_10571858 Ga0207676_105718582 185
79 3300046453 Ga0495627_023956 Ga0495627_023956_1061_1648 185
80 3300006852 Ga0075433_10220634 Ga0075433_102206342 186
81 3300013307 Ga0157372_11544630 Ga0157372_115446301 186
82 3300050515 nmdc:mga0a205_126357_c1 nmdc:mga0a205_126357_c1_718_1398 186
83 3300035691 Ga0373931_0085098 Ga0373931_0085098_569_1171 187
84 3300005335 Ga0070666_10000210 Ga0070666_1000021025 188
85 3300005336 Ga0070680_100022779 Ga0070680_1000227792 188
86 3300005336 Ga0070680_100469778 Ga0070680_1004697782 188
87 3300005339 Ga0070660_100024950 Ga0070660_1000249503 188
88 3300005344 Ga0070661_100000582 Ga0070661_10000058210 188
89 3300005366 Ga0070659_100061751 Ga0070659_1000617514 188
90 3300005435 Ga0070714_100320356 Ga0070714_1003203562 188
91 3300005435 Ga0070714_100912710 Ga0070714_1009127101 188
92 3300005436 Ga0070713_100071312 Ga0070713_1000713122 188
93 3300005436 Ga0070713_100317582 Ga0070713_1003175822 188
94 3300005441 Ga0070700_100272864 Ga0070700_1002728642 188
95 3300005458 Ga0070681_10079213 Ga0070681_100792133 188
96 3300005458 Ga0070681_10090211 Ga0070681_100902112 188
97 3300005458 Ga0070681_10576859 Ga0070681_105768591 188
98 3300005530 Ga0070679_100003831 Ga0070679_10000383115 188
99 3300005530 Ga0070679_100302376 Ga0070679_1003023762 188
100 3300005539 Ga0068853_100387549 Ga0068853_1003875492 188
101 3300005547 Ga0070693_100458791 Ga0070693_1004587911 188
102 3300005548 Ga0070665_100369592 Ga0070665_1003695921 188
103 3300005563 Ga0068855_100123435 Ga0068855_1001234352 188
104 3300005563 Ga0068855_100169302 Ga0068855_1001693022 188
105 3300005577 Ga0068857_100091306 Ga0068857_1000913061 188
106 3300005614 Ga0068856_100000522 Ga0068856_10000052220 188
107 3300005614 Ga0068856_100130094 Ga0068856_1001300942 188
108 3300005614 Ga0068856_100393265 Ga0068856_1003932652 188
109 3300005616 Ga0068852_100069237 Ga0068852_1000692372 188
110 3300005616 Ga0068852_100466117 Ga0068852_1004661172 188
111 3300006173 Ga0070716_100302118 Ga0070716_1003021182 188
112 3300006175 Ga0070712_100316092 Ga0070712_1003160922 188
113 3300006847 Ga0075431_100008974 Ga0075431_1000089742 188
114 3300006881 Ga0068865_100482960 Ga0068865_1004829602 188
115 3300007788 Ga0099795_10016354 Ga0099795_100163542 188
116 3300009093 Ga0105240_10159953 Ga0105240_101599533 188
117 3300009093 Ga0105240_10309285 Ga0105240_103092852 188
118 3300009093 Ga0105240_10764847 Ga0105240_107648472 188
119 3300009177 Ga0105248_11725806 Ga0105248_117258061 188
120 3300009545 Ga0105237_10201296 Ga0105237_102012961 188
121 3300009545 Ga0105237_10274715 Ga0105237_102747152 188
122 3300009545 Ga0105237_10388505 Ga0105237_103885052 188
123 3300009551 Ga0105238_10848401 Ga0105238_108484011 188
124 3300009553 Ga0105249_10229596 Ga0105249_102295962 188
125 3300013100 Ga0157373_10306940 Ga0157373_103069402 188
126 3300013102 Ga0157371_10435177 Ga0157371_104351772 188
127 3300013104 Ga0157370_10026609 Ga0157370_100266092 188
128 3300013104 Ga0157370_10203548 Ga0157370_102035482 188
129 3300013104 Ga0157370_10209146 Ga0157370_102091462 188
130 3300013104 Ga0157370_10612062 Ga0157370_106120621 188
131 3300013105 Ga0157369_10014337 Ga0157369_100143372 188
132 3300013105 Ga0157369_10018323 Ga0157369_100183232 188
133 3300013105 Ga0157369_10061648 Ga0157369_100616482 188
134 3300013105 Ga0157369_10412526 Ga0157369_104125262 188
135 3300013105 Ga0157369_10919463 Ga0157369_109194632 188
136 3300013296 Ga0157374_10132066 Ga0157374_101320662 188
137 3300013306 Ga0163162_10153579 Ga0163162_101535792 188
138 3300013307 Ga0157372_10060527 Ga0157372_100605272 188
139 3300013307 Ga0157372_10080366 Ga0157372_100803664 188
