F460601
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 534 | 302 | 528 | 203 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2524023250|2524610018 |
| Length | 224 |
| Sequence | TARRHGSKGACFIASRPGPYPMQKFTQLTGVAAPLRLMNVDTDMIIPADYLKTIKRTGLGAGLFASLRYKDGKAIEDFVLNKPAYAKASILIAGDNFGCGSSREHAPWALADYGIRCIIAPSFADIFFNNCFKNGILPIPMPVEVVERLMEAADNGANSTFTVDLETQKITLPDGSTIGFDVEPFRRECLLNGWDDIGLTLRNVDAIDSFEAKAKQDQSWLWAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 2 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 3 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 4 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 157 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 163 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 164 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 166 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 175 | 3300031815 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 205 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 208 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 211 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 212 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 213 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 214 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 216 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 217 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 295 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 296 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 297 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 301 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 302 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 0.94 |
| Isolates | 1.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.18 |
| Nodule | 0 |
| Rhizoplane | 1.5 |
| Rhizosphere | 88.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100289579 | 3300005329 | Bacteria | 1558 |
| 2 | Ga0070690_100164253 | 3300005330 | Bacteria | 1524 |
| 3 | Ga0070670_100051744 | 3300005331 | Bacteria | 3527 |
| 4 | Ga0070670_100256582 | 3300005331 | Bacteria | 1523 |
| 5 | Ga0070677_10015247 | 3300005333 | Bacteria | 2720 |
| 6 | Ga0070677_10101605 | 3300005333 | Bacteria | 1269 |
| 7 | Ga0068869_100371679 | 3300005334 | Bacteria | 1170 |
| 8 | Ga0070666_10000210 | 3300005335 | Bacteria | 40037 |
| 9 | Ga0070666_10018215 | 3300005335 | Bacteria | 4512 |
| 10 | Ga0070680_100022779 | 3300005336 | Bacteria | 4991 |
| 11 | Ga0070680_100469778 | 3300005336 | Bacteria | 1075 |
| 12 | Ga0068868_100263827 | 3300005338 | Bacteria | 1453 |
| 13 | Ga0070660_100024950 | 3300005339 | Bacteria | 4440 |
| 14 | Ga0070660_100732446 | 3300005339 | Bacteria | 830 |
| 15 | Ga0070689_100027470 | 3300005340 | Bacteria | 4290 |
| 16 | Ga0070661_100000582 | 3300005344 | Bacteria | 27755 |
| 17 | Ga0070669_100194816 | 3300005353 | Bacteria | 1591 |
| 18 | Ga0070669_100623269 | 3300005353 | Bacteria | 905 |
| 19 | Ga0070675_100084339 | 3300005354 | Bacteria | 2653 |
| 20 | Ga0070675_100100537 | 3300005354 | Bacteria | 2435 |
| 21 | Ga0070671_100223733 | 3300005355 | Bacteria | 1596 |
| 22 | Ga0070671_100327818 | 3300005355 | Bacteria | 1305 |
| 23 | Ga0070673_100037625 | 3300005364 | Bacteria | 3688 |
| 24 | Ga0070673_100062317 | 3300005364 | Bacteria | 2962 |
| 25 | Ga0070659_100061751 | 3300005366 | Bacteria | 2962 |
| 26 | Ga0070709_10083677 | 3300005434 | Bacteria | 2087 |
| 27 | Ga0070714_100051314 | 3300005435 | Bacteria | 3516 |
| 28 | Ga0070714_100320356 | 3300005435 | Bacteria | 1450 |
| 29 | Ga0070714_100602747 | 3300005435 | Bacteria | 1055 |
| 30 | Ga0070714_100912710 | 3300005435 | Bacteria | 853 |
| 31 | Ga0070713_100039903 | 3300005436 | Bacteria | 3814 |
| 32 | Ga0070713_100071312 | 3300005436 | Bacteria | 2935 |
| 33 | Ga0070713_100317582 | 3300005436 | Bacteria | 1438 |
| 34 | Ga0070710_10398714 | 3300005437 | Bacteria | 922 |
| 35 | Ga0070711_100111609 | 3300005439 | Bacteria | 2007 |
| 36 | Ga0070700_100040182 | 3300005441 | Bacteria | 2862 |
| 37 | Ga0070700_100272864 | 3300005441 | Bacteria | 1223 |
| 38 | Ga0070678_100160356 | 3300005456 | Bacteria | 1821 |
| 39 | Ga0070662_100442635 | 3300005457 | Unclassified | 1077 |
| 40 | Ga0070681_10079213 | 3300005458 | Bacteria | 3242 |
| 41 | Ga0070681_10090211 | 3300005458 | Bacteria | 3016 |
| 42 | Ga0070681_10128651 | 3300005458 | Bacteria | 2465 |
| 43 | Ga0070681_10208936 | 3300005458 | Bacteria | 1869 |
| 44 | Ga0070681_10576859 | 3300005458 | Bacteria | 1039 |
| 45 | Ga0068867_100191189 | 3300005459 | Bacteria | 1633 |
| 46 | Ga0070679_100003831 | 3300005530 | Bacteria | 13806 |
| 47 | Ga0070679_100302376 | 3300005530 | Bacteria | 1550 |
| 48 | Ga0070697_100535664 | 3300005536 | Bacteria | 1026 |
| 49 | Ga0068853_100387549 | 3300005539 | Bacteria | 1306 |
| 50 | Ga0070672_100029815 | 3300005543 | Bacteria | 4094 |
| 51 | Ga0070672_100178316 | 3300005543 | Bacteria | 1769 |
| 52 | Ga0070686_100184851 | 3300005544 | Bacteria | 1483 |
| 53 | Ga0070686_100602796 | 3300005544 | Bacteria | 866 |
| 54 | Ga0070696_101079598 | 3300005546 | Bacteria | 674 |
| 55 | Ga0070693_100458791 | 3300005547 | Bacteria | 896 |
| 56 | Ga0070665_100147560 | 3300005548 | Bacteria | 2355 |
| 57 | Ga0070665_100369592 | 3300005548 | Bacteria | 1441 |
| 58 | Ga0070665_100928013 | 3300005548 | Bacteria | 883 |
| 59 | Ga0068855_100033235 | 3300005563 | Bacteria | 6157 |
| 60 | Ga0068855_100123435 | 3300005563 | Bacteria | 2963 |
| 61 | Ga0068855_100169302 | 3300005563 | Bacteria | 2475 |
| 62 | Ga0068855_100287912 | 3300005563 | Bacteria | 1822 |
| 63 | Ga0068855_100887579 | 3300005563 | Bacteria | 943 |
| 64 | Ga0070664_100208071 | 3300005564 | Bacteria | 1748 |
| 65 | Ga0070664_100290462 | 3300005564 | Bacteria | 1476 |
| 66 | Ga0068857_100091306 | 3300005577 | Bacteria | 2726 |
| 67 | Ga0068857_100448668 | 3300005577 | Bacteria | 1206 |
| 68 | Ga0068856_100000522 | 3300005614 | Bacteria | 42457 |
| 69 | Ga0068856_100130094 | 3300005614 | Bacteria | 2522 |
| 70 | Ga0068856_100193534 | 3300005614 | Bacteria | 2047 |
| 71 | Ga0068856_100393265 | 3300005614 | Bacteria | 1406 |
| 72 | Ga0068852_100069237 | 3300005616 | Bacteria | 3092 |
| 73 | Ga0068852_100466117 | 3300005616 | Bacteria | 1253 |
| 74 | Ga0068852_101111772 | 3300005616 | Unclassified | 810 |
| 75 | Ga0068859_100233362 | 3300005617 | Bacteria | 1928 |
| 76 | Ga0068859_100321747 | 3300005617 | Bacteria | 1641 |
| 77 | Ga0068864_100154841 | 3300005618 | Bacteria | 2079 |
| 78 | Ga0068864_100673073 | 3300005618 | Bacteria | 1009 |
| 79 | Ga0068861_100189384 | 3300005719 | Unclassified | 1718 |
| 80 | Ga0068861_100834066 | 3300005719 | Bacteria | 868 |
| 81 | Ga0068858_100311324 | 3300005842 | Bacteria | 1504 |
| 82 | Ga0068862_100041570 | 3300005844 | Bacteria | 3912 |
| 83 | Ga0068862_100454045 | 3300005844 | Bacteria | 1209 |
| 84 | Ga0081455_10020970 | 3300005937 | Bacteria | 6140 |
| 85 | Ga0081455_10577011 | 3300005937 | Bacteria | 738 |
| 86 | Ga0081540_1009776 | 3300005983 | Bacteria | 6567 |
| 87 | Ga0081539_10001781 | 3300005985 | Bacteria | 34193 |
| 88 | Ga0081539_10004863 | 3300005985 | Bacteria | 14362 |
| 89 | Ga0081539_10230982 | 3300005985 | Bacteria | 835 |
| 90 | Ga0070717_10809040 | 3300006028 | Bacteria | 853 |
| 91 | Ga0075365_10411625 | 3300006038 | Bacteria | 954 |
| 92 | Ga0075364_10119452 | 3300006051 | Bacteria | 1764 |
| 93 | Ga0070716_100302118 | 3300006173 | Bacteria | 1114 |
| 94 | Ga0070712_100316092 | 3300006175 | Bacteria | 1269 |
| 95 | Ga0075362_10005496 | 3300006177 | Bacteria | 4644 |
| 96 | Ga0075362_10142092 | 3300006177 | Bacteria | 1147 |
| 97 | Ga0075369_10003345 | 3300006186 | Bacteria | 5828 |
| 98 | Ga0097621_100077322 | 3300006237 | Bacteria | 2762 |
| 99 | Ga0097621_100316007 | 3300006237 | Bacteria | 1382 |
| 100 | Ga0068871_100190287 | 3300006358 | Bacteria | 1767 |
| 101 | Ga0068871_100296292 | 3300006358 | Bacteria | 1418 |
| 102 | Ga0075428_100624626 | 3300006844 | Bacteria | 1150 |
| 103 | Ga0075430_100283390 | 3300006846 | Bacteria | 1371 |
| 104 | Ga0075431_100000858 | 3300006847 | Bacteria | 26654 |
| 105 | Ga0075431_100008974 | 3300006847 | Bacteria | 10023 |
| 106 | Ga0075433_10220634 | 3300006852 | Bacteria | 1684 |
| 107 | Ga0075434_100223443 | 3300006871 | Bacteria | 1903 |
| 108 | Ga0068865_100482960 | 3300006881 | Bacteria | 1030 |
| 109 | Ga0075436_100101722 | 3300006914 | Bacteria | 2001 |
| 110 | Ga0075436_100618192 | 3300006914 | Bacteria | 799 |
| 111 | Ga0097620_100233351 | 3300006931 | Bacteria | 1928 |
| 112 | Ga0097620_100321738 | 3300006931 | Bacteria | 1641 |
| 113 | Ga0099795_10006310 | 3300007788 | Bacteria | 3227 |
| 114 | Ga0099795_10016354 | 3300007788 | Bacteria | 2345 |
| 115 | Ga0099795_10034401 | 3300007788 | Bacteria | 1765 |
| 116 | Ga0105240_10123291 | 3300009093 | Bacteria | 3118 |
| 117 | Ga0105240_10159953 | 3300009093 | Bacteria | 2676 |
| 118 | Ga0105240_10233952 | 3300009093 | Bacteria | 2133 |
| 119 | Ga0105240_10309285 | 3300009093 | Bacteria | 1805 |
| 120 | Ga0105240_10523932 | 3300009093 | Bacteria | 1315 |
| 121 | Ga0105240_10764847 | 3300009093 | Bacteria | 1049 |
| 122 | Ga0111539_10026091 | 3300009094 | Bacteria | 7152 |
| 123 | Ga0105245_10561765 | 3300009098 | Bacteria | 1164 |