140 3300013307 Ga0157372_10179804 Ga0157372_101798044 188
141 3300014326 Ga0157380_10045818 Ga0157380_100458185 188
142 3300014497 Ga0182008_10091792 Ga0182008_100917922 188
143 3300014968 Ga0157379_10011036 Ga0157379_100110366 188
144 3300017792 Ga0163161_10257803 Ga0163161_102578031 188
145 3300020076 Ga0206355_1529234 Ga0206355_15292342 188
146 3300021384 Ga0213876_10160791 Ga0213876_101607912 188
147 3300022467 Ga0224712_10089146 Ga0224712_100891462 188
148 3300025903 Ga0207680_10000318 Ga0207680_1000031823 188
149 3300025904 Ga0207647_10076848 Ga0207647_100768482 188
150 3300025906 Ga0207699_10041749 Ga0207699_100417492 188
151 3300025912 Ga0207707_10014668 Ga0207707_100146684 188
152 3300025912 Ga0207707_10077292 Ga0207707_100772922 188
153 3300025912 Ga0207707_10081496 Ga0207707_100814964 188
154 3300025912 Ga0207707_10241547 Ga0207707_102415472 188
155 3300025913 Ga0207695_10077314 Ga0207695_100773145 188
156 3300025913 Ga0207695_10166990 Ga0207695_101669902 188
157 3300025913 Ga0207695_10370602 Ga0207695_103706021 188
158 3300025914 Ga0207671_10270766 Ga0207671_102707662 188
159 3300025914 Ga0207671_10372587 Ga0207671_103725871 188
160 3300025915 Ga0207693_10012149 Ga0207693_100121494 188
161 3300025915 Ga0207693_10046205 Ga0207693_100462052 188
162 3300025917 Ga0207660_10260073 Ga0207660_102600732 188
163 3300025919 Ga0207657_10095173 Ga0207657_100951733 188
164 3300025920 Ga0207649_10000036 Ga0207649_1000003632 188
165 3300025921 Ga0207652_10048090 Ga0207652_100480902 188
166 3300025921 Ga0207652_10509323 Ga0207652_105093232 188
167 3300025924 Ga0207694_10023854 Ga0207694_100238543 188
168 3300025924 Ga0207694_10467016 Ga0207694_104670161 188
169 3300025928 Ga0207700_10012180 Ga0207700_100121803 188
170 3300025928 Ga0207700_10022784 Ga0207700_100227842 188
171 3300025928 Ga0207700_10091490 Ga0207700_100914903 188
172 3300025929 Ga0207664_10381599 Ga0207664_103815992 188
173 3300025941 Ga0207711_10253299 Ga0207711_102532992 188
174 3300025944 Ga0207661_10133363 Ga0207661_101333632 188
175 3300025944 Ga0207661_10393330 Ga0207661_103933303 188
176 3300025949 Ga0207667_10089982 Ga0207667_100899822 188
177 3300025949 Ga0207667_10507699 Ga0207667_105076992 188
178 3300025949 Ga0207667_10587014 Ga0207667_105870142 188
179 3300025981 Ga0207640_10091261 Ga0207640_100912612 188
180 3300026041 Ga0207639_10522071 Ga0207639_105220712 188
181 3300026067 Ga0207678_10309592 Ga0207678_103095921 188
182 3300026078 Ga0207702_10000014 Ga0207702_10000014218 188
183 3300026116 Ga0207674_10030475 Ga0207674_100304754 188
184 3300026116 Ga0207674_10324747 Ga0207674_103247472 188
185 3300026116 Ga0207674_11288899 Ga0207674_112888991 188
186 3300026142 Ga0207698_10052846 Ga0207698_100528465 188
187 3300026142 Ga0207698_10096453 Ga0207698_100964532 188
188 3300028379 Ga0268266_10099352 Ga0268266_100993522 188
189 3300028379 Ga0268266_10273283 Ga0268266_102732833 188
190 3300028563 Ga0265319_1070464 Ga0265319_10704641 188
191 3300028800 Ga0265338_10082115 Ga0265338_100821153 188
192 3300030760 Ga0265762_1037011 Ga0265762_10370112 188
193 3300031090 Ga0265760_10072497 Ga0265760_100724972 188
194 3300031238 Ga0265332_10041515 Ga0265332_100415152 188
195 3300031240 Ga0265320_10022856 Ga0265320_100228563 188
196 3300031247 Ga0265340_10004949 Ga0265340_100049499 188
197 3300031249 Ga0265339_10019827 Ga0265339_100198273 188
198 3300031249 Ga0265339_10059572 Ga0265339_100595722 188
199 3300031711 Ga0265314_10028433 Ga0265314_100284332 188
200 3300031711 Ga0265314_10030196 Ga0265314_100301962 188
201 3300031712 Ga0265342_10010141 Ga0265342_100101413 188
202 3300031712 Ga0265342_10012608 Ga0265342_100126086 188
203 3300031815 Ga0316045_117561 Ga0316045_1175611 188
204 3300033547 Ga0316212_1021453 Ga0316212_10214532 188
205 3300035086 Ga0373934_0057809 Ga0373934_0057809_303_908 188
206 3300035111 Ga0373923_0047470 Ga0373923_0047470_1057_1662 188
207 3300035116 Ga0373945_0309426 Ga0373945_0309426_56_661 188
208 3300035118 Ga0373954_0072677 Ga0373954_0072677_718_1323 188
209 3300035170 Ga0373943_0177257 Ga0373943_0177257_281_886 188
210 3300035172 Ga0373955_0306411 Ga0373955_0306411_113_718 188
211 3300035724 Ga0373933_0023643 Ga0373933_0023643_2534_3139 188
212 3300035724 Ga0373933_0093860 Ga0373933_0093860_465_1070 188
213 3300035724 Ga0373933_0157650 Ga0373933_0157650_243_848 188
214 3300036401 Ga0373937_0008874 Ga0373937_0008874_7629_8234 188
215 3300036401 Ga0373937_0012551 Ga0373937_0012551_364_969 188
216 3300036401 Ga0373937_0066253 Ga0373937_0066253_1972_2577 188
217 3300037068 Ga0373925_0169343 Ga0373925_0169343_1089_1694 188
218 3300037068 Ga0373925_0531226 Ga0373925_0531226_153_758 188
219 3300037418 Ga0395900_0041489 Ga0395900_0041489_1700_2305 188
220 3300037466 Ga0395898_0050370 Ga0395898_0050370_1764_2369 188
221 3300037466 Ga0395898_0130361 Ga0395898_0130361_1543_2157 188
222 3300037466 Ga0395898_0424249 Ga0395898_0424249_275_880 188
223 3300038443 Ga0395901_0270011 Ga0395901_0270011_938_1552 188
224 3300038443 Ga0395901_0436821 Ga0395901_0436821_180_785 188
225 3300038742 Ga0400486_25950 Ga0400486_25950_3451_4056 188
226 3300039110 Ga0400487_45699 Ga0400487_45699_34_639 188
227 3300039437 Ga0436365_0712452 Ga0436365_0712452_2175_2780 188
228 3300039447 Ga0436361_0638706 Ga0436361_0638706_410_1015 188
229 3300039450 Ga0436363_0556338 Ga0436363_0556338_108_713 188
230 3300039453 Ga0436362_0170569 Ga0436362_0170569_548_1153 188
231 3300045051 Ga0451576_0050890 Ga0451576_0050890_1165_1770 188
232 3300045051 Ga0451576_0340790 Ga0451576_0340790_727_1332 188
233 3300045976 Ga0466967_0043866 Ga0466967_0043866_630_1235 188
234 3300045976 Ga0466967_0238372 Ga0466967_0238372_697_1302 188
235 3300046473 Ga0495582_0170241 Ga0495582_0170241_165_770 188
236 3300046516 Ga0495628_0183720 Ga0495628_0183720_766_1371 188
237 3300046517 Ga0495630_0428336 Ga0495630_0428336_370_975 188
238 3300046517 Ga0495630_0575695 Ga0495630_0575695_48_653 188
239 3300046529 Ga0495652_0154176 Ga0495652_0154176_426_1031 188
240 3300046533 Ga0495640_0318911 Ga0495640_0318911_262_867 188
241 3300046536 Ga0495587_0146743 Ga0495587_0146743_634_1239 188
242 3300046663 Ga0495635_0268043 Ga0495635_0268043_531_1136 188
243 3300046690 Ga0495624_0449856 Ga0495624_0449856_41_652 188
244 3300047315 Ga0495581_0277487 Ga0495581_0277487_236_841 188
245 3300047317 Ga0495604_0410684 Ga0495604_0410684_236_847 188
246 3300047317 Ga0495604_0431334 Ga0495604_0431334_70_675 188
247 3300047322 Ga0495680_0280771 Ga0495680_0280771_432_1037 188
248 3300047444 Ga0495675_0153738 Ga0495675_0153738_283_888 188
249 3300048918 Ga0496115_0019339 Ga0496115_0019339_2231_2836 188
250 3300048918 Ga0496115_0086389 Ga0496115_0086389_449_1054 188
251 3300048929 Ga0496126_0000406 Ga0496126_0000406_46338_46943 188
252 3300048929 Ga0496126_0007049 Ga0496126_0007049_149_754 188
253 3300048929 Ga0496126_0129350 Ga0496126_0129350_571_1176 188
254 3300048929 Ga0496126_0138488 Ga0496126_0138488_678_1283 188
255 3300048929 Ga0496126_0274726 Ga0496126_0274726_21_626 188
256 3300048929 Ga0496126_0388045 Ga0496126_0388045_314_919 188
257 3300049568 Ga0501031_0113567 Ga0501031_0113567_1087_1692 188
258 3300049568 Ga0501031_0247837 Ga0501031_0247837_38_643 188
259 3300049569 Ga0501032_0051088 Ga0501032_0051088_574_1179 188