| 124 | Ga0114129_10065525 | 3300009147 | Bacteria | 5070 |
| 125 | Ga0114129_10505255 | 3300009147 | Bacteria | 1578 |
| 126 | Ga0105243_10126213 | 3300009148 | Bacteria | 2165 |
| 127 | Ga0105242_10065378 | 3300009176 | Bacteria | 3000 |
| 128 | Ga0105248_10272001 | 3300009177 | Bacteria | 1908 |
| 129 | Ga0105248_11725806 | 3300009177 | Bacteria | 710 |
| 130 | Ga0105237_10000304 | 3300009545 | Bacteria | 68213 |
| 131 | Ga0105237_10201296 | 3300009545 | Bacteria | 1991 |
| 132 | Ga0105237_10274715 | 3300009545 | Bacteria | 1688 |
| 133 | Ga0105237_10388505 | 3300009545 | Bacteria | 1400 |
| 134 | Ga0105237_11404928 | 3300009545 | Bacteria | 704 |
| 135 | Ga0105238_10848401 | 3300009551 | Bacteria | 931 |
| 136 | Ga0105249_10229596 | 3300009553 | Bacteria | 1830 |
| 137 | Ga0099796_10026910 | 3300010159 | Bacteria | 1832 |
| 138 | Ga0105246_10393844 | 3300011119 | Bacteria | 1148 |
| 139 | Ga0157373_10306940 | 3300013100 | Bacteria | 1127 |
| 140 | Ga0157371_10435177 | 3300013102 | Bacteria | 963 |
| 141 | Ga0157370_10003211 | 3300013104 | Bacteria | 19328 |
| 142 | Ga0157370_10026609 | 3300013104 | Bacteria | 5709 |
| 143 | Ga0157370_10203548 | 3300013104 | Bacteria | 1836 |
| 144 | Ga0157370_10209146 | 3300013104 | Bacteria | 1808 |
| 145 | Ga0157370_10385956 | 3300013104 | Bacteria | 1290 |
| 146 | Ga0157370_10612062 | 3300013104 | Bacteria | 997 |
| 147 | Ga0157369_10014337 | 3300013105 | Bacteria | 8950 |
| 148 | Ga0157369_10018323 | 3300013105 | Bacteria | 7851 |
| 149 | Ga0157369_10061648 | 3300013105 | Bacteria | 4042 |
| 150 | Ga0157369_10412526 | 3300013105 | Bacteria | 1400 |
| 151 | Ga0157369_10919463 | 3300013105 | Bacteria | 897 |
| 152 | Ga0157374_10132066 | 3300013296 | Bacteria | 2417 |
| 153 | Ga0157374_10248049 | 3300013296 | Bacteria | 1752 |
| 154 | Ga0163162_10119742 | 3300013306 | Bacteria | 2736 |
| 155 | Ga0163162_10153579 | 3300013306 | Bacteria | 2421 |
| 156 | Ga0157372_10060527 | 3300013307 | Bacteria | 4237 |
| 157 | Ga0157372_10080366 | 3300013307 | Bacteria | 3688 |
| 158 | Ga0157372_10179804 | 3300013307 | Bacteria | 2448 |
| 159 | Ga0157372_11544630 | 3300013307 | Bacteria | 764 |
| 160 | Ga0157375_10029144 | 3300013308 | Bacteria | 5186 |
| 161 | Ga0157375_10039658 | 3300013308 | Bacteria | 4534 |
| 162 | Ga0163163_10313989 | 3300014325 | Bacteria | 1621 |
| 163 | Ga0157380_10045818 | 3300014326 | Bacteria | 3434 |
| 164 | Ga0182008_10000171 | 3300014497 | Bacteria | 50744 |
| 165 | Ga0182008_10091792 | 3300014497 | Bacteria | 1497 |
| 166 | Ga0157379_10011036 | 3300014968 | Bacteria | 7874 |
| 167 | Ga0157379_10076995 | 3300014968 | Bacteria | 2987 |
| 168 | Ga0157379_10266928 | 3300014968 | Bacteria | 1556 |
| 169 | Ga0163161_10257803 | 3300017792 | Bacteria | 1361 |
| 170 | Ga0206355_1529234 | 3300020076 | Bacteria | 1106 |
| 171 | Ga0213876_10060261 | 3300021384 | Bacteria | 2002 |
| 172 | Ga0213876_10160791 | 3300021384 | Bacteria | 1194 |
| 173 | Ga0213875_10000863 | 3300021388 | Bacteria | 22384 |
| 174 | Ga0213875_10005044 | 3300021388 | Bacteria | 7154 |
| 175 | Ga0224712_10089146 | 3300022467 | Bacteria | 1289 |
| 176 | Ga0207673_1000811 | 3300025290 | Bacteria | 3375 |
| 177 | Ga0207697_10083223 | 3300025315 | Bacteria | 1350 |
| 178 | Ga0207682_10015551 | 3300025893 | Bacteria | 2963 |
| 179 | Ga0207692_10412431 | 3300025898 | Bacteria | 844 |
| 180 | Ga0207688_10015305 | 3300025901 | Bacteria | 4162 |
| 181 | Ga0207688_10531688 | 3300025901 | Bacteria | 738 |
| 182 | Ga0207680_10000318 | 3300025903 | Bacteria | 23043 |
| 183 | Ga0207647_10076848 | 3300025904 | Bacteria | 2008 |
| 184 | Ga0207699_10041749 | 3300025906 | Bacteria | 2652 |
| 185 | Ga0207645_10278454 | 3300025907 | Bacteria | 1110 |
| 186 | Ga0207707_10014668 | 3300025912 | Bacteria | 6829 |
| 187 | Ga0207707_10077292 | 3300025912 | Bacteria | 2906 |
| 188 | Ga0207707_10081496 | 3300025912 | Bacteria | 2825 |
| 189 | Ga0207707_10241547 | 3300025912 | Bacteria | 1570 |
| 190 | Ga0207695_10077314 | 3300025913 | Bacteria | 3381 |
| 191 | Ga0207695_10166990 | 3300025913 | Bacteria | 2128 |
| 192 | Ga0207695_10221076 | 3300025913 | Bacteria | 1801 |
| 193 | Ga0207695_10370602 | 3300025913 | Bacteria | 1318 |
| 194 | Ga0207695_10502989 | 3300025913 | Bacteria | 1094 |
| 195 | Ga0207671_10001956 | 3300025914 | Bacteria | 22727 |
| 196 | Ga0207671_10270766 | 3300025914 | Bacteria | 1338 |
| 197 | Ga0207671_10372587 | 3300025914 | Bacteria | 1134 |
| 198 | Ga0207693_10012149 | 3300025915 | Bacteria | 6958 |
| 199 | Ga0207693_10046205 | 3300025915 | Bacteria | 3420 |
| 200 | Ga0207663_10299579 | 3300025916 | Bacteria | 1201 |
| 201 | Ga0207660_10260073 | 3300025917 | Bacteria | 1372 |
| 202 | Ga0207662_10062967 | 3300025918 | Bacteria | 2230 |
| 203 | Ga0207657_10095173 | 3300025919 | Bacteria | 2478 |
| 204 | Ga0207649_10000036 | 3300025920 | Bacteria | 132545 |
| 205 | Ga0207652_10048090 | 3300025921 | Bacteria | 3645 |
| 206 | Ga0207652_10509323 | 3300025921 | Bacteria | 1083 |
| 207 | Ga0207681_10048651 | 3300025923 | Bacteria | 2863 |
| 208 | Ga0207681_10378476 | 3300025923 | Bacteria | 1139 |
| 209 | Ga0207694_10023854 | 3300025924 | Bacteria | 4645 |
| 210 | Ga0207694_10467016 | 3300025924 | Bacteria | 1055 |
| 211 | Ga0207650_10021483 | 3300025925 | Bacteria | 4561 |
| 212 | Ga0207650_10195200 | 3300025925 | Bacteria | 1619 |
| 213 | Ga0207659_10048971 | 3300025926 | Bacteria | 2995 |
| 214 | Ga0207700_10012180 | 3300025928 | Bacteria | 5532 |
| 215 | Ga0207700_10022784 | 3300025928 | Bacteria | 4302 |
| 216 | Ga0207700_10087330 | 3300025928 | Bacteria | 2453 |
| 217 | Ga0207700_10091490 | 3300025928 | Bacteria | 2403 |
| 218 | Ga0207700_10147626 | 3300025928 | Bacteria | 1940 |
| 219 | Ga0207700_10261100 | 3300025928 | Bacteria | 1483 |
| 220 | Ga0207664_10128770 | 3300025929 | Bacteria | 2128 |
| 221 | Ga0207664_10381599 | 3300025929 | Bacteria | 1251 |
| 222 | Ga0207709_10361063 | 3300025935 | Bacteria | 1100 |
| 223 | Ga0207669_10011067 | 3300025937 | Bacteria | 4374 |
| 224 | Ga0207691_10135303 | 3300025940 | Bacteria | 2174 |
| 225 | Ga0207691_10147738 | 3300025940 | Bacteria | 2068 |
| 226 | Ga0207711_10253299 | 3300025941 | Bacteria | 1617 |
| 227 | Ga0207689_10062348 | 3300025942 | Bacteria | 3066 |
| 228 | Ga0207661_10133363 | 3300025944 | Bacteria | 2131 |
| 229 | Ga0207661_10393330 | 3300025944 | Bacteria | 1256 |
| 230 | Ga0207679_10092082 | 3300025945 | Bacteria | 2348 |
| 231 | Ga0207667_10089982 | 3300025949 | Bacteria | 3172 |
| 232 | Ga0207667_10327015 | 3300025949 | Bacteria | 1565 |
| 233 | Ga0207667_10507699 | 3300025949 | Bacteria | 1222 |
| 234 | Ga0207667_10587014 | 3300025949 | Bacteria | 1124 |
| 235 | Ga0207640_10091261 | 3300025981 | Bacteria | 2110 |
| 236 | Ga0207677_10133911 | 3300026023 | Bacteria | 1886 |
| 237 | Ga0207703_10040606 | 3300026035 | Bacteria | 3724 |
| 238 | Ga0207639_10522071 | 3300026041 | Bacteria | 1087 |
| 239 | Ga0207678_10309592 | 3300026067 | Bacteria | 1358 |
| 240 | Ga0207708_10046860 | 3300026075 | Bacteria | 3292 |
| 241 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 242 | Ga0207702_10136553 | 3300026078 | Bacteria | 2213 |
| 243 | Ga0207641_10063753 | 3300026088 | Bacteria | 3148 |
| 244 | Ga0207641_10118280 | 3300026088 | Bacteria | 2360 |
| 245 | Ga0207641_10974885 | 3300026088 | Bacteria | 844 |
| 246 | Ga0207648_10040461 | 3300026089 | Bacteria | 4096 |
| 247 | Ga0207676_10012081 | 3300026095 | Bacteria | 6179 |
| 248 | Ga0207676_10571858 | 3300026095 | Bacteria | 1082 |
| 249 | Ga0207676_10769914 | 3300026095 | Bacteria | 937 |
| 250 | Ga0207674_10030475 | 3300026116 | Bacteria | 5670 |
| 251 | Ga0207674_10324747 | 3300026116 | Bacteria | 1488 |
| 252 | Ga0207674_11288899 | 3300026116 | Bacteria | 700 |
| 253 | Ga0207675_100024271 | 3300026118 | Bacteria | 5638 |
| 254 | Ga0207675_100858476 | 3300026118 | Bacteria | 923 |
| 255 | Ga0207683_10501860 | 3300026121 | Bacteria | 1121 |
| 256 | Ga0207698_10052846 | 3300026142 | Bacteria | 3115 |
| 257 | Ga0207698_10096453 | 3300026142 | Bacteria | 2437 |
| 258 | Ga0209966_1088460 | 3300027695 | Bacteria | 692 |
| 259 | Ga0207428_10012127 | 3300027907 | Bacteria | 7582 |
| 260 | Ga0268266_10099352 | 3300028379 | Bacteria | 2562 |
| 261 | Ga0268266_10273283 | 3300028379 | Bacteria | 1569 |
| 262 | Ga0268265_10029583 | 3300028380 | Bacteria | 3934 |
| 263 | Ga0268265_10043021 | 3300028380 | Bacteria | 3355 |
| 264 | Ga0268265_10402822 | 3300028380 | Bacteria | 1265 |
| 265 | Ga0268265_11339332 | 3300028380 | Bacteria | 717 |
| 266 | Ga0265319_1005645 | 3300028563 | Bacteria | 5949 |
| 267 | Ga0265319_1070464 | 3300028563 | Bacteria | 1121 |
| 268 | Ga0265334_10000242 | 3300028573 | Bacteria | 31502 |
| 269 | Ga0265318_10000024 | 3300028577 | Bacteria | 159801 |
| 270 | Ga0307517_10108323 | 3300028786 | Bacteria | 2134 |
| 271 | Ga0307515_10050694 | 3300028794 | Bacteria | 6209 |
| 272 | Ga0265338_10033908 | 3300028800 | Bacteria | 4945 |
| 273 | Ga0265338_10082115 | 3300028800 | Bacteria | 2699 |
| 274 | Ga0307512_10031923 | 3300030522 | Bacteria | 4555 |
| 275 | Ga0265762_1037011 | 3300030760 | Bacteria | 944 |
| 276 | Ga0265760_10072497 | 3300031090 | Bacteria | 1058 |
| 277 | Ga0265330_10002684 | 3300031235 | Bacteria | 9616 |