260 3300049570 Ga0501033_0051426 Ga0501033_0051426_2188_2793 188
261 3300049570 Ga0501033_0066735 Ga0501033_0066735_1907_2512 188
262 3300049571 Ga0501034_0000374 Ga0501034_0000374_68739_69344 188
263 3300049571 Ga0501034_0009431 Ga0501034_0009431_2285_2890 188
264 3300049571 Ga0501034_0041569 Ga0501034_0041569_1756_2361 188
265 3300049571 Ga0501034_0136934 Ga0501034_0136934_289_894 188
266 3300049571 Ga0501034_0335616 Ga0501034_0335616_815_1420 188
267 3300049572 Ga0501036_0001435 Ga0501036_0001435_14595_15200 188
268 3300049572 Ga0501036_0044095 Ga0501036_0044095_1978_2583 188
269 3300049574 Ga0501038_0023734 Ga0501038_0023734_1105_1710 188
270 3300049574 Ga0501038_0246512 Ga0501038_0246512_550_1155 188
271 3300049574 Ga0501038_0354477 Ga0501038_0354477_497_1102 188
272 3300049575 Ga0501039_0007451 Ga0501039_0007451_3117_3722 188
273 3300049579 Ga0501043_0002453 Ga0501043_0002453_6164_6769 188
274 3300049579 Ga0501043_0160371 Ga0501043_0160371_1093_1698 188
275 3300049579 Ga0501043_0412765 Ga0501043_0412765_219_824 188
276 3300049580 Ga0501046_0051089 Ga0501046_0051089_775_1380 188
277 3300049581 Ga0501047_0000234 Ga0501047_0000234_746_1351 188
278 3300049581 Ga0501047_0011934 Ga0501047_0011934_4983_5588 188
279 3300049581 Ga0501047_0023022 Ga0501047_0023022_1727_2332 188
280 3300049581 Ga0501047_0082351 Ga0501047_0082351_2206_2811 188
281 3300049582 Ga0501048_0000051 Ga0501048_0000051_50255_50860 188
282 3300049585 Ga0501069_0034537 Ga0501069_0034537_813_1418 188
283 3300049586 Ga0501070_0001845 Ga0501070_0001845_3261_3866 188
284 3300049586 Ga0501070_0068595 Ga0501070_0068595_1975_2580 188
285 3300049586 Ga0501070_0142819 Ga0501070_0142819_748_1353 188
286 3300049588 Ga0501072_0198332 Ga0501072_0198332_597_1202 188
287 3300049589 Ga0501073_0018322 Ga0501073_0018322_3880_4485 188
288 3300049589 Ga0501073_0030914 Ga0501073_0030914_348_953 188
289 3300049589 Ga0501073_0484370 Ga0501073_0484370_205_810 188
290 3300049590 Ga0501074_0036705 Ga0501074_0036705_2511_3116 188
291 3300049592 Ga0501076_0222847 Ga0501076_0222847_913_1518 188
292 3300049592 Ga0501076_0669307 Ga0501076_0669307_135_740 188
293 3300049593 Ga0501077_0216912 Ga0501077_0216912_225_830 188
294 3300049741 Ga0501079_0051628 Ga0501079_0051628_1053_1658 188
295 3300049741 Ga0501079_0332919 Ga0501079_0332919_200_805 188
296 3300049741 Ga0501079_0466112 Ga0501079_0466112_167_772 188
297 3300049742 Ga0501080_0000383 Ga0501080_0000383_14225_14830 188
298 3300049742 Ga0501080_0032801 Ga0501080_0032801_1910_2515 188
299 3300049744 Ga0501083_0356014 Ga0501083_0356014_73_678 188
300 3300049744 Ga0501083_0358200 Ga0501083_0358200_253_858 188
301 3300049822 Ga0501035_0049770 Ga0501035_0049770_1494_2099 188
302 3300049823 Ga0501044_0005993 Ga0501044_0005993_5656_6261 188
303 3300049823 Ga0501044_0053131 Ga0501044_0053131_3227_3832 188
304 3300049823 Ga0501044_0065692 Ga0501044_0065692_1120_1725 188
305 3300049823 Ga0501044_0076178 Ga0501044_0076178_2187_2792 188
306 3300049823 Ga0501044_0086296 Ga0501044_0086296_276_881 188
307 3300053084 Ga0495595_0237165 Ga0495595_0237165_72_677 188
308 3300053150 Ga0500603_077755 Ga0500603_077755_308_913 188
309 3300054114 Ga0501084_0000512 Ga0501084_0000512_12685_13272 188
310 3300061734 Ga0530510_0072370 Ga0530510_0072370_1862_2467 188
311 3300061734 Ga0530510_0329883 Ga0530510_0329883_499_1104 188
312 3300009147 Ga0114129_10505255 Ga0114129_105052552 189
313 3300042156 Ga0439446_0142206 Ga0439446_0142206_131_739 189
314 3300050507 nmdc:mga05p37_177785_c1 nmdc:mga05p37_177785_c1_636_1241 189
315 iso_pu_bacteria 8056172158 8056173520 189
316 3300005331 Ga0070670_100256582 Ga0070670_1002565821 190
317 3300005340 Ga0070689_100027470 Ga0070689_1000274702 190
318 3300005353 Ga0070669_100194816 Ga0070669_1001948161 190
319 3300005364 Ga0070673_100062317 Ga0070673_1000623173 190
320 3300005546 Ga0070696_101079598 Ga0070696_1010795981 190
321 3300005617 Ga0068859_100233362 Ga0068859_1002333622 190
322 3300006237 Ga0097621_100316007 Ga0097621_1003160072 190
323 3300006931 Ga0097620_100233351 Ga0097620_1002333512 190
324 3300009093 Ga0105240_10123291 Ga0105240_101232913 190
325 3300009147 Ga0114129_10065525 Ga0114129_100655254 190
326 3300009148 Ga0105243_10126213 Ga0105243_101262132 190
327 3300014968 Ga0157379_10266928 Ga0157379_102669282 190
328 3300025901 Ga0207688_10015305 Ga0207688_100153055 190
329 3300025913 Ga0207695_10221076 Ga0207695_102210762 190
330 3300025935 Ga0207709_10361063 Ga0207709_103610632 190
331 3300025937 Ga0207669_10011067 Ga0207669_100110672 190
332 3300026035 Ga0207703_10040606 Ga0207703_100406062 190
333 3300026088 Ga0207641_10063753 Ga0207641_100637532 190
334 3300026118 Ga0207675_100024271 Ga0207675_1000242712 190
335 3300031239 Ga0265328_10036071 Ga0265328_100360712 190
336 3300031240 Ga0265320_10086039 Ga0265320_100860392 190
337 3300031242 Ga0265329_10033083 Ga0265329_100330832 190
338 3300031250 Ga0265331_10005675 Ga0265331_100056751 190
339 3300031711 Ga0265314_10002039 Ga0265314_1000203923 190
340 3300032126 Ga0307415_100368680 Ga0307415_1003686801 190
341 3300033180 Ga0307510_10267875 Ga0307510_102678752 190
342 3300035692 Ga0373935_0037739 Ga0373935_0037739_496_1143 190
343 3300035695 Ga0373927_0488090 Ga0373927_0488090_139_786 190
344 3300037853 Ga0436364_0972465 Ga0436364_0972465_4529_5140 190
345 3300049822 Ga0501035_0076395 Ga0501035_0076395_226_846 190
346 3300005331 Ga0070670_100051744 Ga0070670_1000517442 191
347 3300005339 Ga0070660_100732446 Ga0070660_1007324462 191
348 3300005353 Ga0070669_100623269 Ga0070669_1006232691 191
349 3300005354 Ga0070675_100100537 Ga0070675_1001005371 191
350 3300005563 Ga0068855_100887579 Ga0068855_1008875791 191
351 3300005564 Ga0070664_100290462 Ga0070664_1002904621 191
352 3300005617 Ga0068859_100321747 Ga0068859_1003217472 191
353 3300005844 Ga0068862_100454045 Ga0068862_1004540452 191
354 3300006931 Ga0097620_100321738 Ga0097620_1003217382 191
355 3300025923 Ga0207681_10048651 Ga0207681_100486513 191
356 3300025945 Ga0207679_10092082 Ga0207679_100920822 191
357 3300028380 Ga0268265_10402822 Ga0268265_104028222 191
358 3300038443 Ga0395901_0255746 Ga0395901_0255746_938_1630 191
359 3300039437 Ga0436365_0197362 Ga0436365_0197362_3064_3708 191
360 3300039447 Ga0436361_0524149 Ga0436361_0524149_1907_2521 191
361 3300049578 Ga0501042_0014148 Ga0501042_0014148_1840_2454 191
362 3300049582 Ga0501048_0286460 Ga0501048_0286460_32_646 191
363 3300049592 Ga0501076_0160063 Ga0501076_0160063_1075_1689 191
364 3300049823 Ga0501044_0183687 Ga0501044_0183687_1067_1759 191
365 3300049824 Ga0501045_0243629 Ga0501045_0243629_610_1224 191
366 3300005563 Ga0068855_100287912 Ga0068855_1002879122 192
367 3300009093 Ga0105240_10233952 Ga0105240_102339522 192
368 3300014968 Ga0157379_10076995 Ga0157379_100769953 192
369 3300025290 Ga0207673_1000811 Ga0207673_10008112 192
370 3300025913 Ga0207695_10502989 Ga0207695_105029892 192
371 3300025949 Ga0207667_10327015 Ga0207667_103270153 192
372 3300041405 Ga0439438_002468 Ga0439438_002468_6592_7236 193
373 3300041407 Ga0439447_002751 Ga0439447_002751_1299_1943 193
374 3300041411 Ga0439466_0012459 Ga0439466_0012459_1954_2598 193
375 3300042010 Ga0439452_003688 Ga0439452_003688_479_1123 193
376 3300046518 Ga0495631_0037460 Ga0495631_0037460_271_915 193
377 3300053153 Ga0500616_0000541 Ga0500616_0000541_29591_30211 193