| 278 | Ga0265332_10014578 | 3300031238 | Bacteria | 3477 |
| 279 | Ga0265332_10041515 | 3300031238 | Bacteria | 1990 |
| 280 | Ga0265328_10007268 | 3300031239 | Bacteria | 4628 |
| 281 | Ga0265328_10036071 | 3300031239 | Bacteria | 1827 |
| 282 | Ga0265320_10008638 | 3300031240 | Bacteria | 6214 |
| 283 | Ga0265320_10022856 | 3300031240 | Bacteria | 3338 |
| 284 | Ga0265320_10086039 | 3300031240 | Bacteria | 1462 |
| 285 | Ga0265325_10006476 | 3300031241 | Bacteria | 7098 |
| 286 | Ga0265329_10000807 | 3300031242 | Bacteria | 15917 |
| 287 | Ga0265329_10033083 | 3300031242 | Bacteria | 1672 |
| 288 | Ga0265340_10004949 | 3300031247 | Bacteria | 7407 |
| 289 | Ga0265340_10012368 | 3300031247 | Bacteria | 4510 |
| 290 | Ga0265339_10007816 | 3300031249 | Bacteria | 6867 |
| 291 | Ga0265339_10019827 | 3300031249 | Bacteria | 3939 |
| 292 | Ga0265339_10059572 | 3300031249 | Bacteria | 2059 |
| 293 | Ga0265331_10005325 | 3300031250 | Bacteria | 7783 |
| 294 | Ga0265331_10005675 | 3300031250 | Bacteria | 7496 |
| 295 | Ga0265331_10031957 | 3300031250 | Bacteria | 2612 |
| 296 | Ga0307513_10013624 | 3300031456 | Bacteria | 9969 |
| 297 | Ga0307509_10071030 | 3300031507 | Bacteria | 3633 |
| 298 | Ga0265313_10003524 | 3300031595 | Bacteria | 12621 |
| 299 | Ga0307508_10000358 | 3300031616 | Bacteria | 55352 |
| 300 | Ga0265314_10002039 | 3300031711 | Bacteria | 21396 |
| 301 | Ga0265314_10028433 | 3300031711 | Bacteria | 4168 |
| 302 | Ga0265314_10030196 | 3300031711 | Bacteria | 4015 |
| 303 | Ga0265342_10010141 | 3300031712 | Bacteria | 6565 |
| 304 | Ga0265342_10012608 | 3300031712 | Bacteria | 5719 |
| 305 | Ga0316576_10008993 | 3300031727 | Bacteria | 6419 |
| 306 | Ga0316045_117561 | 3300031815 | Bacteria | 718 |
| 307 | Ga0307416_100438232 | 3300032002 | Bacteria | 1356 |
| 308 | Ga0307415_100368680 | 3300032126 | Bacteria | 1215 |
| 309 | Ga0316580_10095074 | 3300032139 | Bacteria | 912 |
| 310 | Ga0307510_10202843 | 3300033180 | Bacteria | 1515 |
| 311 | Ga0307510_10267875 | 3300033180 | Bacteria | 1186 |
| 312 | Ga0316212_1021453 | 3300033547 | Bacteria | 906 |
| 313 | Ga0373934_0057809 | 3300035086 | Bacteria | 1543 |
| 314 | Ga0373944_0089018 | 3300035089 | Bacteria | 1030 |
| 315 | Ga0373923_0047470 | 3300035111 | Bacteria | 1790 |
| 316 | Ga0373945_0032316 | 3300035116 | Bacteria | 1854 |
| 317 | Ga0373945_0309426 | 3300035116 | Bacteria | 678 |
| 318 | Ga0373953_0216421 | 3300035117 | Bacteria | 830 |
| 319 | Ga0373954_0072677 | 3300035118 | Bacteria | 1636 |
| 320 | Ga0373954_0072697 | 3300035118 | Bacteria | 1636 |
| 321 | Ga0373943_0126819 | 3300035170 | Bacteria | 1362 |
| 322 | Ga0373943_0177257 | 3300035170 | Bacteria | 1170 |
| 323 | Ga0373943_0303924 | 3300035170 | Bacteria | 906 |
| 324 | Ga0373946_0080103 | 3300035171 | Bacteria | 1428 |
| 325 | Ga0373955_0007276 | 3300035172 | Bacteria | 5082 |
| 326 | Ga0373955_0306411 | 3300035172 | Bacteria | 958 |
| 327 | Ga0373961_0140530 | 3300035241 | Bacteria | 815 |
| 328 | Ga0373962_0090821 | 3300035242 | Bacteria | 940 |
| 329 | Ga0373931_0063931 | 3300035691 | Bacteria | 1990 |
| 330 | Ga0373931_0085098 | 3300035691 | Bacteria | 1752 |
| 331 | Ga0373931_0264685 | 3300035691 | Bacteria | 1050 |
| 332 | Ga0373935_0037739 | 3300035692 | Bacteria | 3024 |
| 333 | Ga0373935_0502843 | 3300035692 | Bacteria | 880 |
| 334 | Ga0373927_0488090 | 3300035695 | Bacteria | 814 |
| 335 | Ga0373933_0023643 | 3300035724 | Bacteria | 3513 |
| 336 | Ga0373933_0093860 | 3300035724 | Bacteria | 1855 |
| 337 | Ga0373933_0157650 | 3300035724 | Bacteria | 1440 |
| 338 | Ga0373947_0160997 | 3300035725 | Bacteria | 1451 |
| 339 | Ga0373937_0008874 | 3300036401 | Bacteria | 8728 |
| 340 | Ga0373937_0012551 | 3300036401 | Bacteria | 7454 |
| 341 | Ga0373937_0066253 | 3300036401 | Bacteria | 3325 |
| 342 | Ga0373937_0146600 | 3300036401 | Bacteria | 2210 |
| 343 | Ga0373937_0676124 | 3300036401 | Unclassified | 978 |
| 344 | Ga0316584_0727267 | 3300036712 | Bacteria | 679 |
| 345 | Ga0373925_0169343 | 3300037068 | Bacteria | 1724 |
| 346 | Ga0373925_0531226 | 3300037068 | Bacteria | 967 |
| 347 | Ga0373925_0826561 | 3300037068 | Bacteria | 764 |
| 348 | Ga0395900_0012540 | 3300037418 | Bacteria | 8671 |
| 349 | Ga0395900_0041489 | 3300037418 | Bacteria | 4744 |
| 350 | Ga0395898_0050370 | 3300037466 | Bacteria | 4076 |
| 351 | Ga0395898_0130361 | 3300037466 | Bacteria | 2409 |
| 352 | Ga0395898_0424249 | 3300037466 | Bacteria | 1267 |
| 353 | Ga0395898_0568404 | 3300037466 | Bacteria | 1076 |
| 354 | Ga0436364_0208031 | 3300037853 | Bacteria | 1213 |
| 355 | Ga0436364_0607465 | 3300037853 | Bacteria | 39411 |
| 356 | Ga0436364_0972465 | 3300037853 | Bacteria | 5964 |
| 357 | Ga0436364_0992577 | 3300037853 | Bacteria | 61189 |
| 358 | Ga0436364_1529531 | 3300037853 | Bacteria | 1939 |
| 359 | Ga0395901_0255746 | 3300038443 | Bacteria | 1824 |
| 360 | Ga0395901_0270011 | 3300038443 | Bacteria | 1769 |
| 361 | Ga0395901_0436821 | 3300038443 | Bacteria | 1340 |
| 362 | Ga0395901_0584254 | 3300038443 | Bacteria | 1128 |
| 363 | Ga0400486_25950 | 3300038742 | Bacteria | 4507 |
| 364 | Ga0400487_45699 | 3300039110 | Bacteria | 2123 |
| 365 | Ga0436365_0197362 | 3300039437 | Bacteria | 7050 |
| 366 | Ga0436365_0709051 | 3300039437 | Bacteria | 32416 |
| 367 | Ga0436365_0712452 | 3300039437 | Bacteria | 2949 |
| 368 | Ga0436365_1592530 | 3300039437 | Bacteria | 1101 |
| 369 | Ga0436365_1744068 | 3300039437 | Bacteria | 686 |
| 370 | Ga0436365_1792009 | 3300039437 | Bacteria | 1613 |
| 371 | Ga0436360_0608677 | 3300039438 | Bacteria | 742 |
| 372 | Ga0436360_1045365 | 3300039438 | Bacteria | 745 |
| 373 | Ga0436360_1199485 | 3300039438 | Bacteria | 1466 |
| 374 | Ga0436361_0238240 | 3300039447 | Bacteria | 2158 |
| 375 | Ga0436361_0524149 | 3300039447 | Bacteria | 3429 |
| 376 | Ga0436361_0638706 | 3300039447 | Bacteria | 2394 |
| 377 | Ga0436363_0556338 | 3300039450 | Bacteria | 932 |
| 378 | Ga0436363_0834227 | 3300039450 | Bacteria | 701 |
| 379 | Ga0436362_0170569 | 3300039453 | Bacteria | 1311 |
| 380 | Ga0439438_002468 | 3300041405 | Bacteria | 7866 |
| 381 | Ga0439447_002751 | 3300041407 | Bacteria | 6356 |
| 382 | Ga0439466_0012459 | 3300041411 | Bacteria | 3131 |
| 383 | Ga0451798_0255457 | 3300041458 | Bacteria | 811 |
| 384 | Ga0451807_2272789 | 3300041486 | Bacteria | 1591 |
| 385 | Ga0439452_003688 | 3300042010 | Bacteria | 5300 |
| 386 | Ga0439446_0142206 | 3300042156 | Bacteria | 784 |
| 387 | Ga0451577_0000212 | 3300042876 | Bacteria | 122106 |
| 388 | Ga0451577_0060680 | 3300042876 | Bacteria | 3371 |
| 389 | Ga0451577_0216096 | 3300042876 | Bacteria | 1732 |
| 390 | Ga0453683_0154790 | 3300044673 | Bacteria | 1449 |
| 391 | Ga0466963_0512272 | 3300044694 | Bacteria | 847 |
| 392 | Ga0453684_0274560 | 3300044712 | Bacteria | 1925 |
| 393 | Ga0451576_0050890 | 3300045051 | Bacteria | 4344 |
| 394 | Ga0451576_0340790 | 3300045051 | Bacteria | 1569 |
| 395 | Ga0466967_0043866 | 3300045976 | Bacteria | 3875 |
| 396 | Ga0466967_0136191 | 3300045976 | Bacteria | 2284 |
| 397 | Ga0466967_0238372 | 3300045976 | Bacteria | 1734 |
| 398 | Ga0495627_023956 | 3300046453 | Bacteria | 1994 |
| 399 | Ga0495580_0126543 | 3300046472 | Bacteria | 1773 |
| 400 | Ga0495580_0153360 | 3300046472 | Bacteria | 1596 |
| 401 | Ga0495582_0170241 | 3300046473 | Bacteria | 1240 |
| 402 | Ga0495605_0066281 | 3300046474 | Bacteria | 1716 |
| 403 | Ga0495618_0043537 | 3300046514 | Bacteria | 2832 |
| 404 | Ga0495628_0072972 | 3300046516 | Bacteria | 2674 |
| 405 | Ga0495628_0132824 | 3300046516 | Bacteria | 1903 |
| 406 | Ga0495628_0183720 | 3300046516 | Bacteria | 1581 |
| 407 | Ga0495630_0031777 | 3300046517 | Bacteria | 3932 |
| 408 | Ga0495630_0428336 | 3300046517 | Bacteria | 1014 |
| 409 | Ga0495630_0575695 | 3300046517 | Bacteria | 863 |
| 410 | Ga0495631_0037460 | 3300046518 | Bacteria | 2160 |
| 411 | Ga0495632_0002900 | 3300046519 | Bacteria | 12607 |
| 412 | Ga0495648_0131146 | 3300046524 | Bacteria | 1332 |
| 413 | Ga0495652_0154176 | 3300046529 | Bacteria | 1791 |
| 414 | Ga0495640_0318911 | 3300046533 | Bacteria | 963 |
| 415 | Ga0495587_0146743 | 3300046536 | Bacteria | 1345 |
| 416 | Ga0495667_0459457 | 3300046559 | Bacteria | 799 |
| 417 | Ga0495634_0215100 | 3300046642 | Bacteria | 1188 |
| 418 | Ga0495625_0145458 | 3300046660 | Bacteria | 1596 |
| 419 | Ga0495635_0268043 | 3300046663 | Bacteria | 1149 |
| 420 | Ga0495599_0375446 | 3300046678 | Bacteria | 849 |
| 421 | Ga0495658_0031792 | 3300046683 | Bacteria | 2877 |
| 422 | Ga0495624_0449856 | 3300046690 | Bacteria | 772 |
| 423 | Ga0495649_0003265 | 3300046694 | Bacteria | 11048 |
| 424 | Ga0495581_0277487 | 3300047315 | Bacteria | 980 |
| 425 | Ga0495604_0410684 | 3300047317 | Bacteria | 890 |
| 426 | Ga0495604_0431334 | 3300047317 | Bacteria | 864 |
| 427 | Ga0495680_0280771 | 3300047322 | Bacteria | 1174 |
| 428 | Ga0495687_001187 | 3300047443 | Bacteria | 25022 |
| 429 | Ga0495675_0153738 | 3300047444 | Bacteria | 1420 |
| 430 | Ga0495626_0117695 | 3300048091 | Bacteria | 1145 |
| 431 | Ga0496104_0052190 | 3300048907 | Bacteria | 3862 |
| 432 | Ga0496109_0598560 | 3300048912 | Unclassified | 1039 |
| 433 | Ga0496112_0430021 | 3300048915 | Bacteria | 1259 |
| 434 | Ga0496113_0069705 | 3300048916 | Bacteria | 2671 |