378 3300005330 Ga0070690_100164253 Ga0070690_1001642532 194
379 3300005333 Ga0070677_10015247 Ga0070677_100152473 194
380 3300005333 Ga0070677_10101605 Ga0070677_101016052 194
381 3300005334 Ga0068869_100371679 Ga0068869_1003716792 194
382 3300005335 Ga0070666_10018215 Ga0070666_100182154 194
383 3300005354 Ga0070675_100084339 Ga0070675_1000843392 194
384 3300005355 Ga0070671_100223733 Ga0070671_1002237332 194
385 3300005364 Ga0070673_100037625 Ga0070673_1000376252 194
386 3300005441 Ga0070700_100040182 Ga0070700_1000401821 194
387 3300005456 Ga0070678_100160356 Ga0070678_1001603562 194
388 3300005457 Ga0070662_100442635 Ga0070662_1004426352 194
389 3300005459 Ga0068867_100191189 Ga0068867_1001911892 194
390 3300005543 Ga0070672_100029815 Ga0070672_1000298154 194
391 3300005543 Ga0070672_100178316 Ga0070672_1001783162 194
392 3300005544 Ga0070686_100184851 Ga0070686_1001848512 194
393 3300005548 Ga0070665_100147560 Ga0070665_1001475602 194
394 3300005577 Ga0068857_100448668 Ga0068857_1004486682 194
395 3300005616 Ga0068852_101111772 Ga0068852_1011117721 194
396 3300005618 Ga0068864_100154841 Ga0068864_1001548412 194
397 3300005719 Ga0068861_100834066 Ga0068861_1008340662 194
398 3300005842 Ga0068858_100311324 Ga0068858_1003113242 194
399 3300005937 Ga0081455_10020970 Ga0081455_100209705 194
400 3300005937 Ga0081455_10577011 Ga0081455_105770112 194
401 3300005985 Ga0081539_10001781 Ga0081539_1000178111 194
402 3300005985 Ga0081539_10230982 Ga0081539_102309821 194
403 3300006038 Ga0075365_10411625 Ga0075365_104116252 194
404 3300006177 Ga0075362_10142092 Ga0075362_101420922 194
405 3300006237 Ga0097621_100077322 Ga0097621_1000773222 194
406 3300006358 Ga0068871_100190287 Ga0068871_1001902872 194
407 3300006844 Ga0075428_100624626 Ga0075428_1006246262 194
408 3300006914 Ga0075436_100618192 Ga0075436_1006181921 194
409 3300009098 Ga0105245_10561765 Ga0105245_105617651 194
410 3300009177 Ga0105248_10272001 Ga0105248_102720012 194
411 3300013296 Ga0157374_10248049 Ga0157374_102480492 194
412 3300013308 Ga0157375_10029144 Ga0157375_100291442 194
413 3300013308 Ga0157375_10039658 Ga0157375_100396582 194
414 3300014325 Ga0163163_10313989 Ga0163163_103139892 194
415 3300014497 Ga0182008_10000171 Ga0182008_1000017134 194
416 3300025893 Ga0207682_10015551 Ga0207682_100155514 194
417 3300025901 Ga0207688_10531688 Ga0207688_105316881 194
418 3300025907 Ga0207645_10278454 Ga0207645_102784542 194
419 3300025918 Ga0207662_10062967 Ga0207662_100629672 194
420 3300025923 Ga0207681_10378476 Ga0207681_103784762 194
421 3300025925 Ga0207650_10021483 Ga0207650_100214834 194
422 3300025925 Ga0207650_10195200 Ga0207650_101952002 194
423 3300025926 Ga0207659_10048971 Ga0207659_100489712 194
424 3300025940 Ga0207691_10135303 Ga0207691_101353033 194
425 3300025940 Ga0207691_10147738 Ga0207691_101477383 194
426 3300025942 Ga0207689_10062348 Ga0207689_100623482 194
427 3300026075 Ga0207708_10046860 Ga0207708_100468602 194
428 3300026088 Ga0207641_10118280 Ga0207641_101182802 194
429 3300026089 Ga0207648_10040461 Ga0207648_100404612 194
430 3300026095 Ga0207676_10012081 Ga0207676_100120813 194
431 3300026095 Ga0207676_10769914 Ga0207676_107699141 194
432 3300026121 Ga0207683_10501860 Ga0207683_105018602 194
433 3300028380 Ga0268265_10043021 Ga0268265_100430211 194
434 3300028380 Ga0268265_11339332 Ga0268265_113393321 194
435 3300028786 Ga0307517_10108323 Ga0307517_101083232 194
436 3300028794 Ga0307515_10050694 Ga0307515_100506942 194
437 3300031456 Ga0307513_10013624 Ga0307513_100136248 194
438 3300031507 Ga0307509_10071030 Ga0307509_100710303 194
439 3300031616 Ga0307508_10000358 Ga0307508_1000035829 194