| 435 | Ga0496115_0019339 | 3300048918 | Bacteria | 5240 |
| 436 | Ga0496115_0086389 | 3300048918 | Bacteria | 2559 |
| 437 | Ga0496126_0000406 | 3300048929 | Bacteria | 87599 |
| 438 | Ga0496126_0007049 | 3300048929 | Bacteria | 12393 |
| 439 | Ga0496126_0129350 | 3300048929 | Bacteria | 2183 |
| 440 | Ga0496126_0138488 | 3300048929 | Bacteria | 2097 |
| 441 | Ga0496126_0274726 | 3300048929 | Bacteria | 1397 |
| 442 | Ga0496126_0388045 | 3300048929 | Bacteria | 1135 |
| 443 | Ga0501031_0113567 | 3300049568 | Bacteria | 1769 |
| 444 | Ga0501031_0247837 | 3300049568 | Bacteria | 1158 |
| 445 | Ga0501032_0051088 | 3300049569 | Bacteria | 2787 |
| 446 | Ga0501033_0051426 | 3300049570 | Bacteria | 3054 |
| 447 | Ga0501033_0066735 | 3300049570 | Bacteria | 2646 |
| 448 | Ga0501034_0000374 | 3300049571 | Bacteria | 76280 |
| 449 | Ga0501034_0009431 | 3300049571 | Bacteria | 10215 |
| 450 | Ga0501034_0041569 | 3300049571 | Bacteria | 4652 |
| 451 | Ga0501034_0136934 | 3300049571 | Bacteria | 2429 |
| 452 | Ga0501034_0137215 | 3300049571 | Bacteria | 2427 |
| 453 | Ga0501034_0335616 | 3300049571 | Bacteria | 1442 |
| 454 | Ga0501036_0001435 | 3300049572 | Bacteria | 18318 |
| 455 | Ga0501036_0044095 | 3300049572 | Bacteria | 3777 |
| 456 | Ga0501038_0023734 | 3300049574 | Bacteria | 5480 |
| 457 | Ga0501038_0246512 | 3300049574 | Bacteria | 1416 |
| 458 | Ga0501038_0354477 | 3300049574 | Bacteria | 1142 |
| 459 | Ga0501038_0651623 | 3300049574 | Bacteria | 793 |
| 460 | Ga0501039_0007451 | 3300049575 | Bacteria | 8352 |
| 461 | Ga0501042_0014148 | 3300049578 | Bacteria | 5442 |
| 462 | Ga0501043_0002453 | 3300049579 | Bacteria | 15684 |
| 463 | Ga0501043_0160371 | 3300049579 | Bacteria | 1757 |
| 464 | Ga0501043_0412765 | 3300049579 | Bacteria | 1019 |
| 465 | Ga0501046_0051089 | 3300049580 | Bacteria | 3264 |
| 466 | Ga0501047_0000234 | 3300049581 | Bacteria | 65759 |
| 467 | Ga0501047_0011934 | 3300049581 | Bacteria | 8222 |
| 468 | Ga0501047_0023022 | 3300049581 | Bacteria | 5980 |
| 469 | Ga0501047_0082351 | 3300049581 | Bacteria | 3093 |
| 470 | Ga0501048_0000051 | 3300049582 | Bacteria | 57320 |
| 471 | Ga0501048_0286460 | 3300049582 | Bacteria | 1171 |
| 472 | Ga0501048_0672293 | 3300049582 | Bacteria | 744 |
| 473 | Ga0501068_0089059 | 3300049584 | Bacteria | 1902 |
| 474 | Ga0501069_0034537 | 3300049585 | Bacteria | 2785 |
| 475 | Ga0501070_0001845 | 3300049586 | Bacteria | 18698 |
| 476 | Ga0501070_0068595 | 3300049586 | Bacteria | 2935 |
| 477 | Ga0501070_0142819 | 3300049586 | Bacteria | 1976 |
| 478 | Ga0501072_0198332 | 3300049588 | Bacteria | 1600 |
| 479 | Ga0501073_0018322 | 3300049589 | Bacteria | 5059 |
| 480 | Ga0501073_0030914 | 3300049589 | Bacteria | 3823 |
| 481 | Ga0501073_0484370 | 3300049589 | Bacteria | 855 |
| 482 | Ga0501074_0036705 | 3300049590 | Bacteria | 3549 |
| 483 | Ga0501076_0160063 | 3300049592 | Bacteria | 1834 |
| 484 | Ga0501076_0222847 | 3300049592 | Bacteria | 1541 |
| 485 | Ga0501076_0669307 | 3300049592 | Bacteria | 857 |
| 486 | Ga0501077_0216912 | 3300049593 | Bacteria | 1216 |
| 487 | Ga0501079_0051628 | 3300049741 | Bacteria | 3175 |
| 488 | Ga0501079_0332919 | 3300049741 | Bacteria | 1189 |
| 489 | Ga0501079_0466112 | 3300049741 | Bacteria | 992 |
| 490 | Ga0501080_0000383 | 3300049742 | Bacteria | 34102 |
| 491 | Ga0501080_0032801 | 3300049742 | Bacteria | 4844 |
| 492 | Ga0501083_0356014 | 3300049744 | Bacteria | 952 |
| 493 | Ga0501083_0358200 | 3300049744 | Bacteria | 948 |
| 494 | Ga0501035_0049770 | 3300049822 | Bacteria | 3755 |
| 495 | Ga0501035_0076395 | 3300049822 | Bacteria | 2962 |
| 496 | Ga0501044_0005993 | 3300049823 | Bacteria | 13431 |
| 497 | Ga0501044_0053131 | 3300049823 | Bacteria | 4169 |
| 498 | Ga0501044_0065692 | 3300049823 | Bacteria | 3699 |
| 499 | Ga0501044_0076178 | 3300049823 | Bacteria | 3406 |
| 500 | Ga0501044_0086296 | 3300049823 | Bacteria | 3170 |
| 501 | Ga0501044_0183687 | 3300049823 | Bacteria | 2057 |
| 502 | Ga0501045_0243629 | 3300049824 | Bacteria | 1338 |
| 503 | nmdc:mga00v17_159308_c1 | 3300050491 | Bacteria | 1452 |
| 504 | nmdc:mga0yw44_359981_c1 | 3300050492 | Bacteria | 980 |
| 505 | nmdc:mga0yw44_553354_c1 | 3300050492 | Bacteria | 781 |
| 506 | nmdc:mga0yw44_63689_c1 | 3300050492 | Bacteria | 2268 |
| 507 | nmdc:mga07m45_148644_c1 | 3300050496 | Bacteria | 1358 |
| 508 | nmdc:mga05p37_177785_c1 | 3300050507 | Bacteria | 2591 |
| 509 | nmdc:mga09592_110955_c1 | 3300050508 | Bacteria | 2353 |
| 510 | nmdc:mga06r32_64259_c1 | 3300050510 | Bacteria | 3539 |
| 511 | nmdc:mga08y16_29920_c1 | 3300050511 | Bacteria | 5735 |
| 512 | nmdc:mga08y16_403739_c1 | 3300050511 | Bacteria | 1398 |
| 513 | nmdc:mga08y16_61504_c1 | 3300050511 | Bacteria | 3921 |
| 514 | nmdc:mga08y16_79260_c1 | 3300050511 | Bacteria | 3423 |
| 515 | nmdc:mga08x19_99056_c1 | 3300050514 | Bacteria | 1932 |
| 516 | nmdc:mga0a205_126357_c1 | 3300050515 | Bacteria | 2457 |
| 517 | nmdc:mga0sz30_9199_c1 | 3300050516 | Bacteria | 3751 |
| 518 | Ga0495595_0237165 | 3300053084 | Bacteria | 912 |
| 519 | Ga0500646_0231094 | 3300053090 | Bacteria | 645 |
| 520 | Ga0500651_0107846 | 3300053093 | Bacteria | 1702 |
| 521 | Ga0500651_0119881 | 3300053093 | Bacteria | 1598 |
| 522 | Ga0500568_0010673 | 3300053139 | Bacteria | 4291 |
| 523 | Ga0500603_077755 | 3300053150 | Bacteria | 956 |
| 524 | Ga0500616_0000541 | 3300053153 | Bacteria | 47231 |
| 525 | Ga0501084_0000512 | 3300054114 | Bacteria | 29772 |
| 526 | Ga0501084_0520305 | 3300054114 | Bacteria | 1006 |
| 527 | Ga0530510_0072370 | 3300061734 | Bacteria | 2502 |
| 528 | Ga0530510_0329883 | 3300061734 | Bacteria | 1144 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0584254 | Ga0395901_0584254_572_1111 | 169 |
| 2 | 3300049584 | Ga0501068_0089059 | Ga0501068_0089059_824_1486 | 172 |
| 3 | 3300050492 | nmdc:mga0yw44_63689_c1 | nmdc:mga0yw44_63689_c1_13_570 | 175 |
| 4 | 3300031250 | Ga0265331_10031957 | Ga0265331_100319573 | 176 |
| 5 | 3300035117 | Ga0373953_0216421 | Ga0373953_0216421_257_817 | 176 |
| 6 | 3300035692 | Ga0373935_0502843 | Ga0373935_0502843_285_845 | 176 |
| 7 | 3300046559 | Ga0495667_0459457 | Ga0495667_0459457_221_781 | 176 |
| 8 | 3300050508 | nmdc:mga09592_110955_c1 | nmdc:mga09592_110955_c1_604_1158 | 176 |
| 9 | 3300050510 | nmdc:mga06r32_64259_c1 | nmdc:mga06r32_64259_c1_1313_1867 | 176 |
| 10 | 3300053090 | Ga0500646_0231094 | Ga0500646_0231094_66_632 | 177 |
| 11 | iso_pu_bacteria | 2916971899 | 2916974959 | 177 |
| 12 | 3300039450 | Ga0436363_0834227 | Ga0436363_0834227_17_583 | 178 |
| 13 | 3300027695 | Ga0209966_1088460 | Ga0209966_10884601 | 180 |
| 14 | 3300036712 | Ga0316584_0727267 | Ga0316584_0727267_67_642 | 180 |
| 15 | 3300041458 | Ga0451798_0255457 | Ga0451798_0255457_60_620 | 180 |
| 16 | 3300041486 | Ga0451807_2272789 | Ga0451807_2272789_549_1118 | 180 |
| 17 | 3300006051 | Ga0075364_10119452 | Ga0075364_101194522 | 181 |
| 18 | 3300006871 | Ga0075434_100223443 | Ga0075434_1002234432 | 181 |
| 19 | 3300011119 | Ga0105246_10393844 | Ga0105246_103938441 | 181 |
| 20 | 3300035170 | Ga0373943_0303924 | Ga0373943_0303924_240_812 | 181 |
| 21 | 3300035171 | Ga0373946_0080103 | Ga0373946_0080103_658_1230 | 181 |
| 22 | 3300035172 | Ga0373955_0007276 | Ga0373955_0007276_3449_4021 | 181 |
| 23 | 3300036401 | Ga0373937_0676124 | Ga0373937_0676124_315_887 | 181 |
| 24 | 3300037418 | Ga0395900_0012540 | Ga0395900_0012540_7973_8536 | 181 |
| 25 | 3300037466 | Ga0395898_0568404 | Ga0395898_0568404_492_1055 | 181 |
| 26 | 3300044673 | Ga0453683_0154790 | Ga0453683_0154790_564_1181 | 181 |
| 27 | 3300046514 | Ga0495618_0043537 | Ga0495618_0043537_371_943 | 181 |
| 28 | 3300046516 | Ga0495628_0072972 | Ga0495628_0072972_972_1544 | 181 |
| 29 | 3300046517 | Ga0495630_0031777 | Ga0495630_0031777_879_1451 | 181 |
| 30 | 3300046642 | Ga0495634_0215100 | Ga0495634_0215100_206_778 | 181 |
| 31 | 3300050491 | nmdc:mga00v17_159308_c1 | nmdc:mga00v17_159308_c1_671_1246 | 181 |
| 32 | iso_pu_bacteria | 2687453341 | 2688392344 | 181 |
| 33 | 3300005548 | Ga0070665_100928013 | Ga0070665_1009280132 | 182 |
| 34 | 3300005563 | Ga0068855_100033235 | Ga0068855_1000332356 | 182 |
| 35 | 3300026088 | Ga0207641_10974885 | Ga0207641_109748852 | 182 |
| 36 | 3300028563 | Ga0265319_1005645 | Ga0265319_10056454 | 182 |
| 37 | 3300028573 | Ga0265334_10000242 | Ga0265334_1000024215 | 182 |
| 38 | 3300028577 | Ga0265318_10000024 | Ga0265318_1000002490 | 182 |
| 39 | 3300028800 | Ga0265338_10033908 | Ga0265338_100339083 | 182 |
| 40 | 3300031235 | Ga0265330_10002684 | Ga0265330_100026847 | 182 |
| 41 | 3300031238 | Ga0265332_10014578 | Ga0265332_100145783 | 182 |
| 42 | 3300031239 | Ga0265328_10007268 | Ga0265328_100072683 | 182 |
| 43 | 3300031240 | Ga0265320_10008638 | Ga0265320_100086383 | 182 |
| 44 | 3300031241 | Ga0265325_10006476 | Ga0265325_100064765 | 182 |
| 45 | 3300031242 | Ga0265329_10000807 | Ga0265329_1000080714 | 182 |
| 46 | 3300031247 | Ga0265340_10012368 | Ga0265340_100123684 | 182 |
| 47 | 3300031249 | Ga0265339_10007816 | Ga0265339_100078164 | 182 |
| 48 | 3300031250 | Ga0265331_10005325 | Ga0265331_100053254 | 182 |
| 49 | 3300031595 | Ga0265313_10003524 | Ga0265313_100035247 | 182 |