440 3300033180 Ga0307510_10202843 Ga0307510_102028432 194
441 3300037853 Ga0436364_0208031 Ga0436364_0208031_483_1106 194
442 3300046472 Ga0495580_0126543 Ga0495580_0126543_690_1367 194
443 3300046474 Ga0495605_0066281 Ga0495605_0066281_846_1469 194
444 3300046519 Ga0495632_0002900 Ga0495632_0002900_5992_6615 194
445 3300046660 Ga0495625_0145458 Ga0495625_0145458_82_705 194
446 3300046683 Ga0495658_0031792 Ga0495658_0031792_1849_2472 194
447 3300046694 Ga0495649_0003265 Ga0495649_0003265_6008_6631 194
448 3300047443 Ga0495687_001187 Ga0495687_001187_6996_7619 194
449 3300048091 Ga0495626_0117695 Ga0495626_0117695_159_782 194
450 3300048912 Ga0496109_0598560 Ga0496109_0598560_120_743 194
451 3300049574 Ga0501038_0651623 Ga0501038_0651623_101_724 194
452 3300050492 nmdc:mga0yw44_359981_c1 nmdc:mga0yw44_359981_c1_132_755 194
453 3300050492 nmdc:mga0yw44_553354_c1 nmdc:mga0yw44_553354_c1_55_678 194
454 3300050511 nmdc:mga08y16_61504_c1 nmdc:mga08y16_61504_c1_1190_1813 194
455 3300053093 Ga0500651_0119881 Ga0500651_0119881_221_850 194
456 3300054114 Ga0501084_0520305 Ga0501084_0520305_318_941 194
457 iso_pu_bacteria 2524023250 2524610018 194
458 3300005338 Ga0068868_100263827 Ga0068868_1002638272 195
459 3300005719 Ga0068861_100189384 Ga0068861_1001893841 195
460 3300005985 Ga0081539_10004863 Ga0081539_1000486312 195
461 3300006186 Ga0075369_10003345 Ga0075369_100033454 195
462 3300006358 Ga0068871_100296292 Ga0068871_1002962922 195
463 3300009176 Ga0105242_10065378 Ga0105242_100653781 195
464 3300009545 Ga0105237_10000304 Ga0105237_1000030454 195
465 3300025315 Ga0207697_10083223 Ga0207697_100832231 195
466 3300025914 Ga0207671_10001956 Ga0207671_1000195614 195
467 3300026023 Ga0207677_10133911 Ga0207677_101339112 195
468 3300030522 Ga0307512_10031923 Ga0307512_100319233 195
469 3300042876 Ga0451577_0060680 Ga0451577_0060680_615_1265 195
470 3300042876 Ga0451577_0216096 Ga0451577_0216096_1004_1654 195
471 3300044712 Ga0453684_0274560 Ga0453684_0274560_1112_1762 195
472 3300050511 nmdc:mga08y16_79260_c1 nmdc:mga08y16_79260_c1_2532_3161 195
473 3300050516 nmdc:mga0sz30_9199_c1 nmdc:mga0sz30_9199_c1_1841_2467 195
474 3300053093 Ga0500651_0107846 Ga0500651_0107846_393_1019 195
475 3300005355 Ga0070671_100327818 Ga0070671_1003278182 196
476 3300005434 Ga0070709_10083677 Ga0070709_100836772 196
477 3300005435 Ga0070714_100051314 Ga0070714_1000513143 196
478 3300005435 Ga0070714_100602747 Ga0070714_1006027471 196
479 3300005436 Ga0070713_100039903 Ga0070713_1000399033 196
480 3300005437 Ga0070710_10398714 Ga0070710_103987142 196
481 3300005439 Ga0070711_100111609 Ga0070711_1001116091 196
482 3300005458 Ga0070681_10128651 Ga0070681_101286512 196
483 3300005458 Ga0070681_10208936 Ga0070681_102089362 196
484 3300005564 Ga0070664_100208071 Ga0070664_1002080711 196
485 3300005614 Ga0068856_100193534 Ga0068856_1001935342 196
486 3300005844 Ga0068862_100041570 Ga0068862_1000415704 196
487 3300006028 Ga0070717_10809040 Ga0070717_108090402 196
488 3300006177 Ga0075362_10005496 Ga0075362_100054964 196
489 3300006914 Ga0075436_100101722 Ga0075436_1001017222 196
490 3300007788 Ga0099795_10006310 Ga0099795_100063103 196
491 3300007788 Ga0099795_10034401 Ga0099795_100344012 196
492 3300009093 Ga0105240_10523932 Ga0105240_105239322 196
493 3300009545 Ga0105237_11404928 Ga0105237_114049281 196
494 3300010159 Ga0099796_10026910 Ga0099796_100269102 196
495 3300013104 Ga0157370_10385956 Ga0157370_103859562 196
496 3300013306 Ga0163162_10119742 Ga0163162_101197422 196
497 3300021384 Ga0213876_10060261 Ga0213876_100602612 196
498 3300021388 Ga0213875_10000863 Ga0213875_1000086315 196
499 3300021388 Ga0213875_10005044 Ga0213875_100050442 196
500 3300025898 Ga0207692_10412431 Ga0207692_104124311 196
501 3300025916 Ga0207663_10299579 Ga0207663_102995792 196
502 3300025928 Ga0207700_10087330 Ga0207700_100873302 196
503 3300025928 Ga0207700_10147626 Ga0207700_101476262 196
504 3300025928 Ga0207700_10261100 Ga0207700_102611002 196
505 3300025929 Ga0207664_10128770 Ga0207664_101287702 196
506 3300026078 Ga0207702_10136553 Ga0207702_101365532 196
507 3300028380 Ga0268265_10029583 Ga0268265_100295832 196
508 3300032002 Ga0307416_100438232 Ga0307416_1004382322 196
509 3300035089 Ga0373944_0089018 Ga0373944_0089018_238_870 196
510 3300035116 Ga0373945_0032316 Ga0373945_0032316_959_1591 196
511 3300035170 Ga0373943_0126819 Ga0373943_0126819_84_716 196
512 3300035691 Ga0373931_0063931 Ga0373931_0063931_361_993 196
513 3300035725 Ga0373947_0160997 Ga0373947_0160997_168_800 196
514 3300037853 Ga0436364_0607465 Ga0436364_0607465_29273_29902 196
515 3300037853 Ga0436364_0992577 Ga0436364_0992577_46314_46943 196
516 3300037853 Ga0436364_1529531 Ga0436364_1529531_842_1471 196
517 3300039437 Ga0436365_0709051 Ga0436365_0709051_8744_9373 196
518 3300039437 Ga0436365_1592530 Ga0436365_1592530_139_771 196
519 3300039437 Ga0436365_1744068 Ga0436365_1744068_21_653 196
520 3300039437 Ga0436365_1792009 Ga0436365_1792009_865_1494 196
521 3300039438 Ga0436360_1045365 Ga0436360_1045365_28_660 196
522 3300039438 Ga0436360_1199485 Ga0436360_1199485_281_910 196
523 3300039447 Ga0436361_0238240 Ga0436361_0238240_1104_1733 196
524 3300045976 Ga0466967_0136191 Ga0466967_0136191_316_948 196
525 3300046472 Ga0495580_0153360 Ga0495580_0153360_215_847 196
526 3300048907 Ga0496104_0052190 Ga0496104_0052190_42_674 196
527 3300048915 Ga0496112_0430021 Ga0496112_0430021_187_819 196
528 3300048916 Ga0496113_0069705 Ga0496113_0069705_1793_2425 196
529 3300050511 nmdc:mga08y16_403739_c1 nmdc:mga08y16_403739_c1_323_955 196
530 3300050514 nmdc:mga08x19_99056_c1 nmdc:mga08x19_99056_c1_986_1618 196
531 3300053139 Ga0500568_0010673 Ga0500568_0010673_2423_3070 196
532 3300044694 Ga0466963_0512272 Ga0466963_0512272_98_694 198
533 3300005983 Ga0081540_1009776 Ga0081540_10097769 199
534 3300005329 Ga0070683_100289579 Ga0070683_1002895791 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

22

144

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9729 1 170
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9673 1 170
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9538 4 157
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9477 4 157
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.9278 1 171
ID Description Score Start End Superfamily
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9729 1 170 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9673 1 170 3.20.19.10
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9287 1 173 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9238 1 171 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9104 3 170 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A7K2L3S6-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 0.9892 9 126 GO:0003861
GO:0009098
GO:0009316
AF-A0A7G3D6B9-F1-model_v4 deleted 0.9847 1 146
AF-X7Z4V8-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 0.9817 13 131 GO:0003861
GO:0009098
GO:0009316
AF-A0A1B6AWJ5-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 0.9816 1 146 GO:0003861
GO:0009098
GO:0009316
AF-A0A3C1YAF1-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9799 1 138 GO:0003861
GO:0009098
GO:0009316

Feature Viewer

pLDDT pTM Quality
91.71 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map