| 50 | 3300031727 | Ga0316576_10008993 | Ga0316576_100089933 | 182 |
| 51 | 3300032139 | Ga0316580_10095074 | Ga0316580_100950742 | 182 |
| 52 | 3300042876 | Ga0451577_0000212 | Ga0451577_0000212_21618_22205 | 182 |
| 53 | 3300005536 | Ga0070697_100535664 | Ga0070697_1005356641 | 183 |
| 54 | 3300005544 | Ga0070686_100602796 | Ga0070686_1006027961 | 183 |
| 55 | 3300006846 | Ga0075430_100283390 | Ga0075430_1002833902 | 183 |
| 56 | 3300006847 | Ga0075431_100000858 | Ga0075431_10000085816 | 183 |
| 57 | 3300009094 | Ga0111539_10026091 | Ga0111539_100260912 | 183 |
| 58 | 3300026118 | Ga0207675_100858476 | Ga0207675_1008584762 | 183 |
| 59 | 3300027907 | Ga0207428_10012127 | Ga0207428_100121273 | 183 |
| 60 | 3300035118 | Ga0373954_0072697 | Ga0373954_0072697_549_1139 | 183 |
| 61 | 3300035241 | Ga0373961_0140530 | Ga0373961_0140530_190_780 | 183 |
| 62 | 3300035242 | Ga0373962_0090821 | Ga0373962_0090821_134_724 | 183 |
| 63 | 3300036401 | Ga0373937_0146600 | Ga0373937_0146600_1155_1745 | 183 |
| 64 | 3300037068 | Ga0373925_0826561 | Ga0373925_0826561_38_628 | 183 |
| 65 | 3300046516 | Ga0495628_0132824 | Ga0495628_0132824_221_811 | 183 |
| 66 | 3300046524 | Ga0495648_0131146 | Ga0495648_0131146_32_637 | 183 |
| 67 | 3300046678 | Ga0495599_0375446 | Ga0495599_0375446_73_663 | 183 |
| 68 | 3300049571 | Ga0501034_0137215 | Ga0501034_0137215_679_1269 | 183 |
| 69 | 3300049582 | Ga0501048_0672293 | Ga0501048_0672293_149_730 | 183 |
| 70 | 3300050496 | nmdc:mga07m45_148644_c1 | nmdc:mga07m45_148644_c1_746_1327 | 183 |
| 71 | 3300050511 | nmdc:mga08y16_29920_c1 | nmdc:mga08y16_29920_c1_583_1173 | 183 |
| 72 | 3300013104 | Ga0157370_10003211 | Ga0157370_1000321119 | 184 |
| 73 | 3300035691 | Ga0373931_0264685 | Ga0373931_0264685_260_937 | 184 |
| 74 | 3300039438 | Ga0436360_0608677 | Ga0436360_0608677_27_611 | 184 |
| 75 | iso_pu_bacteria | 2837678835 | 2837678914 | 184 |
| 76 | iso_pu_bacteria | 8054563764 | 8054568732 | 184 |
| 77 | 3300005618 | Ga0068864_100673073 | Ga0068864_1006730732 | 185 |
| 78 | 3300026095 | Ga0207676_10571858 | Ga0207676_105718582 | 185 |
| 79 | 3300046453 | Ga0495627_023956 | Ga0495627_023956_1061_1648 | 185 |
| 80 | 3300006852 | Ga0075433_10220634 | Ga0075433_102206342 | 186 |
| 81 | 3300013307 | Ga0157372_11544630 | Ga0157372_115446301 | 186 |
| 82 | 3300050515 | nmdc:mga0a205_126357_c1 | nmdc:mga0a205_126357_c1_718_1398 | 186 |
| 83 | 3300035691 | Ga0373931_0085098 | Ga0373931_0085098_569_1171 | 187 |
| 84 | 3300005335 | Ga0070666_10000210 | Ga0070666_1000021025 | 188 |
| 85 | 3300005336 | Ga0070680_100022779 | Ga0070680_1000227792 | 188 |
| 86 | 3300005336 | Ga0070680_100469778 | Ga0070680_1004697782 | 188 |
| 87 | 3300005339 | Ga0070660_100024950 | Ga0070660_1000249503 | 188 |
| 88 | 3300005344 | Ga0070661_100000582 | Ga0070661_10000058210 | 188 |
| 89 | 3300005366 | Ga0070659_100061751 | Ga0070659_1000617514 | 188 |
| 90 | 3300005435 | Ga0070714_100320356 | Ga0070714_1003203562 | 188 |
| 91 | 3300005435 | Ga0070714_100912710 | Ga0070714_1009127101 | 188 |
| 92 | 3300005436 | Ga0070713_100071312 | Ga0070713_1000713122 | 188 |
| 93 | 3300005436 | Ga0070713_100317582 | Ga0070713_1003175822 | 188 |
| 94 | 3300005441 | Ga0070700_100272864 | Ga0070700_1002728642 | 188 |
| 95 | 3300005458 | Ga0070681_10079213 | Ga0070681_100792133 | 188 |
| 96 | 3300005458 | Ga0070681_10090211 | Ga0070681_100902112 | 188 |
| 97 | 3300005458 | Ga0070681_10576859 | Ga0070681_105768591 | 188 |
| 98 | 3300005530 | Ga0070679_100003831 | Ga0070679_10000383115 | 188 |
| 99 | 3300005530 | Ga0070679_100302376 | Ga0070679_1003023762 | 188 |
| 100 | 3300005539 | Ga0068853_100387549 | Ga0068853_1003875492 | 188 |
| 101 | 3300005547 | Ga0070693_100458791 | Ga0070693_1004587911 | 188 |
| 102 | 3300005548 | Ga0070665_100369592 | Ga0070665_1003695921 | 188 |
| 103 | 3300005563 | Ga0068855_100123435 | Ga0068855_1001234352 | 188 |
| 104 | 3300005563 | Ga0068855_100169302 | Ga0068855_1001693022 | 188 |
| 105 | 3300005577 | Ga0068857_100091306 | Ga0068857_1000913061 | 188 |
| 106 | 3300005614 | Ga0068856_100000522 | Ga0068856_10000052220 | 188 |
| 107 | 3300005614 | Ga0068856_100130094 | Ga0068856_1001300942 | 188 |
| 108 | 3300005614 | Ga0068856_100393265 | Ga0068856_1003932652 | 188 |
| 109 | 3300005616 | Ga0068852_100069237 | Ga0068852_1000692372 | 188 |
| 110 | 3300005616 | Ga0068852_100466117 | Ga0068852_1004661172 | 188 |
| 111 | 3300006173 | Ga0070716_100302118 | Ga0070716_1003021182 | 188 |
| 112 | 3300006175 | Ga0070712_100316092 | Ga0070712_1003160922 | 188 |
| 113 | 3300006847 | Ga0075431_100008974 | Ga0075431_1000089742 | 188 |
| 114 | 3300006881 | Ga0068865_100482960 | Ga0068865_1004829602 | 188 |
| 115 | 3300007788 | Ga0099795_10016354 | Ga0099795_100163542 | 188 |
| 116 | 3300009093 | Ga0105240_10159953 | Ga0105240_101599533 | 188 |
| 117 | 3300009093 | Ga0105240_10309285 | Ga0105240_103092852 | 188 |
| 118 | 3300009093 | Ga0105240_10764847 | Ga0105240_107648472 | 188 |
| 119 | 3300009177 | Ga0105248_11725806 | Ga0105248_117258061 | 188 |
| 120 | 3300009545 | Ga0105237_10201296 | Ga0105237_102012961 | 188 |
| 121 | 3300009545 | Ga0105237_10274715 | Ga0105237_102747152 | 188 |
| 122 | 3300009545 | Ga0105237_10388505 | Ga0105237_103885052 | 188 |
| 123 | 3300009551 | Ga0105238_10848401 | Ga0105238_108484011 | 188 |
| 124 | 3300009553 | Ga0105249_10229596 | Ga0105249_102295962 | 188 |
| 125 | 3300013100 | Ga0157373_10306940 | Ga0157373_103069402 | 188 |
| 126 | 3300013102 | Ga0157371_10435177 | Ga0157371_104351772 | 188 |
| 127 | 3300013104 | Ga0157370_10026609 | Ga0157370_100266092 | 188 |
| 128 | 3300013104 | Ga0157370_10203548 | Ga0157370_102035482 | 188 |
| 129 | 3300013104 | Ga0157370_10209146 | Ga0157370_102091462 | 188 |
| 130 | 3300013104 | Ga0157370_10612062 | Ga0157370_106120621 | 188 |
| 131 | 3300013105 | Ga0157369_10014337 | Ga0157369_100143372 | 188 |
| 132 | 3300013105 | Ga0157369_10018323 | Ga0157369_100183232 | 188 |
| 133 | 3300013105 | Ga0157369_10061648 | Ga0157369_100616482 | 188 |
| 134 | 3300013105 | Ga0157369_10412526 | Ga0157369_104125262 | 188 |
| 135 | 3300013105 | Ga0157369_10919463 | Ga0157369_109194632 | 188 |
| 136 | 3300013296 | Ga0157374_10132066 | Ga0157374_101320662 | 188 |
| 137 | 3300013306 | Ga0163162_10153579 | Ga0163162_101535792 | 188 |
| 138 | 3300013307 | Ga0157372_10060527 | Ga0157372_100605272 | 188 |
| 139 | 3300013307 | Ga0157372_10080366 | Ga0157372_100803664 | 188 |
| 140 | 3300013307 | Ga0157372_10179804 | Ga0157372_101798044 | 188 |
| 141 | 3300014326 | Ga0157380_10045818 | Ga0157380_100458185 | 188 |
| 142 | 3300014497 | Ga0182008_10091792 | Ga0182008_100917922 | 188 |
| 143 | 3300014968 | Ga0157379_10011036 | Ga0157379_100110366 | 188 |
| 144 | 3300017792 | Ga0163161_10257803 | Ga0163161_102578031 | 188 |
| 145 | 3300020076 | Ga0206355_1529234 | Ga0206355_15292342 | 188 |
| 146 | 3300021384 | Ga0213876_10160791 | Ga0213876_101607912 | 188 |
| 147 | 3300022467 | Ga0224712_10089146 | Ga0224712_100891462 | 188 |
| 148 | 3300025903 | Ga0207680_10000318 | Ga0207680_1000031823 | 188 |
| 149 | 3300025904 | Ga0207647_10076848 | Ga0207647_100768482 | 188 |
| 150 | 3300025906 | Ga0207699_10041749 | Ga0207699_100417492 | 188 |
| 151 | 3300025912 | Ga0207707_10014668 | Ga0207707_100146684 | 188 |
| 152 | 3300025912 | Ga0207707_10077292 | Ga0207707_100772922 | 188 |
| 153 | 3300025912 | Ga0207707_10081496 | Ga0207707_100814964 | 188 |
| 154 | 3300025912 | Ga0207707_10241547 | Ga0207707_102415472 | 188 |
| 155 | 3300025913 | Ga0207695_10077314 | Ga0207695_100773145 | 188 |
| 156 | 3300025913 | Ga0207695_10166990 | Ga0207695_101669902 | 188 |
| 157 | 3300025913 | Ga0207695_10370602 | Ga0207695_103706021 | 188 |
| 158 | 3300025914 | Ga0207671_10270766 | Ga0207671_102707662 | 188 |
| 159 | 3300025914 | Ga0207671_10372587 | Ga0207671_103725871 | 188 |
| 160 | 3300025915 | Ga0207693_10012149 | Ga0207693_100121494 | 188 |
| 161 | 3300025915 | Ga0207693_10046205 | Ga0207693_100462052 | 188 |
| 162 | 3300025917 | Ga0207660_10260073 | Ga0207660_102600732 | 188 |
| 163 | 3300025919 | Ga0207657_10095173 | Ga0207657_100951733 | 188 |
| 164 | 3300025920 | Ga0207649_10000036 | Ga0207649_1000003632 | 188 |
| 165 | 3300025921 | Ga0207652_10048090 | Ga0207652_100480902 | 188 |
| 166 | 3300025921 | Ga0207652_10509323 | Ga0207652_105093232 | 188 |
| 167 | 3300025924 | Ga0207694_10023854 | Ga0207694_100238543 | 188 |
| 168 | 3300025924 | Ga0207694_10467016 | Ga0207694_104670161 | 188 |
| 169 | 3300025928 | Ga0207700_10012180 | Ga0207700_100121803 | 188 |
| 170 | 3300025928 | Ga0207700_10022784 | Ga0207700_100227842 | 188 |
| 171 | 3300025928 | Ga0207700_10091490 | Ga0207700_100914903 | 188 |
| 172 | 3300025929 | Ga0207664_10381599 | Ga0207664_103815992 | 188 |
| 173 | 3300025941 | Ga0207711_10253299 | Ga0207711_102532992 | 188 |
| 174 | 3300025944 | Ga0207661_10133363 | Ga0207661_101333632 | 188 |
| 175 | 3300025944 | Ga0207661_10393330 | Ga0207661_103933303 | 188 |
| 176 | 3300025949 | Ga0207667_10089982 | Ga0207667_100899822 | 188 |
| 177 | 3300025949 | Ga0207667_10507699 | Ga0207667_105076992 | 188 |
| 178 | 3300025949 | Ga0207667_10587014 | Ga0207667_105870142 | 188 |
| 179 | 3300025981 | Ga0207640_10091261 | Ga0207640_100912612 | 188 |
| 180 | 3300026041 | Ga0207639_10522071 | Ga0207639_105220712 | 188 |
| 181 | 3300026067 | Ga0207678_10309592 | Ga0207678_103095921 | 188 |
| 182 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014218 | 188 |
| 183 | 3300026116 | Ga0207674_10030475 | Ga0207674_100304754 | 188 |
| 184 | 3300026116 | Ga0207674_10324747 | Ga0207674_103247472 | 188 |
| 185 | 3300026116 | Ga0207674_11288899 | Ga0207674_112888991 | 188 |
| 186 | 3300026142 | Ga0207698_10052846 | Ga0207698_100528465 | 188 |
| 187 | 3300026142 | Ga0207698_10096453 | Ga0207698_100964532 | 188 |
| 188 | 3300028379 | Ga0268266_10099352 | Ga0268266_100993522 | 188 |
| 189 | 3300028379 | Ga0268266_10273283 | Ga0268266_102732833 | 188 |
| 190 | 3300028563 | Ga0265319_1070464 | Ga0265319_10704641 | 188 |
| 191 | 3300028800 | Ga0265338_10082115 | Ga0265338_100821153 | 188 |
| 192 | 3300030760 | Ga0265762_1037011 | Ga0265762_10370112 | 188 |
| 193 | 3300031090 | Ga0265760_10072497 | Ga0265760_100724972 | 188 |
| 194 | 3300031238 | Ga0265332_10041515 | Ga0265332_100415152 | 188 |
| 195 | 3300031240 | Ga0265320_10022856 | Ga0265320_100228563 | 188 |
| 196 | 3300031247 | Ga0265340_10004949 | Ga0265340_100049499 | 188 |
| 197 | 3300031249 | Ga0265339_10019827 | Ga0265339_100198273 | 188 |
| 198 | 3300031249 | Ga0265339_10059572 | Ga0265339_100595722 | 188 |
| 199 | 3300031711 | Ga0265314_10028433 | Ga0265314_100284332 | 188 |
| 200 | 3300031711 | Ga0265314_10030196 | Ga0265314_100301962 | 188 |
| 201 | 3300031712 | Ga0265342_10010141 | Ga0265342_100101413 | 188 |
| 202 | 3300031712 | Ga0265342_10012608 | Ga0265342_100126086 | 188 |
| 203 | 3300031815 | Ga0316045_117561 | Ga0316045_1175611 | 188 |
| 204 | 3300033547 | Ga0316212_1021453 | Ga0316212_10214532 | 188 |
| 205 | 3300035086 | Ga0373934_0057809 | Ga0373934_0057809_303_908 | 188 |
| 206 | 3300035111 | Ga0373923_0047470 | Ga0373923_0047470_1057_1662 | 188 |
| 207 | 3300035116 | Ga0373945_0309426 | Ga0373945_0309426_56_661 | 188 |
| 208 | 3300035118 | Ga0373954_0072677 | Ga0373954_0072677_718_1323 | 188 |
| 209 | 3300035170 | Ga0373943_0177257 | Ga0373943_0177257_281_886 | 188 |
| 210 | 3300035172 | Ga0373955_0306411 | Ga0373955_0306411_113_718 | 188 |
| 211 | 3300035724 | Ga0373933_0023643 | Ga0373933_0023643_2534_3139 | 188 |
| 212 | 3300035724 | Ga0373933_0093860 | Ga0373933_0093860_465_1070 | 188 |
| 213 | 3300035724 | Ga0373933_0157650 | Ga0373933_0157650_243_848 | 188 |
| 214 | 3300036401 | Ga0373937_0008874 | Ga0373937_0008874_7629_8234 | 188 |
| 215 | 3300036401 | Ga0373937_0012551 | Ga0373937_0012551_364_969 | 188 |
| 216 | 3300036401 | Ga0373937_0066253 | Ga0373937_0066253_1972_2577 | 188 |
| 217 | 3300037068 | Ga0373925_0169343 | Ga0373925_0169343_1089_1694 | 188 |
| 218 | 3300037068 | Ga0373925_0531226 | Ga0373925_0531226_153_758 | 188 |
| 219 | 3300037418 | Ga0395900_0041489 | Ga0395900_0041489_1700_2305 | 188 |
| 220 | 3300037466 | Ga0395898_0050370 | Ga0395898_0050370_1764_2369 | 188 |
| 221 | 3300037466 | Ga0395898_0130361 | Ga0395898_0130361_1543_2157 | 188 |
| 222 | 3300037466 | Ga0395898_0424249 | Ga0395898_0424249_275_880 | 188 |
| 223 | 3300038443 | Ga0395901_0270011 | Ga0395901_0270011_938_1552 | 188 |
| 224 | 3300038443 | Ga0395901_0436821 | Ga0395901_0436821_180_785 | 188 |
| 225 | 3300038742 | Ga0400486_25950 | Ga0400486_25950_3451_4056 | 188 |
| 226 | 3300039110 | Ga0400487_45699 | Ga0400487_45699_34_639 | 188 |
| 227 | 3300039437 | Ga0436365_0712452 | Ga0436365_0712452_2175_2780 | 188 |
| 228 | 3300039447 | Ga0436361_0638706 | Ga0436361_0638706_410_1015 | 188 |
| 229 | 3300039450 | Ga0436363_0556338 | Ga0436363_0556338_108_713 | 188 |
| 230 | 3300039453 | Ga0436362_0170569 | Ga0436362_0170569_548_1153 | 188 |
| 231 | 3300045051 | Ga0451576_0050890 | Ga0451576_0050890_1165_1770 | 188 |
| 232 | 3300045051 | Ga0451576_0340790 | Ga0451576_0340790_727_1332 | 188 |
| 233 | 3300045976 | Ga0466967_0043866 | Ga0466967_0043866_630_1235 | 188 |
| 234 | 3300045976 | Ga0466967_0238372 | Ga0466967_0238372_697_1302 | 188 |
| 235 | 3300046473 | Ga0495582_0170241 | Ga0495582_0170241_165_770 | 188 |
| 236 | 3300046516 | Ga0495628_0183720 | Ga0495628_0183720_766_1371 | 188 |
| 237 | 3300046517 | Ga0495630_0428336 | Ga0495630_0428336_370_975 | 188 |
| 238 | 3300046517 | Ga0495630_0575695 | Ga0495630_0575695_48_653 | 188 |
| 239 | 3300046529 | Ga0495652_0154176 | Ga0495652_0154176_426_1031 | 188 |
| 240 | 3300046533 | Ga0495640_0318911 | Ga0495640_0318911_262_867 | 188 |
| 241 | 3300046536 | Ga0495587_0146743 | Ga0495587_0146743_634_1239 | 188 |
| 242 | 3300046663 | Ga0495635_0268043 | Ga0495635_0268043_531_1136 | 188 |
| 243 | 3300046690 | Ga0495624_0449856 | Ga0495624_0449856_41_652 | 188 |
| 244 | 3300047315 | Ga0495581_0277487 | Ga0495581_0277487_236_841 | 188 |
| 245 | 3300047317 | Ga0495604_0410684 | Ga0495604_0410684_236_847 | 188 |
| 246 | 3300047317 | Ga0495604_0431334 | Ga0495604_0431334_70_675 | 188 |
| 247 | 3300047322 | Ga0495680_0280771 | Ga0495680_0280771_432_1037 | 188 |
| 248 | 3300047444 | Ga0495675_0153738 | Ga0495675_0153738_283_888 | 188 |
| 249 | 3300048918 | Ga0496115_0019339 | Ga0496115_0019339_2231_2836 | 188 |
| 250 | 3300048918 | Ga0496115_0086389 | Ga0496115_0086389_449_1054 | 188 |
| 251 | 3300048929 | Ga0496126_0000406 | Ga0496126_0000406_46338_46943 | 188 |
| 252 | 3300048929 | Ga0496126_0007049 | Ga0496126_0007049_149_754 | 188 |
| 253 | 3300048929 | Ga0496126_0129350 | Ga0496126_0129350_571_1176 | 188 |
| 254 | 3300048929 | Ga0496126_0138488 | Ga0496126_0138488_678_1283 | 188 |
| 255 | 3300048929 | Ga0496126_0274726 | Ga0496126_0274726_21_626 | 188 |
| 256 | 3300048929 | Ga0496126_0388045 | Ga0496126_0388045_314_919 | 188 |
| 257 | 3300049568 | Ga0501031_0113567 | Ga0501031_0113567_1087_1692 | 188 |
| 258 | 3300049568 | Ga0501031_0247837 | Ga0501031_0247837_38_643 | 188 |
| 259 | 3300049569 | Ga0501032_0051088 | Ga0501032_0051088_574_1179 | 188 |
| 260 | 3300049570 | Ga0501033_0051426 | Ga0501033_0051426_2188_2793 | 188 |
| 261 | 3300049570 | Ga0501033_0066735 | Ga0501033_0066735_1907_2512 | 188 |
| 262 | 3300049571 | Ga0501034_0000374 | Ga0501034_0000374_68739_69344 | 188 |
| 263 | 3300049571 | Ga0501034_0009431 | Ga0501034_0009431_2285_2890 | 188 |
| 264 | 3300049571 | Ga0501034_0041569 | Ga0501034_0041569_1756_2361 | 188 |
| 265 | 3300049571 | Ga0501034_0136934 | Ga0501034_0136934_289_894 | 188 |
| 266 | 3300049571 | Ga0501034_0335616 | Ga0501034_0335616_815_1420 | 188 |
| 267 | 3300049572 | Ga0501036_0001435 | Ga0501036_0001435_14595_15200 | 188 |
| 268 | 3300049572 | Ga0501036_0044095 | Ga0501036_0044095_1978_2583 | 188 |
| 269 | 3300049574 | Ga0501038_0023734 | Ga0501038_0023734_1105_1710 | 188 |
| 270 | 3300049574 | Ga0501038_0246512 | Ga0501038_0246512_550_1155 | 188 |
| 271 | 3300049574 | Ga0501038_0354477 | Ga0501038_0354477_497_1102 | 188 |
| 272 | 3300049575 | Ga0501039_0007451 | Ga0501039_0007451_3117_3722 | 188 |
| 273 | 3300049579 | Ga0501043_0002453 | Ga0501043_0002453_6164_6769 | 188 |
| 274 | 3300049579 | Ga0501043_0160371 | Ga0501043_0160371_1093_1698 | 188 |
| 275 | 3300049579 | Ga0501043_0412765 | Ga0501043_0412765_219_824 | 188 |
| 276 | 3300049580 | Ga0501046_0051089 | Ga0501046_0051089_775_1380 | 188 |
| 277 | 3300049581 | Ga0501047_0000234 | Ga0501047_0000234_746_1351 | 188 |
| 278 | 3300049581 | Ga0501047_0011934 | Ga0501047_0011934_4983_5588 | 188 |
| 279 | 3300049581 | Ga0501047_0023022 | Ga0501047_0023022_1727_2332 | 188 |
| 280 | 3300049581 | Ga0501047_0082351 | Ga0501047_0082351_2206_2811 | 188 |
| 281 | 3300049582 | Ga0501048_0000051 | Ga0501048_0000051_50255_50860 | 188 |
| 282 | 3300049585 | Ga0501069_0034537 | Ga0501069_0034537_813_1418 | 188 |
| 283 | 3300049586 | Ga0501070_0001845 | Ga0501070_0001845_3261_3866 | 188 |
| 284 | 3300049586 | Ga0501070_0068595 | Ga0501070_0068595_1975_2580 | 188 |
| 285 | 3300049586 | Ga0501070_0142819 | Ga0501070_0142819_748_1353 | 188 |
| 286 | 3300049588 | Ga0501072_0198332 | Ga0501072_0198332_597_1202 | 188 |
| 287 | 3300049589 | Ga0501073_0018322 | Ga0501073_0018322_3880_4485 | 188 |
| 288 | 3300049589 | Ga0501073_0030914 | Ga0501073_0030914_348_953 | 188 |
| 289 | 3300049589 | Ga0501073_0484370 | Ga0501073_0484370_205_810 | 188 |
| 290 | 3300049590 | Ga0501074_0036705 | Ga0501074_0036705_2511_3116 | 188 |
| 291 | 3300049592 | Ga0501076_0222847 | Ga0501076_0222847_913_1518 | 188 |
| 292 | 3300049592 | Ga0501076_0669307 | Ga0501076_0669307_135_740 | 188 |
| 293 | 3300049593 | Ga0501077_0216912 | Ga0501077_0216912_225_830 | 188 |
| 294 | 3300049741 | Ga0501079_0051628 | Ga0501079_0051628_1053_1658 | 188 |
| 295 | 3300049741 | Ga0501079_0332919 | Ga0501079_0332919_200_805 | 188 |
| 296 | 3300049741 | Ga0501079_0466112 | Ga0501079_0466112_167_772 | 188 |
| 297 | 3300049742 | Ga0501080_0000383 | Ga0501080_0000383_14225_14830 | 188 |
| 298 | 3300049742 | Ga0501080_0032801 | Ga0501080_0032801_1910_2515 | 188 |
| 299 | 3300049744 | Ga0501083_0356014 | Ga0501083_0356014_73_678 | 188 |
| 300 | 3300049744 | Ga0501083_0358200 | Ga0501083_0358200_253_858 | 188 |
| 301 | 3300049822 | Ga0501035_0049770 | Ga0501035_0049770_1494_2099 | 188 |
| 302 | 3300049823 | Ga0501044_0005993 | Ga0501044_0005993_5656_6261 | 188 |
| 303 | 3300049823 | Ga0501044_0053131 | Ga0501044_0053131_3227_3832 | 188 |
| 304 | 3300049823 | Ga0501044_0065692 | Ga0501044_0065692_1120_1725 | 188 |
| 305 | 3300049823 | Ga0501044_0076178 | Ga0501044_0076178_2187_2792 | 188 |
| 306 | 3300049823 | Ga0501044_0086296 | Ga0501044_0086296_276_881 | 188 |
| 307 | 3300053084 | Ga0495595_0237165 | Ga0495595_0237165_72_677 | 188 |
| 308 | 3300053150 | Ga0500603_077755 | Ga0500603_077755_308_913 | 188 |
| 309 | 3300054114 | Ga0501084_0000512 | Ga0501084_0000512_12685_13272 | 188 |
| 310 | 3300061734 | Ga0530510_0072370 | Ga0530510_0072370_1862_2467 | 188 |
| 311 | 3300061734 | Ga0530510_0329883 | Ga0530510_0329883_499_1104 | 188 |
| 312 | 3300009147 | Ga0114129_10505255 | Ga0114129_105052552 | 189 |
| 313 | 3300042156 | Ga0439446_0142206 | Ga0439446_0142206_131_739 | 189 |
| 314 | 3300050507 | nmdc:mga05p37_177785_c1 | nmdc:mga05p37_177785_c1_636_1241 | 189 |
| 315 | iso_pu_bacteria | 8056172158 | 8056173520 | 189 |
| 316 | 3300005331 | Ga0070670_100256582 | Ga0070670_1002565821 | 190 |
| 317 | 3300005340 | Ga0070689_100027470 | Ga0070689_1000274702 | 190 |
| 318 | 3300005353 | Ga0070669_100194816 | Ga0070669_1001948161 | 190 |
| 319 | 3300005364 | Ga0070673_100062317 | Ga0070673_1000623173 | 190 |
| 320 | 3300005546 | Ga0070696_101079598 | Ga0070696_1010795981 | 190 |
| 321 | 3300005617 | Ga0068859_100233362 | Ga0068859_1002333622 | 190 |
| 322 | 3300006237 | Ga0097621_100316007 | Ga0097621_1003160072 | 190 |
| 323 | 3300006931 | Ga0097620_100233351 | Ga0097620_1002333512 | 190 |
| 324 | 3300009093 | Ga0105240_10123291 | Ga0105240_101232913 | 190 |
| 325 | 3300009147 | Ga0114129_10065525 | Ga0114129_100655254 | 190 |
| 326 | 3300009148 | Ga0105243_10126213 | Ga0105243_101262132 | 190 |
| 327 | 3300014968 | Ga0157379_10266928 | Ga0157379_102669282 | 190 |
| 328 | 3300025901 | Ga0207688_10015305 | Ga0207688_100153055 | 190 |
| 329 | 3300025913 | Ga0207695_10221076 | Ga0207695_102210762 | 190 |
| 330 | 3300025935 | Ga0207709_10361063 | Ga0207709_103610632 | 190 |
| 331 | 3300025937 | Ga0207669_10011067 | Ga0207669_100110672 | 190 |
| 332 | 3300026035 | Ga0207703_10040606 | Ga0207703_100406062 | 190 |
| 333 | 3300026088 | Ga0207641_10063753 | Ga0207641_100637532 | 190 |
| 334 | 3300026118 | Ga0207675_100024271 | Ga0207675_1000242712 | 190 |
| 335 | 3300031239 | Ga0265328_10036071 | Ga0265328_100360712 | 190 |
| 336 | 3300031240 | Ga0265320_10086039 | Ga0265320_100860392 | 190 |
| 337 | 3300031242 | Ga0265329_10033083 | Ga0265329_100330832 | 190 |
| 338 | 3300031250 | Ga0265331_10005675 | Ga0265331_100056751 | 190 |
| 339 | 3300031711 | Ga0265314_10002039 | Ga0265314_1000203923 | 190 |
| 340 | 3300032126 | Ga0307415_100368680 | Ga0307415_1003686801 | 190 |
| 341 | 3300033180 | Ga0307510_10267875 | Ga0307510_102678752 | 190 |
| 342 | 3300035692 | Ga0373935_0037739 | Ga0373935_0037739_496_1143 | 190 |
| 343 | 3300035695 | Ga0373927_0488090 | Ga0373927_0488090_139_786 | 190 |
| 344 | 3300037853 | Ga0436364_0972465 | Ga0436364_0972465_4529_5140 | 190 |
| 345 | 3300049822 | Ga0501035_0076395 | Ga0501035_0076395_226_846 | 190 |
| 346 | 3300005331 | Ga0070670_100051744 | Ga0070670_1000517442 | 191 |
| 347 | 3300005339 | Ga0070660_100732446 | Ga0070660_1007324462 | 191 |
| 348 | 3300005353 | Ga0070669_100623269 | Ga0070669_1006232691 | 191 |
| 349 | 3300005354 | Ga0070675_100100537 | Ga0070675_1001005371 | 191 |
| 350 | 3300005563 | Ga0068855_100887579 | Ga0068855_1008875791 | 191 |
| 351 | 3300005564 | Ga0070664_100290462 | Ga0070664_1002904621 | 191 |
| 352 | 3300005617 | Ga0068859_100321747 | Ga0068859_1003217472 | 191 |
| 353 | 3300005844 | Ga0068862_100454045 | Ga0068862_1004540452 | 191 |
| 354 | 3300006931 | Ga0097620_100321738 | Ga0097620_1003217382 | 191 |
| 355 | 3300025923 | Ga0207681_10048651 | Ga0207681_100486513 | 191 |
| 356 | 3300025945 | Ga0207679_10092082 | Ga0207679_100920822 | 191 |
| 357 | 3300028380 | Ga0268265_10402822 | Ga0268265_104028222 | 191 |
| 358 | 3300038443 | Ga0395901_0255746 | Ga0395901_0255746_938_1630 | 191 |
| 359 | 3300039437 | Ga0436365_0197362 | Ga0436365_0197362_3064_3708 | 191 |
| 360 | 3300039447 | Ga0436361_0524149 | Ga0436361_0524149_1907_2521 | 191 |
| 361 | 3300049578 | Ga0501042_0014148 | Ga0501042_0014148_1840_2454 | 191 |
| 362 | 3300049582 | Ga0501048_0286460 | Ga0501048_0286460_32_646 | 191 |
| 363 | 3300049592 | Ga0501076_0160063 | Ga0501076_0160063_1075_1689 | 191 |
| 364 | 3300049823 | Ga0501044_0183687 | Ga0501044_0183687_1067_1759 | 191 |
| 365 | 3300049824 | Ga0501045_0243629 | Ga0501045_0243629_610_1224 | 191 |
| 366 | 3300005563 | Ga0068855_100287912 | Ga0068855_1002879122 | 192 |
| 367 | 3300009093 | Ga0105240_10233952 | Ga0105240_102339522 | 192 |
| 368 | 3300014968 | Ga0157379_10076995 | Ga0157379_100769953 | 192 |
| 369 | 3300025290 | Ga0207673_1000811 | Ga0207673_10008112 | 192 |
| 370 | 3300025913 | Ga0207695_10502989 | Ga0207695_105029892 | 192 |
| 371 | 3300025949 | Ga0207667_10327015 | Ga0207667_103270153 | 192 |
| 372 | 3300041405 | Ga0439438_002468 | Ga0439438_002468_6592_7236 | 193 |
| 373 | 3300041407 | Ga0439447_002751 | Ga0439447_002751_1299_1943 | 193 |
| 374 | 3300041411 | Ga0439466_0012459 | Ga0439466_0012459_1954_2598 | 193 |
| 375 | 3300042010 | Ga0439452_003688 | Ga0439452_003688_479_1123 | 193 |
| 376 | 3300046518 | Ga0495631_0037460 | Ga0495631_0037460_271_915 | 193 |
| 377 | 3300053153 | Ga0500616_0000541 | Ga0500616_0000541_29591_30211 | 193 |
| 378 | 3300005330 | Ga0070690_100164253 | Ga0070690_1001642532 | 194 |
| 379 | 3300005333 | Ga0070677_10015247 | Ga0070677_100152473 | 194 |
| 380 | 3300005333 | Ga0070677_10101605 | Ga0070677_101016052 | 194 |
| 381 | 3300005334 | Ga0068869_100371679 | Ga0068869_1003716792 | 194 |
| 382 | 3300005335 | Ga0070666_10018215 | Ga0070666_100182154 | 194 |
| 383 | 3300005354 | Ga0070675_100084339 | Ga0070675_1000843392 | 194 |
| 384 | 3300005355 | Ga0070671_100223733 | Ga0070671_1002237332 | 194 |
| 385 | 3300005364 | Ga0070673_100037625 | Ga0070673_1000376252 | 194 |
| 386 | 3300005441 | Ga0070700_100040182 | Ga0070700_1000401821 | 194 |
| 387 | 3300005456 | Ga0070678_100160356 | Ga0070678_1001603562 | 194 |
| 388 | 3300005457 | Ga0070662_100442635 | Ga0070662_1004426352 | 194 |
| 389 | 3300005459 | Ga0068867_100191189 | Ga0068867_1001911892 | 194 |
| 390 | 3300005543 | Ga0070672_100029815 | Ga0070672_1000298154 | 194 |
| 391 | 3300005543 | Ga0070672_100178316 | Ga0070672_1001783162 | 194 |
| 392 | 3300005544 | Ga0070686_100184851 | Ga0070686_1001848512 | 194 |
| 393 | 3300005548 | Ga0070665_100147560 | Ga0070665_1001475602 | 194 |
| 394 | 3300005577 | Ga0068857_100448668 | Ga0068857_1004486682 | 194 |
| 395 | 3300005616 | Ga0068852_101111772 | Ga0068852_1011117721 | 194 |
| 396 | 3300005618 | Ga0068864_100154841 | Ga0068864_1001548412 | 194 |
| 397 | 3300005719 | Ga0068861_100834066 | Ga0068861_1008340662 | 194 |
| 398 | 3300005842 | Ga0068858_100311324 | Ga0068858_1003113242 | 194 |
| 399 | 3300005937 | Ga0081455_10020970 | Ga0081455_100209705 | 194 |
| 400 | 3300005937 | Ga0081455_10577011 | Ga0081455_105770112 | 194 |
| 401 | 3300005985 | Ga0081539_10001781 | Ga0081539_1000178111 | 194 |
| 402 | 3300005985 | Ga0081539_10230982 | Ga0081539_102309821 | 194 |
| 403 | 3300006038 | Ga0075365_10411625 | Ga0075365_104116252 | 194 |
| 404 | 3300006177 | Ga0075362_10142092 | Ga0075362_101420922 | 194 |
| 405 | 3300006237 | Ga0097621_100077322 | Ga0097621_1000773222 | 194 |
| 406 | 3300006358 | Ga0068871_100190287 | Ga0068871_1001902872 | 194 |
| 407 | 3300006844 | Ga0075428_100624626 | Ga0075428_1006246262 | 194 |
| 408 | 3300006914 | Ga0075436_100618192 | Ga0075436_1006181921 | 194 |
| 409 | 3300009098 | Ga0105245_10561765 | Ga0105245_105617651 | 194 |
| 410 | 3300009177 | Ga0105248_10272001 | Ga0105248_102720012 | 194 |
| 411 | 3300013296 | Ga0157374_10248049 | Ga0157374_102480492 | 194 |
| 412 | 3300013308 | Ga0157375_10029144 | Ga0157375_100291442 | 194 |
| 413 | 3300013308 | Ga0157375_10039658 | Ga0157375_100396582 | 194 |
| 414 | 3300014325 | Ga0163163_10313989 | Ga0163163_103139892 | 194 |
| 415 | 3300014497 | Ga0182008_10000171 | Ga0182008_1000017134 | 194 |
| 416 | 3300025893 | Ga0207682_10015551 | Ga0207682_100155514 | 194 |
| 417 | 3300025901 | Ga0207688_10531688 | Ga0207688_105316881 | 194 |
| 418 | 3300025907 | Ga0207645_10278454 | Ga0207645_102784542 | 194 |
| 419 | 3300025918 | Ga0207662_10062967 | Ga0207662_100629672 | 194 |
| 420 | 3300025923 | Ga0207681_10378476 | Ga0207681_103784762 | 194 |
| 421 | 3300025925 | Ga0207650_10021483 | Ga0207650_100214834 | 194 |
| 422 | 3300025925 | Ga0207650_10195200 | Ga0207650_101952002 | 194 |
| 423 | 3300025926 | Ga0207659_10048971 | Ga0207659_100489712 | 194 |
| 424 | 3300025940 | Ga0207691_10135303 | Ga0207691_101353033 | 194 |
| 425 | 3300025940 | Ga0207691_10147738 | Ga0207691_101477383 | 194 |
| 426 | 3300025942 | Ga0207689_10062348 | Ga0207689_100623482 | 194 |
| 427 | 3300026075 | Ga0207708_10046860 | Ga0207708_100468602 | 194 |
| 428 | 3300026088 | Ga0207641_10118280 | Ga0207641_101182802 | 194 |
| 429 | 3300026089 | Ga0207648_10040461 | Ga0207648_100404612 | 194 |
| 430 | 3300026095 | Ga0207676_10012081 | Ga0207676_100120813 | 194 |
| 431 | 3300026095 | Ga0207676_10769914 | Ga0207676_107699141 | 194 |
| 432 | 3300026121 | Ga0207683_10501860 | Ga0207683_105018602 | 194 |
| 433 | 3300028380 | Ga0268265_10043021 | Ga0268265_100430211 | 194 |
| 434 | 3300028380 | Ga0268265_11339332 | Ga0268265_113393321 | 194 |
| 435 | 3300028786 | Ga0307517_10108323 | Ga0307517_101083232 | 194 |
| 436 | 3300028794 | Ga0307515_10050694 | Ga0307515_100506942 | 194 |
| 437 | 3300031456 | Ga0307513_10013624 | Ga0307513_100136248 | 194 |
| 438 | 3300031507 | Ga0307509_10071030 | Ga0307509_100710303 | 194 |
| 439 | 3300031616 | Ga0307508_10000358 | Ga0307508_1000035829 | 194 |
| 440 | 3300033180 | Ga0307510_10202843 | Ga0307510_102028432 | 194 |
| 441 | 3300037853 | Ga0436364_0208031 | Ga0436364_0208031_483_1106 | 194 |
| 442 | 3300046472 | Ga0495580_0126543 | Ga0495580_0126543_690_1367 | 194 |
| 443 | 3300046474 | Ga0495605_0066281 | Ga0495605_0066281_846_1469 | 194 |
| 444 | 3300046519 | Ga0495632_0002900 | Ga0495632_0002900_5992_6615 | 194 |
| 445 | 3300046660 | Ga0495625_0145458 | Ga0495625_0145458_82_705 | 194 |
| 446 | 3300046683 | Ga0495658_0031792 | Ga0495658_0031792_1849_2472 | 194 |
| 447 | 3300046694 | Ga0495649_0003265 | Ga0495649_0003265_6008_6631 | 194 |
| 448 | 3300047443 | Ga0495687_001187 | Ga0495687_001187_6996_7619 | 194 |
| 449 | 3300048091 | Ga0495626_0117695 | Ga0495626_0117695_159_782 | 194 |
| 450 | 3300048912 | Ga0496109_0598560 | Ga0496109_0598560_120_743 | 194 |
| 451 | 3300049574 | Ga0501038_0651623 | Ga0501038_0651623_101_724 | 194 |
| 452 | 3300050492 | nmdc:mga0yw44_359981_c1 | nmdc:mga0yw44_359981_c1_132_755 | 194 |
| 453 | 3300050492 | nmdc:mga0yw44_553354_c1 | nmdc:mga0yw44_553354_c1_55_678 | 194 |
| 454 | 3300050511 | nmdc:mga08y16_61504_c1 | nmdc:mga08y16_61504_c1_1190_1813 | 194 |
| 455 | 3300053093 | Ga0500651_0119881 | Ga0500651_0119881_221_850 | 194 |
| 456 | 3300054114 | Ga0501084_0520305 | Ga0501084_0520305_318_941 | 194 |
| 457 | iso_pu_bacteria | 2524023250 | 2524610018 | 194 |
| 458 | 3300005338 | Ga0068868_100263827 | Ga0068868_1002638272 | 195 |
| 459 | 3300005719 | Ga0068861_100189384 | Ga0068861_1001893841 | 195 |
| 460 | 3300005985 | Ga0081539_10004863 | Ga0081539_1000486312 | 195 |
| 461 | 3300006186 | Ga0075369_10003345 | Ga0075369_100033454 | 195 |
| 462 | 3300006358 | Ga0068871_100296292 | Ga0068871_1002962922 | 195 |
| 463 | 3300009176 | Ga0105242_10065378 | Ga0105242_100653781 | 195 |
| 464 | 3300009545 | Ga0105237_10000304 | Ga0105237_1000030454 | 195 |
| 465 | 3300025315 | Ga0207697_10083223 | Ga0207697_100832231 | 195 |
| 466 | 3300025914 | Ga0207671_10001956 | Ga0207671_1000195614 | 195 |
| 467 | 3300026023 | Ga0207677_10133911 | Ga0207677_101339112 | 195 |
| 468 | 3300030522 | Ga0307512_10031923 | Ga0307512_100319233 | 195 |
| 469 | 3300042876 | Ga0451577_0060680 | Ga0451577_0060680_615_1265 | 195 |
| 470 | 3300042876 | Ga0451577_0216096 | Ga0451577_0216096_1004_1654 | 195 |
| 471 | 3300044712 | Ga0453684_0274560 | Ga0453684_0274560_1112_1762 | 195 |
| 472 | 3300050511 | nmdc:mga08y16_79260_c1 | nmdc:mga08y16_79260_c1_2532_3161 | 195 |
| 473 | 3300050516 | nmdc:mga0sz30_9199_c1 | nmdc:mga0sz30_9199_c1_1841_2467 | 195 |
| 474 | 3300053093 | Ga0500651_0107846 | Ga0500651_0107846_393_1019 | 195 |
| 475 | 3300005355 | Ga0070671_100327818 | Ga0070671_1003278182 | 196 |
| 476 | 3300005434 | Ga0070709_10083677 | Ga0070709_100836772 | 196 |
| 477 | 3300005435 | Ga0070714_100051314 | Ga0070714_1000513143 | 196 |
| 478 | 3300005435 | Ga0070714_100602747 | Ga0070714_1006027471 | 196 |
| 479 | 3300005436 | Ga0070713_100039903 | Ga0070713_1000399033 | 196 |
| 480 | 3300005437 | Ga0070710_10398714 | Ga0070710_103987142 | 196 |
| 481 | 3300005439 | Ga0070711_100111609 | Ga0070711_1001116091 | 196 |
| 482 | 3300005458 | Ga0070681_10128651 | Ga0070681_101286512 | 196 |
| 483 | 3300005458 | Ga0070681_10208936 | Ga0070681_102089362 | 196 |
| 484 | 3300005564 | Ga0070664_100208071 | Ga0070664_1002080711 | 196 |
| 485 | 3300005614 | Ga0068856_100193534 | Ga0068856_1001935342 | 196 |
| 486 | 3300005844 | Ga0068862_100041570 | Ga0068862_1000415704 | 196 |
| 487 | 3300006028 | Ga0070717_10809040 | Ga0070717_108090402 | 196 |
| 488 | 3300006177 | Ga0075362_10005496 | Ga0075362_100054964 | 196 |
| 489 | 3300006914 | Ga0075436_100101722 | Ga0075436_1001017222 | 196 |
| 490 | 3300007788 | Ga0099795_10006310 | Ga0099795_100063103 | 196 |
| 491 | 3300007788 | Ga0099795_10034401 | Ga0099795_100344012 | 196 |
| 492 | 3300009093 | Ga0105240_10523932 | Ga0105240_105239322 | 196 |
| 493 | 3300009545 | Ga0105237_11404928 | Ga0105237_114049281 | 196 |
| 494 | 3300010159 | Ga0099796_10026910 | Ga0099796_100269102 | 196 |
| 495 | 3300013104 | Ga0157370_10385956 | Ga0157370_103859562 | 196 |
| 496 | 3300013306 | Ga0163162_10119742 | Ga0163162_101197422 | 196 |
| 497 | 3300021384 | Ga0213876_10060261 | Ga0213876_100602612 | 196 |
| 498 | 3300021388 | Ga0213875_10000863 | Ga0213875_1000086315 | 196 |
| 499 | 3300021388 | Ga0213875_10005044 | Ga0213875_100050442 | 196 |
| 500 | 3300025898 | Ga0207692_10412431 | Ga0207692_104124311 | 196 |
| 501 | 3300025916 | Ga0207663_10299579 | Ga0207663_102995792 | 196 |
| 502 | 3300025928 | Ga0207700_10087330 | Ga0207700_100873302 | 196 |
| 503 | 3300025928 | Ga0207700_10147626 | Ga0207700_101476262 | 196 |
| 504 | 3300025928 | Ga0207700_10261100 | Ga0207700_102611002 | 196 |
| 505 | 3300025929 | Ga0207664_10128770 | Ga0207664_101287702 | 196 |
| 506 | 3300026078 | Ga0207702_10136553 | Ga0207702_101365532 | 196 |
| 507 | 3300028380 | Ga0268265_10029583 | Ga0268265_100295832 | 196 |
| 508 | 3300032002 | Ga0307416_100438232 | Ga0307416_1004382322 | 196 |
| 509 | 3300035089 | Ga0373944_0089018 | Ga0373944_0089018_238_870 | 196 |
| 510 | 3300035116 | Ga0373945_0032316 | Ga0373945_0032316_959_1591 | 196 |
| 511 | 3300035170 | Ga0373943_0126819 | Ga0373943_0126819_84_716 | 196 |
| 512 | 3300035691 | Ga0373931_0063931 | Ga0373931_0063931_361_993 | 196 |
| 513 | 3300035725 | Ga0373947_0160997 | Ga0373947_0160997_168_800 | 196 |
| 514 | 3300037853 | Ga0436364_0607465 | Ga0436364_0607465_29273_29902 | 196 |
| 515 | 3300037853 | Ga0436364_0992577 | Ga0436364_0992577_46314_46943 | 196 |
| 516 | 3300037853 | Ga0436364_1529531 | Ga0436364_1529531_842_1471 | 196 |
| 517 | 3300039437 | Ga0436365_0709051 | Ga0436365_0709051_8744_9373 | 196 |
| 518 | 3300039437 | Ga0436365_1592530 | Ga0436365_1592530_139_771 | 196 |
| 519 | 3300039437 | Ga0436365_1744068 | Ga0436365_1744068_21_653 | 196 |
| 520 | 3300039437 | Ga0436365_1792009 | Ga0436365_1792009_865_1494 | 196 |
| 521 | 3300039438 | Ga0436360_1045365 | Ga0436360_1045365_28_660 | 196 |
| 522 | 3300039438 | Ga0436360_1199485 | Ga0436360_1199485_281_910 | 196 |
| 523 | 3300039447 | Ga0436361_0238240 | Ga0436361_0238240_1104_1733 | 196 |
| 524 | 3300045976 | Ga0466967_0136191 | Ga0466967_0136191_316_948 | 196 |
| 525 | 3300046472 | Ga0495580_0153360 | Ga0495580_0153360_215_847 | 196 |
| 526 | 3300048907 | Ga0496104_0052190 | Ga0496104_0052190_42_674 | 196 |
| 527 | 3300048915 | Ga0496112_0430021 | Ga0496112_0430021_187_819 | 196 |
| 528 | 3300048916 | Ga0496113_0069705 | Ga0496113_0069705_1793_2425 | 196 |
| 529 | 3300050511 | nmdc:mga08y16_403739_c1 | nmdc:mga08y16_403739_c1_323_955 | 196 |
| 530 | 3300050514 | nmdc:mga08x19_99056_c1 | nmdc:mga08x19_99056_c1_986_1618 | 196 |
| 531 | 3300053139 | Ga0500568_0010673 | Ga0500568_0010673_2423_3070 | 196 |
| 532 | 3300044694 | Ga0466963_0512272 | Ga0466963_0512272_98_694 | 198 |
| 533 | 3300005983 | Ga0081540_1009776 | Ga0081540_10097769 | 199 |
| 534 | 3300005329 | Ga0070683_100289579 | Ga0070683_1002895791 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h5j-assembly1.cif.gz_A | leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9729 | 1 | 170 |
| 3h5j-assembly1.cif.gz_A | leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9673 | 1 | 170 |
| 3h5e-assembly2.cif.gz_B | leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9538 | 4 | 157 |
| 3h5e-assembly2.cif.gz_B | leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.9477 | 4 | 157 |
| 3q3w-assembly1.cif.gz_A | isopropylmalate isomerase small subunit from campylobacter jejuni. | 0.9278 | 1 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9729 | 1 | 170 | 3.20.19.10 |
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9673 | 1 | 170 | 3.20.19.10 |
| af_O14289_535_712_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9287 | 1 | 173 | 3.20.19.10 |
| 3q3wA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9238 | 1 | 171 | 3.20.19.10 |
| af_Q2FWK0_1_171_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.9104 | 3 | 170 | 3.20.19.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K2L3S6-F1-model_v4 | 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) | 0.9892 | 9 | 126 |
GO:0003861
GO:0009098 GO:0009316 |
| AF-A0A7G3D6B9-F1-model_v4 | deleted | 0.9847 | 1 | 146 |
|
| AF-X7Z4V8-F1-model_v4 | 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) | 0.9817 | 13 | 131 |
GO:0003861
GO:0009098 GO:0009316 |
| AF-A0A1B6AWJ5-F1-model_v4 | 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) | 0.9816 | 1 | 146 |
GO:0003861
GO:0009098 GO:0009316 |
| AF-A0A3C1YAF1-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9799 | 1 | 138 |
GO:0003861
GO:0009098 GO:0009316 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar