F460550

General Info

Members Datasets Scaffolds Average Seq Length
534 273 534 98

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10939459|Ga0307411_109394591
Length 116
Sequence MSESEHPIRRNRDHEVTVDDVRQLMGASTPHFALQIRNRIARLIKGLPAGHPARVEGEREIARLTRLGYSGEVRGIEAEEGLPPLRSVEAPHPAGVGEGHPRVAAAGRPCARSRGR

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
73 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
153 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
154 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
155 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 13.3
Rhizosphere 81.09
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10046620 3300003659 Bacteria 913
2 Ga0070658_10616283 3300005327 Bacteria 941
3 Ga0070683_101895639 3300005329 Bacteria 573
4 Ga0070690_100345412 3300005330 Bacteria 1079
5 Ga0070670_101006402 3300005331 Bacteria 758
6 Ga0070682_100077108 3300005337 Bacteria 2147
7 Ga0070682_100660106 3300005337 Bacteria 834
8 Ga0070682_101717580 3300005337 Bacteria 546
9 Ga0068868_100041722 3300005338 Bacteria 3576
10 Ga0068868_100133026 3300005338 Bacteria 2037
11 Ga0070660_100535146 3300005339 Bacteria 976
12 Ga0070689_100273323 3300005340 Bacteria 1400
13 Ga0070689_101571699 3300005340 Bacteria 597
14 Ga0070691_10487038 3300005341 Bacteria 710
15 Ga0070661_100737040 3300005344 Bacteria 805
16 Ga0070661_100944618 3300005344 Bacteria 713
17 Ga0070692_10038857 3300005345 Bacteria 2428
18 Ga0070668_100005261 3300005347 Bacteria 9601
19 Ga0070675_100645666 3300005354 Bacteria 962
20 Ga0070674_100810670 3300005356 Bacteria 809
21 Ga0070673_102072852 3300005364 Bacteria 540
22 Ga0070659_100730798 3300005366 Bacteria 858
23 Ga0070714_100000315 3300005435 Bacteria 36636
24 Ga0070714_100494589 3300005435 Unclassified 1166
25 Ga0070714_100650783 3300005435 Unclassified 1014
26 Ga0070714_100673808 3300005435 Unclassified 997
27 Ga0070714_100974311 3300005435 Bacteria 825
28 Ga0070714_101535441 3300005435 Unclassified 650
29 Ga0070713_100132513 3300005436 Unclassified 2199
30 Ga0070713_100132573 3300005436 Bacteria 2199
31 Ga0070713_100491406 3300005436 Bacteria 1157
32 Ga0070713_100599364 3300005436 Bacteria 1046
33 Ga0070713_100632060 3300005436 Bacteria 1019
34 Ga0070713_102157103 3300005436 Bacteria 540
35 Ga0070710_10010026 3300005437 Bacteria 4645
36 Ga0070710_10148957 3300005437 Bacteria 1442
37 Ga0070710_11033918 3300005437 Bacteria 600
38 Ga0070701_10457122 3300005438 Bacteria 821
39 Ga0070711_100014052 3300005439 Bacteria 5037
40 Ga0070711_100189549 3300005439 Bacteria 1579
41 Ga0070711_100244675 3300005439 Bacteria 1404
42 Ga0070705_101469000 3300005440 Bacteria 570
43 Ga0070700_100135600 3300005441 Bacteria 1666
44 Ga0070694_100412260 3300005444 Bacteria 1060
45 Ga0070663_100115398 3300005455 Bacteria 2023
46 Ga0070663_100672623 3300005455 Bacteria 877
47 Ga0070663_101112500 3300005455 Bacteria 691
48 Ga0068867_100218209 3300005459 Bacteria 1535
49 Ga0070685_10097997 3300005466 Bacteria 1786
50 Ga0070684_100750752 3300005535 Bacteria 911
51 Ga0070672_100814893 3300005543 Bacteria 822
52 Ga0070695_101594213 3300005545 Bacteria 545
53 Ga0070693_100485286 3300005547 Bacteria 874
54 Ga0070665_100000608 3300005548 Bacteria 49343
55 Ga0070704_101412246 3300005549 Bacteria 639
56 Ga0070664_100093820 3300005564 Bacteria 2601
57 Ga0068857_100740328 3300005577 Bacteria 936
58 Ga0068854_100214300 3300005578 Bacteria 1520
59 Ga0068854_100577384 3300005578 Bacteria 957
60 Ga0068856_100114789 3300005614 Bacteria 2692
61 Ga0068856_100141096 3300005614 Bacteria 2417
62 Ga0068856_100340626 3300005614 Bacteria 1518
63 Ga0068856_102296750 3300005614 Bacteria 548
64 Ga0070702_100014883 3300005615 Bacteria 3959
65 Ga0070702_101109526 3300005615 Bacteria 632
66 Ga0068852_100674433 3300005616 Bacteria 1043
67 Ga0068852_102036742 3300005616 Unclassified 596
68 Ga0068859_100282130 3300005617 Bacteria 1754
69 Ga0068864_100507929 3300005618 Bacteria 1161
70 Ga0068864_101699453 3300005618 Unclassified 636
71 Ga0068866_10055523 3300005718 Bacteria 2034
72 Ga0068861_100058341 3300005719 Bacteria 2951
73 Ga0068861_100914728 3300005719 Bacteria 832
74 Ga0068863_100548138 3300005841 Bacteria 1142
75 Ga0068858_100061612 3300005842 Bacteria 3468
76 Ga0068858_101134348 3300005842 Bacteria 768
77 Ga0068858_102340635 3300005842 Bacteria 528
78 Ga0068860_100518155 3300005843 Bacteria 1192
79 Ga0068860_101795037 3300005843 Bacteria 635
80 Ga0068862_100097500 3300005844 Bacteria 2567
81 Ga0081455_10445471 3300005937 Bacteria 886
82 Ga0081540_1002546 3300005983 Bacteria 14792
83 Ga0081539_10007029 3300005985 Bacteria 10434
84 Ga0070717_10011586 3300006028 Bacteria 6702
85 Ga0070717_10179315 3300006028 Bacteria 1845
86 Ga0070717_10326240 3300006028 Unclassified 1368
87 Ga0070717_10447745 3300006028 Bacteria 1164
88 Ga0070717_10681812 3300006028 Unclassified 933
89 Ga0070717_10775223 3300006028 Bacteria 872
90 Ga0075363_100340252 3300006048 Bacteria 875
91 Ga0070716_100146638 3300006173 Bacteria 1513
92 Ga0070716_100540932 3300006173 Unclassified 866
93 Ga0070712_100208315 3300006175 Unclassified 1540
94 Ga0070712_100569907 3300006175 Bacteria 956
95 Ga0070712_100967534 3300006175 Unclassified 736
96 Ga0068871_102329148 3300006358 Bacteria 511
97 Ga0075431_100749358 3300006847 Bacteria 952
98 Ga0075429_100032547 3300006880 Bacteria 4532
99 Ga0068865_100043877 3300006881 Bacteria 3057
100 Ga0068865_100921921 3300006881 Bacteria 761
101 Ga0097620_100282126 3300006931 Bacteria 1754
102 Ga0105240_10025096 3300009093 Bacteria 7843
103 Ga0105240_11184187 3300009093 Bacteria 810
104 Ga0105240_11430844 3300009093 Bacteria 726
105 Ga0111539_10193928 3300009094 Bacteria 2370
106 Ga0105245_10089818 3300009098 Bacteria 2825
107 Ga0105245_10093908 3300009098 Bacteria 2764
108 Ga0105245_10200195 3300009098 Bacteria 1917
109 Ga0105245_10823088 3300009098 Bacteria 967
110 Ga0105247_10218659 3300009101 Bacteria 1288
111 Ga0105247_11586043 3300009101 Bacteria 537
112 Ga0114129_11826138 3300009147 Bacteria 739
113 Ga0105243_10391745 3300009148 Bacteria 1288
114 Ga0105243_10404534 3300009148 Bacteria 1269
115 Ga0105242_10032371 3300009176 Bacteria 4181
116 Ga0105242_10820652 3300009176 Bacteria 922
117 Ga0105242_12312501 3300009176 Bacteria 584
118 Ga0105248_12138886 3300009177 Unclassified 636
119 Ga0105248_12674692 3300009177 Bacteria 569
120 Ga0105238_10285483 3300009551 Bacteria 1632
121 Ga0105238_10365004 3300009551 Bacteria 1434
122 Ga0105238_12522509 3300009551 Bacteria 550
123 Ga0105249_10185790 3300009553 Bacteria 2025
124 Ga0105249_10256245 3300009553 Bacteria 1736
125 Ga0105249_10452318 3300009553 Bacteria 1323
126 Ga0105249_12451333 3300009553 Bacteria 594
127 Ga0105249_13546777 3300009553 Bacteria 503
128 Ga0105239_10304265 3300010375 Bacteria 1796
129 Ga0105239_10748975 3300010375 Bacteria 1118
130 Ga0157321_1016475 3300012487 Bacteria 635
131 Ga0157343_1016857 3300012488 Bacteria 624
132 Ga0157371_10809860 3300013102 Bacteria 706
133 Ga0157370_11058342 3300013104 Bacteria 734
134 Ga0157369_11507778 3300013105 Bacteria 684
135 Ga0157374_11099105 3300013296 Bacteria 815
136 Ga0157378_10667559 3300013297 Bacteria 1056
137 Ga0157378_11675470 3300013297 Bacteria 683
138 Ga0157378_11884227 3300013297 Bacteria 647
139 Ga0163162_10474454 3300013306 Bacteria 1382
140 Ga0163162_10665995 3300013306 Bacteria 1164
141 Ga0157372_10233221 3300013307 Bacteria 2134
142 Ga0157372_10428798 3300013307 Bacteria 1541
143 Ga0157372_10894673 3300013307 Bacteria 1030
144 Ga0157372_11060895 3300013307 Bacteria 938
145 Ga0157372_11134515 3300013307 Bacteria 904
146 Ga0157375_10164994 3300013308 Bacteria 2359
147 Ga0157375_10799135 3300013308 Bacteria 1092
148 Ga0157375_11714040 3300013308 Bacteria 744
149 Ga0163163_10209479 3300014325 Bacteria 1998
150 Ga0163163_10440315 3300014325 Bacteria 1363
151 Ga0163163_11418129 3300014325 Bacteria 756
152 Ga0157380_10155234 3300014326 Bacteria 1983
153 Ga0182008_10278168 3300014497 Bacteria 870
154 Ga0157377_10142248 3300014745 Bacteria 1475
155 Ga0157377_10274418 3300014745 Bacteria 1102
156 Ga0157377_10571752 3300014745 Unclassified 802
157 Ga0157379_10886916 3300014968 Bacteria 845
158 Ga0157379_11077533 3300014968 Bacteria 769
159 Ga0157379_11380994 3300014968 Bacteria 682
160 Ga0157376_10789525 3300014969 Bacteria 961
161 Ga0206351_10987354 3300020077 Unclassified 573
162 Ga0206354_10759756 3300020081 Bacteria 1593
163 Ga0206353_11884886 3300020082 Bacteria 732
164 Ga0213873_10008381 3300021358 Bacteria 2109
165 Ga0213873_10124045 3300021358 Bacteria 760
166 Ga0213874_10000485 3300021377 Bacteria 7990
167 Ga0213874_10282781 3300021377 Bacteria 620
168 Ga0213876_10008089 3300021384 Bacteria 5700
169 Ga0213876_10078412 3300021384 Bacteria 1745
170 Ga0213876_10193809 3300021384 Bacteria 1080
171 Ga0213876_10323794 3300021384 Bacteria 819
172 Ga0213875_10015010 3300021388 Bacteria 3773
173 Ga0213875_10438299 3300021388 Bacteria 625
174 Ga0224712_10358651 3300022467 Unclassified 690
175 Ga0207656_10069807 3300025321 Bacteria 1559
176 Ga0207692_10118676 3300025898 Bacteria 1478
177 Ga0207692_10396023 3300025898 Unclassified 860
178 Ga0207642_10062516 3300025899 Bacteria 1737
179 Ga0207710_10148272 3300025900 Bacteria 1136
180 Ga0207685_10529530 3300025905 Unclassified 624
181 Ga0207699_10180856 3300025906 Unclassified 1417
182 Ga0207645_10562857 3300025907 Bacteria 773
183 Ga0207705_10208791 3300025909 Bacteria 1481
184 Ga0207707_10896537 3300025912 Bacteria 733
185 Ga0207695_10016571 3300025913 Bacteria 8617
186 Ga0207695_10820506 3300025913 Bacteria 810
187 Ga0207693_10003276 3300025915 Bacteria 13865
188 Ga0207693_10073271 3300025915 Unclassified 2681
189 Ga0207693_10135697 3300025915 Bacteria 1935
190 Ga0207693_10810511 3300025915 Bacteria 721
191 Ga0207693_10861021 3300025915 Bacteria 697
192 Ga0207663_10237967 3300025916 Bacteria 1334
193 Ga0207663_10514822 3300025916 Unclassified 931
194 Ga0207662_10595002 3300025918 Bacteria 769
195 Ga0207657_10677442 3300025919 Bacteria 802
196 Ga0207657_10919127 3300025919 Bacteria 674
197 Ga0207652_10681678 3300025921 Bacteria 918
198 Ga0207681_10180959 3300025923 Bacteria 1606
199 Ga0207694_10106216 3300025924 Bacteria 2230
200 Ga0207659_10322213 3300025926 Bacteria 1275
201 Ga0207659_10857445 3300025926 Bacteria 781
202 Ga0207687_10132530 3300025927 Bacteria 1881
203 Ga0207687_10633007 3300025927 Bacteria 904
204 Ga0207687_11142406 3300025927 Bacteria 669
205 Ga0207700_10627135 3300025928 Unclassified 958
206 Ga0207700_10751584 3300025928 Bacteria 871
207 Ga0207700_10858729 3300025928 Bacteria 812
208 Ga0207700_11517890 3300025928 Bacteria 594
209 Ga0207700_11862825 3300025928 Bacteria 528
210 Ga0207664_10091272 3300025929 Bacteria 2498
211 Ga0207664_10094461 3300025929 Bacteria 2458
212 Ga0207664_10257723 3300025929 Bacteria 1524
213 Ga0207664_10689277 3300025929 Bacteria 919
214 Ga0207664_10833135 3300025929 Bacteria 829
215 Ga0207664_11507025 3300025929 Bacteria 594
216 Ga0207644_10270782 3300025931 Bacteria 1361
217 Ga0207690_10075932 3300025932 Bacteria 2332
218 Ga0207706_10173595 3300025933 Bacteria 1894
219 Ga0207686_11291262 3300025934 Bacteria 599
220 Ga0207709_10579844 3300025935 Bacteria 886
221 Ga0207670_10155383 3300025936 Bacteria 1702
222 Ga0207669_10702153 3300025937 Bacteria 831
223 Ga0207704_10394854 3300025938 Bacteria 1090
224 Ga0207665_10094897 3300025939 Bacteria 2072
225 Ga0207665_10106385 3300025939 Bacteria 1966
226 Ga0207665_10305172 3300025939 Unclassified 1191
227 Ga0207691_10332220 3300025940 Bacteria 1302
228 Ga0207711_11721373 3300025941 Bacteria 570
229 Ga0207689_10005969 3300025942 Bacteria 10774
230 Ga0207661_10150903 3300025944 Bacteria 2009
231 Ga0207661_10198911 3300025944 Bacteria 1761
232 Ga0207661_11319574 3300025944 Bacteria 663
233 Ga0207679_10044732 3300025945 Bacteria 3197
234 Ga0207679_10290417 3300025945 Bacteria 1406
235 Ga0207679_10504827 3300025945 Bacteria 1080
236 Ga0207667_10544622 3300025949 Bacteria 1174
237 Ga0207651_11455122 3300025960 Bacteria 617
238 Ga0207712_10085247 3300025961 Bacteria 2311
239 Ga0207712_10153793 3300025961 Bacteria 1779
240 Ga0207668_10944225 3300025972 Bacteria 769
241 Ga0207640_10294208 3300025981 Bacteria 1281
242 Ga0207640_10636655 3300025981 Bacteria 907
243 Ga0207640_11673559 3300025981 Bacteria 574
244 Ga0207677_10209278 3300026023 Bacteria 1556
245 Ga0207677_10546292 3300026023 Bacteria 1009
246 Ga0207677_10718081 3300026023 Bacteria 888
247 Ga0207703_10054234 3300026035 Bacteria 3259
248 Ga0207639_10354056 3300026041 Bacteria 1312
249 Ga0207678_10159292 3300026067 Bacteria 1928
250 Ga0207678_10584015 3300026067 Bacteria 979
251 Ga0207678_10615264 3300026067 Bacteria 953
252 Ga0207708_10103648 3300026075 Bacteria 2204
253 Ga0207702_10210484 3300026078 Bacteria 1807
254 Ga0207702_10221586 3300026078 Bacteria 1763
255 Ga0207702_10406588 3300026078 Bacteria 1314
256 Ga0207641_11349573 3300026088 Bacteria 714
257 Ga0207648_10255491 3300026089 Bacteria 1563
258 Ga0207676_10392140 3300026095 Bacteria 1295
259 Ga0207674_10515905 3300026116 Bacteria 1154
260 Ga0207675_100058914 3300026118 Bacteria 3584
261 Ga0207675_100232924 3300026118 Bacteria 1777
262 Ga0207675_100918410 3300026118 Bacteria 892
263 Ga0207683_10087091 3300026121 Bacteria 2777
264 Ga0207698_10126833 3300026142 Bacteria 2172
265 Ga0207698_11991480 3300026142 Bacteria 595
266 Ga0268266_11032445 3300028379 Bacteria 795
267 Ga0268265_10187238 3300028380 Bacteria 1784
268 Ga0268264_12165751 3300028381 Bacteria 564
269 Ga0265337_1002017 3300028556 Bacteria 9640
270 Ga0265326_10000360 3300028558 Bacteria 19131
271 Ga0265319_1002401 3300028563 Bacteria 10283
272 Ga0265334_10248550 3300028573 Bacteria 612
273 Ga0265318_10012809 3300028577 Bacteria 3557
274 Ga0265336_10000001 3300028666 Bacteria 916179
275 Ga0265338_10000228 3300028800 Bacteria 104553
276 Ga0265338_10552190 3300028800 Unclassified 806
277 Ga0265324_10010308 3300029957 Bacteria 3610
278 Ga0265340_10000005 3300031247 Bacteria 204570
279 Ga0265339_10081256 3300031249 Bacteria 1713
280 Ga0265316_10726217 3300031344 Bacteria 699
281 Ga0265342_10019136 3300031712 Bacteria 4418
282 Ga0307405_11837054 3300031731 Unclassified 539
283 Ga0307413_11535518 3300031824 Bacteria 590
284 Ga0307406_10978111 3300031901 Bacteria 725
285 Ga0307412_11150506 3300031911 Bacteria 693
286 Ga0307409_101585297 3300031995 Bacteria 683
287 Ga0307409_101792989 3300031995 Bacteria 643
288 Ga0307416_100218719 3300032002 Bacteria 1825
289 Ga0307416_100602038 3300032002 Bacteria 1179
290 Ga0307416_100612377 3300032002 Unclassified 1170
291 Ga0307416_103496763 3300032002 Bacteria 526
292 Ga0307414_10967388 3300032004 Bacteria 783
293 Ga0307411_10939459 3300032005 Bacteria 771
294 Ga0307415_100206519 3300032126 Unclassified 1563
295 Ga0307415_100628954 3300032126 Bacteria 959
296 Ga0307415_100954919 3300032126 Bacteria 794
297 Ga0373954_0019812 3300035118 Bacteria 3037
298 Ga0373956_0037907 3300035119 Unclassified 2132
299 Ga0373943_0027436 3300035170 Bacteria 2676
300 Ga0373946_0258760 3300035171 Bacteria 851
301 Ga0373955_0676176 3300035172 Unclassified 633
302 Ga0373924_0010948 3300035410 Bacteria 3358
303 Ga0373931_0687929 3300035691 Bacteria 675
304 Ga0373933_0036190 3300035724 Bacteria 2888
305 Ga0373947_0125154 3300035725 Bacteria 1636
306 Ga0373937_0017146 3300036401 Bacteria 6445
307 Ga0373937_1367769 3300036401 Bacteria 656
308 Ga0373925_0324832 3300037068 Unclassified 1246
309 Ga0436364_0021731 3300037853 Bacteria 3506
310 Ga0436364_0272422 3300037853 Bacteria 1097
311 Ga0436364_0716277 3300037853 Bacteria 4116
312 Ga0436364_1246106 3300037853 Bacteria 4584
313 Ga0436364_1425427 3300037853 Unclassified 634
314 Ga0436364_1462632 3300037853 Bacteria 860
315 Ga0395901_0451985 3300038443 Bacteria 1314
316 Ga0436365_0021944 3300039437 Bacteria 5144
317 Ga0436365_0127362 3300039437 Bacteria 979
318 Ga0436365_0210228 3300039437 Bacteria 1457
319 Ga0436365_0262453 3300039437 Bacteria 28030
320 Ga0436365_0636327 3300039437 Bacteria 3078
321 Ga0436365_0805820 3300039437 Bacteria 1835
322 Ga0436365_1334540 3300039437 Unclassified 502
323 Ga0436365_1503119 3300039437 Bacteria 5294
324 Ga0436365_1614521 3300039437 Bacteria 2052
325 Ga0436361_0592023 3300039447 Unclassified 2335
326 Ga0436361_0857302 3300039447 Bacteria 899
327 Ga0436361_1122369 3300039447 Unclassified 737
328 Ga0436363_0182915 3300039450 Bacteria 1486
329 Ga0436363_0298435 3300039450 Bacteria 576
330 Ga0436363_0678117 3300039450 Bacteria 33768
331 Ga0436363_0776211 3300039450 Bacteria 3250
332 Ga0436363_0831273 3300039450 Bacteria 1576
333 Ga0436362_0038053 3300039453 Bacteria 3242
334 Ga0436362_0417090 3300039453 Bacteria 1845
335 Ga0451793_1648871 3300041452 Bacteria 703
336 Ga0466965_0811644 3300044683 Unclassified 542
337 Ga0466966_0750968 3300044684 Unclassified 588
338 Ga0466961_0001786 3300044693 Bacteria 13319
339 Ga0466961_0104002 3300044693 Unclassified 1788
340 Ga0466963_0007310 3300044694 Bacteria 6586
341 Ga0466963_0009843 3300044694 Bacteria 5769
342 Ga0466963_0126582 3300044694 Bacteria 1761
343 Ga0466963_0266732 3300044694 Bacteria 1203
344 Ga0466963_0456882 3300044694 Unclassified 901
345 Ga0466963_0910211 3300044694 Bacteria 620
346 Ga0466964_0054521 3300044706 Bacteria 1648
347 Ga0466964_0284046 3300044706 Bacteria 828
348 Ga0466971_0022922 3300044719 Bacteria 2783
349 Ga0466971_0024791 3300044719 Bacteria 2677
350 Ga0466971_0195228 3300044719 Bacteria 954
351 Ga0466971_0653601 3300044719 Unclassified 527
352 Ga0466968_0169779 3300044735 Bacteria 1010
353 Ga0466968_0170594 3300044735 Bacteria 1008
354 Ga0466968_0223583 3300044735 Bacteria 887
355 Ga0466968_0342001 3300044735 Unclassified 726
356 Ga0466968_0515188 3300044735 Unclassified 597
357 Ga0466970_0102109 3300044765 Bacteria 1562
358 Ga0466970_0170890 3300044765 Bacteria 1205
359 Ga0466957_0014845 3300044842 Bacteria 4541
360 Ga0466957_0383676 3300044842 Bacteria 959
361 Ga0466957_0446525 3300044842 Bacteria 891
362 Ga0466957_0591223 3300044842 Bacteria 776
363 Ga0466960_0116061 3300044901 Bacteria 1397
364 Ga0466960_0488253 3300044901 Bacteria 720
365 Ga0466959_0005361 3300045049 Bacteria 8779
366 Ga0466959_0014324 3300045049 Bacteria 5756
367 Ga0466959_0033567 3300045049 Bacteria 3795
368 Ga0466959_0045864 3300045049 Bacteria 3218
369 Ga0466959_0087868 3300045049 Bacteria 2235
370 Ga0466959_0320791 3300045049 Bacteria 1059
371 Ga0466959_0577647 3300045049 Bacteria 757
372 Ga0466959_0593531 3300045049 Bacteria 745
373 Ga0466959_0705016 3300045049 Bacteria 676
374 Ga0466959_0943083 3300045049 Bacteria 575
375 Ga0466959_1142336 3300045049 Bacteria 518
376 Ga0466958_0000261 3300045836 Bacteria 20448
377 Ga0466958_0009591 3300045836 Bacteria 5398
378 Ga0466958_0025299 3300045836 Bacteria 3499
379 Ga0466958_0039126 3300045836 Bacteria 2848
380 Ga0466958_0047139 3300045836 Bacteria 2602
381 Ga0466958_0123084 3300045836 Bacteria 1625
382 Ga0466958_0611396 3300045836 Bacteria 709
383 Ga0466958_0816720 3300045836 Bacteria 608
384 Ga0466958_1176520 3300045836 Bacteria 501
385 Ga0466967_0001282 3300045976 Bacteria 14293
386 Ga0466967_0002486 3300045976 Bacteria 11505
387 Ga0466967_0005377 3300045976 Bacteria 8863
388 Ga0466967_0223949 3300045976 Bacteria 1789
389 Ga0466967_0338121 3300045976 Bacteria 1455
390 Ga0466967_0369590 3300045976 Bacteria 1391
391 Ga0466967_0819291 3300045976 Bacteria 924
392 Ga0466967_2395441 3300045976 Bacteria 523
393 Ga0495592_0027796 3300046454 Bacteria 4285
394 Ga0495603_0279410 3300046455 Bacteria 960
395 Ga0495590_0153265 3300046457 Bacteria 836
396 Ga0495629_0170945 3300046459 Bacteria 1508
397 Ga0495641_0058565 3300046461 Bacteria 1743
398 Ga0495651_0001413 3300046462 Bacteria 18648
399 Ga0495653_0005685 3300046463 Bacteria 10186
400 Ga0495664_0734123 3300046477 Bacteria 583
401 Ga0495664_0842313 3300046477 Bacteria 538
402 Ga0495594_0214463 3300046499 Bacteria 1098
403 Ga0495608_0003483 3300046511 Bacteria 11273
404 Ga0495608_0853069 3300046511 Bacteria 535
405 Ga0495628_0125849 3300046516 Bacteria 1963
406 Ga0495628_0592296 3300046516 Bacteria 793
407 Ga0495628_1122886 3300046516 Bacteria 536
408 Ga0495630_0532280 3300046517 Unclassified 901
409 Ga0495663_0058207 3300046525 Bacteria 1211
410 Ga0495642_0541133 3300046528 Bacteria 516
411 Ga0495652_0045491 3300046529 Bacteria 3772
412 Ga0495640_0006746 3300046533 Bacteria 9060
413 Ga0495587_0041876 3300046536 Bacteria 2732
414 Ga0495609_0118608 3300046538 Bacteria 1139
415 Ga0495597_0148558 3300046542 Bacteria 963
416 Ga0495645_0007716 3300046543 Bacteria 7487
417 Ga0495645_0245881 3300046543 Bacteria 1191
418 Ga0495667_0003251 3300046559 Bacteria 10886
419 Ga0495668_0665581 3300046616 Bacteria 576
420 Ga0495634_0321633 3300046642 Unclassified 931
421 Ga0495635_0074943 3300046663 Bacteria 2318
422 Ga0495635_1105449 3300046663 Unclassified 501
423 Ga0495657_0039487 3300046675 Bacteria 3242
424 Ga0495599_0064012 3300046678 Unclassified 2297
425 Ga0495599_0639551 3300046678 Unclassified 617
426 Ga0495623_0066748 3300046679 Bacteria 2247
427 Ga0495658_0441443 3300046683 Bacteria 831
428 Ga0495658_0945335 3300046683 Unclassified 551
429 Ga0495613_0139436 3300046689 Bacteria 1733
430 Ga0495613_0771274 3300046689 Bacteria 629
431 Ga0495671_0375779 3300046692 Bacteria 681
432 Ga0495600_0002543 3300046809 Bacteria 10500
433 Ga0495604_0002449 3300047317 Bacteria 14842
434 Ga0495604_0003422 3300047317 Bacteria 12654
435 Ga0495674_0009390 3300047319 Bacteria 9296
436 Ga0495674_0082511 3300047319 Bacteria 2756
437 Ga0495674_0384697 3300047319 Bacteria 1135
438 Ga0495674_1491047 3300047319 Bacteria 501
439 Ga0495680_0003728 3300047322 Bacteria 14844
440 Ga0495685_218407 3300047447 Bacteria 609
441 Ga0495684_0513892 3300047471 Bacteria 821
442 Ga0495684_0789280 3300047471 Unclassified 621
443 Ga0495593_0092548 3300047673 Bacteria 1556
444 Ga0495602_0011071 3300048088 Bacteria 9340
445 Ga0495602_0612797 3300048088 Bacteria 747
446 Ga0496100_0068246 3300048903 Bacteria 2364
447 Ga0496100_0305914 3300048903 Bacteria 1191
448 Ga0496100_0460861 3300048903 Bacteria 975
449 Ga0496100_0747979 3300048903 Bacteria 764
450 Ga0496101_0169680 3300048904 Bacteria 1677
451 Ga0496101_0242144 3300048904 Bacteria 1404
452 Ga0496101_0304675 3300048904 Bacteria 1248
453 Ga0496102_0053018 3300048905 Bacteria 3697
454 Ga0496102_0118548 3300048905 Bacteria 2470
455 Ga0496102_0360687 3300048905 Bacteria 1368
456 Ga0496103_0197220 3300048906 Bacteria 1294
457 Ga0496103_0242301 3300048906 Bacteria 1160
458 Ga0496104_0027785 3300048907 Bacteria 5237
459 Ga0496104_0075301 3300048907 Bacteria 3214
460 Ga0496104_0078929 3300048907 Bacteria 3137
461 Ga0496104_0128447 3300048907 Bacteria 2434
462 Ga0496104_0829480 3300048907 Bacteria 830
463 Ga0496105_0061225 3300048908 Bacteria 3106
464 Ga0496105_0099953 3300048908 Bacteria 2396
465 Ga0496105_0108280 3300048908 Bacteria 2294
466 Ga0496105_0292683 3300048908 Bacteria 1311
467 Ga0496106_0042130 3300048909 Bacteria 3423
468 Ga0496106_0073580 3300048909 Bacteria 2614
469 Ga0496106_0095526 3300048909 Bacteria 2299
470 Ga0496106_0271647 3300048909 Bacteria 1357
471 Ga0496106_0650273 3300048909 Bacteria 842
472 Ga0496106_1492551 3300048909 Bacteria 520
473 Ga0496107_0082914 3300048910 Bacteria 2338
474 Ga0496107_0322545 3300048910 Bacteria 1149
475 Ga0496107_0325298 3300048910 Bacteria 1144
476 Ga0496108_0000880 3300048911 Bacteria 23404
477 Ga0496108_0128448 3300048911 Bacteria 2177
478 Ga0496108_0142587 3300048911 Bacteria 2064
479 Ga0496108_0912669 3300048911 Bacteria 753
480 Ga0496109_0021596 3300048912 Bacteria 5694
481 Ga0496109_0045735 3300048912 Bacteria 3973
482 Ga0496109_0114360 3300048912 Bacteria 2510
483 Ga0496109_0251405 3300048912 Bacteria 1665
484 Ga0496109_0759363 3300048912 Bacteria 907
485 Ga0496109_1283600 3300048912 Bacteria 668
486 Ga0496109_1940611 3300048912 Bacteria 521
487 Ga0496109_2039270 3300048912 Bacteria 505
488 Ga0496110_0073222 3300048913 Bacteria 3040
489 Ga0496110_0077309 3300048913 Bacteria 2961
490 Ga0496110_0142549 3300048913 Bacteria 2166
491 Ga0496110_0556190 3300048913 Bacteria 1042
492 Ga0496110_1620965 3300048913 Bacteria 557
493 Ga0496111_0014656 3300048914 Bacteria 5360
494 Ga0496111_0096264 3300048914 Bacteria 2172
495 Ga0496111_0108036 3300048914 Bacteria 2049
496 Ga0496111_0144057 3300048914 Bacteria 1766
497 Ga0496111_0278156 3300048914 Bacteria 1241
498 Ga0496112_0008981 3300048915 Bacteria 8974
499 Ga0496112_0108859 3300048915 Bacteria 2741
500 Ga0496112_0128989 3300048915 Bacteria 2500
501 Ga0496112_0143607 3300048915 Bacteria 2355
502 Ga0496112_0319691 3300048915 Bacteria 1496
503 Ga0496112_0499884 3300048915 Bacteria 1151
504 Ga0496113_0023040 3300048916 Bacteria 4412
505 Ga0496113_0071501 3300048916 Bacteria 2638
506 Ga0496113_0104175 3300048916 Bacteria 2201
507 Ga0496113_0456135 3300048916 Bacteria 1027
508 Ga0496113_1047163 3300048916 Unclassified 641
509 Ga0496114_0042759 3300048917 Bacteria 3756
510 Ga0496114_0055365 3300048917 Bacteria 3308
511 Ga0496114_0386408 3300048917 Bacteria 1239
512 Ga0496115_0093282 3300048918 Bacteria 2462
513 Ga0496115_0120214 3300048918 Bacteria 2161
514 Ga0496115_0291850 3300048918 Bacteria 1338
515 Ga0496115_0718379 3300048918 Bacteria 784
516 Ga0501042_0980899 3300049578 Bacteria 616
517 Ga0501069_0084396 3300049585 Bacteria 1792
518 Ga0501070_0240280 3300049586 Bacteria 1483
519 Ga0501045_0938894 3300049824 Bacteria 635
520 nmdc:mga03n38_509531_c1 3300050490 Bacteria 676
521 nmdc:mga09592_32938_c1 3300050508 Bacteria 4322
522 nmdc:mga06r32_376754_c1 3300050510 Bacteria 1402
523 nmdc:mga08y16_1286377_c1 3300050511 Bacteria 699
524 nmdc:mga0n895_1554227_c1 3300050512 Bacteria 627
525 nmdc:mga0n895_686859_c1 3300050512 Bacteria 1020
526 Ga0495601_1043038 3300053077 Bacteria 513
527 Ga0495612_0025865 3300053078 Bacteria 2358
528 Ga0495612_0530725 3300053078 Bacteria 541
529 Ga0495595_0095606 3300053084 Unclassified 1429
530 Ga0495619_0006527 3300053085 Bacteria 7385
531 Ga0501084_0841736 3300054114 Bacteria 772
532 Ga0466962_0001652 3300061719 Bacteria 10465
533 Ga0466962_0096161 3300061719 Bacteria 1420
534 Ga0530510_1172218 3300061734 Bacteria 589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100737040 Ga0070661_1007370402 87
2 3300005436 Ga0070713_100491406 Ga0070713_1004914062 88
3 3300025928 Ga0207700_10751584 Ga0207700_107515842 88
4 3300048088 Ga0495602_0612797 Ga0495602_0612797_214_507 88
5 3300046683 Ga0495658_0441443 Ga0495658_0441443_355_636 91
6 3300005345 Ga0070692_10038857 Ga0070692_100388572 92
7 3300005435 Ga0070714_100000315 Ga0070714_10000031540 92
8 3300005435 Ga0070714_100673808 Ga0070714_1006738082 92
9 3300005440 Ga0070705_101469000 Ga0070705_1014690001 92
10 3300006173 Ga0070716_100146638 Ga0070716_1001466382 92
11 3300013102 Ga0157371_10809860 Ga0157371_108098602 92
12 3300013297 Ga0157378_10667559 Ga0157378_106675592 92
13 3300014745 Ga0157377_10274418 Ga0157377_102744182 92
14 3300014745 Ga0157377_10571752 Ga0157377_105717522 92
15 3300025913 Ga0207695_10016571 Ga0207695_100165715 92
16 3300025915 Ga0207693_10073271 Ga0207693_100732713 92
17 3300025939 Ga0207665_10094897 Ga0207665_100948972 92
18 3300005338 Ga0068868_100133026 Ga0068868_1001330262 93
19 3300005340 Ga0070689_101571699 Ga0070689_1015716992 93
20 3300005344 Ga0070661_100944618 Ga0070661_1009446181 93
21 3300005578 Ga0068854_100577384 Ga0068854_1005773842 93
22 3300005614 Ga0068856_100114789 Ga0068856_1001147892 93
23 3300005614 Ga0068856_102296750 Ga0068856_1022967502 93
24 3300005937 Ga0081455_10445471 Ga0081455_104454712 93
25 3300006880 Ga0075429_100032547 Ga0075429_1000325472 93
26 3300009093 Ga0105240_10025096 Ga0105240_100250967 93
27 3300009101 Ga0105247_11586043 Ga0105247_115860431 93
28 3300009551 Ga0105238_10365004 Ga0105238_103650042 93
29 3300012487 Ga0157321_1016475 Ga0157321_10164752 93
30 3300013307 Ga0157372_10428798 Ga0157372_104287982 93
31 3300013308 Ga0157375_11714040 Ga0157375_117140402 93
32 3300014968 Ga0157379_11077533 Ga0157379_110775332 93
33 3300025945 Ga0207679_10504827 Ga0207679_105048272 93
34 3300025981 Ga0207640_10636655 Ga0207640_106366552 93
35 3300026023 Ga0207677_10718081 Ga0207677_107180811 93
36 3300031731 Ga0307405_11837054 Ga0307405_118370542 93
37 3300032002 Ga0307416_100612377 Ga0307416_1006123772 93
38 3300032126 Ga0307415_100206519 Ga0307415_1002065192 93
39 3300045049 Ga0466959_0593531 Ga0466959_0593531_100_384 93
40 3300045049 Ga0466959_1142336 Ga0466959_1142336_187_468 93
41 3300045836 Ga0466958_1176520 Ga0466958_1176520_144_425 93
42 3300045976 Ga0466967_0001282 Ga0466967_0001282_467_748 93
43 3300046525 Ga0495663_0058207 Ga0495663_0058207_783_1064 93
44 3300046528 Ga0495642_0541133 Ga0495642_0541133_223_504 93
45 3300046538 Ga0495609_0118608 Ga0495609_0118608_166_447 93
46 3300046542 Ga0495597_0148558 Ga0495597_0148558_589_870 93
47 3300046616 Ga0495668_0665581 Ga0495668_0665581_120_401 93
48 3300046692 Ga0495671_0375779 Ga0495671_0375779_138_419 93
49 3300048903 Ga0496100_0068246 Ga0496100_0068246_967_1248 93
50 3300048904 Ga0496101_0242144 Ga0496101_0242144_65_346 93
51 3300048905 Ga0496102_0053018 Ga0496102_0053018_2344_2625 93
52 3300048906 Ga0496103_0242301 Ga0496103_0242301_269_550 93
53 3300048907 Ga0496104_0128447 Ga0496104_0128447_1087_1368 93
54 3300048908 Ga0496105_0108280 Ga0496105_0108280_928_1209 93
55 3300048909 Ga0496106_0073580 Ga0496106_0073580_2151_2432 93
56 3300048910 Ga0496107_0325298 Ga0496107_0325298_510_791 93
57 3300048911 Ga0496108_0000880 Ga0496108_0000880_7247_7528 93
58 3300048912 Ga0496109_0021596 Ga0496109_0021596_2970_3251 93
59 3300048913 Ga0496110_0556190 Ga0496110_0556190_287_568 93
60 3300048914 Ga0496111_0014656 Ga0496111_0014656_4348_4629 93
61 3300048915 Ga0496112_0319691 Ga0496112_0319691_147_428 93
62 3300048916 Ga0496113_0104175 Ga0496113_0104175_801_1082 93
63 3300048917 Ga0496114_0386408 Ga0496114_0386408_533_814 93
64 3300048918 Ga0496115_0093282 Ga0496115_0093282_341_622 93
65 3300049585 Ga0501069_0084396 Ga0501069_0084396_598_879 93
66 3300050508 nmdc:mga09592_32938_c1 nmdc:mga09592_32938_c1_3375_3656 93
67 3300005435 Ga0070714_100494589 Ga0070714_1004945891 94
68 3300005435 Ga0070714_100650783 Ga0070714_1006507832 94
69 3300005435 Ga0070714_100974311 Ga0070714_1009743112 94
70 3300005435 Ga0070714_101535441 Ga0070714_1015354412 94
71 3300005436 Ga0070713_100132513 Ga0070713_1001325131 94
72 3300005436 Ga0070713_100599364 Ga0070713_1005993642 94
73 3300005436 Ga0070713_100632060 Ga0070713_1006320602 94
74 3300005437 Ga0070710_10010026 Ga0070710_100100264 94
75 3300005439 Ga0070711_100014052 Ga0070711_1000140522 94
76 3300005439 Ga0070711_100189549 Ga0070711_1001895492 94
77 3300006028 Ga0070717_10447745 Ga0070717_104477452 94
78 3300006028 Ga0070717_10681812 Ga0070717_106818122 94
79 3300006173 Ga0070716_100540932 Ga0070716_1005409322 94
80 3300006175 Ga0070712_100208315 Ga0070712_1002083151 94
81 3300006175 Ga0070712_100569907 Ga0070712_1005699072 94
82 3300009093 Ga0105240_11430844 Ga0105240_114308442 94
83 3300021358 Ga0213873_10008381 Ga0213873_100083813 94
84 3300021377 Ga0213874_10282781 Ga0213874_102827812 94
85 3300021384 Ga0213876_10008089 Ga0213876_100080898 94
86 3300021384 Ga0213876_10078412 Ga0213876_100784122 94
87 3300021384 Ga0213876_10323794 Ga0213876_103237941 94
88 3300021388 Ga0213875_10015010 Ga0213875_100150103 94
89 3300021388 Ga0213875_10438299 Ga0213875_104382992 94
90 3300025898 Ga0207692_10396023 Ga0207692_103960232 94
91 3300025905 Ga0207685_10529530 Ga0207685_105295302 94
92 3300025906 Ga0207699_10180856 Ga0207699_101808562 94
93 3300025915 Ga0207693_10003276 Ga0207693_1000327611 94
94 3300025915 Ga0207693_10810511 Ga0207693_108105112 94
95 3300025915 Ga0207693_10861021 Ga0207693_108610212 94
96 3300025916 Ga0207663_10237967 Ga0207663_102379672 94
97 3300025916 Ga0207663_10514822 Ga0207663_105148222 94
98 3300025924 Ga0207694_10106216 Ga0207694_101062162 94
99 3300025928 Ga0207700_10627135 Ga0207700_106271352 94
100 3300025929 Ga0207664_10257723 Ga0207664_102577232 94
101 3300025929 Ga0207664_10833135 Ga0207664_108331352 94
102 3300025929 Ga0207664_11507025 Ga0207664_115070252 94
103 3300025939 Ga0207665_10106385 Ga0207665_101063852 94
104 3300031824 Ga0307413_11535518 Ga0307413_115355182 94
105 3300035118 Ga0373954_0019812 Ga0373954_0019812_1995_2279 94
106 3300035119 Ga0373956_0037907 Ga0373956_0037907_1612_1896 94
107 3300035171 Ga0373946_0258760 Ga0373946_0258760_198_482 94
108 3300035172 Ga0373955_0676176 Ga0373955_0676176_205_489 94
109 3300035410 Ga0373924_0010948 Ga0373924_0010948_824_1108 94
110 3300035724 Ga0373933_0036190 Ga0373933_0036190_1433_1717 94
111 3300036401 Ga0373937_0017146 Ga0373937_0017146_802_1086 94
112 3300036401 Ga0373937_1367769 Ga0373937_1367769_23_307 94
113 3300037068 Ga0373925_0324832 Ga0373925_0324832_112_396 94
114 3300037853 Ga0436364_0021731 Ga0436364_0021731_565_849 94
115 3300037853 Ga0436364_0716277 Ga0436364_0716277_365_649 94
116 3300037853 Ga0436364_1246106 Ga0436364_1246106_2768_3052 94
117 3300037853 Ga0436364_1462632 Ga0436364_1462632_548_832 94
118 3300039437 Ga0436365_0127362 Ga0436365_0127362_338_622 94
119 3300039437 Ga0436365_0262453 Ga0436365_0262453_7627_7911 94
120 3300039437 Ga0436365_0636327 Ga0436365_0636327_894_1178 94
121 3300039437 Ga0436365_0805820 Ga0436365_0805820_277_561 94
122 3300039437 Ga0436365_1334540 Ga0436365_1334540_178_462 94
123 3300039437 Ga0436365_1503119 Ga0436365_1503119_3196_3480 94
124 3300039437 Ga0436365_1614521 Ga0436365_1614521_1334_1618 94
125 3300039447 Ga0436361_1122369 Ga0436361_1122369_53_337 94
126 3300039450 Ga0436363_0182915 Ga0436363_0182915_559_843 94
127 3300039450 Ga0436363_0298435 Ga0436363_0298435_269_553 94
128 3300039450 Ga0436363_0776211 Ga0436363_0776211_798_1082 94
129 3300039450 Ga0436363_0831273 Ga0436363_0831273_1241_1525 94
130 3300039453 Ga0436362_0038053 Ga0436362_0038053_913_1197 94
131 3300044683 Ga0466965_0811644 Ga0466965_0811644_126_410 94
132 3300044684 Ga0466966_0750968 Ga0466966_0750968_165_449 94
133 3300044694 Ga0466963_0009843 Ga0466963_0009843_4796_5080 94
134 3300044694 Ga0466963_0126582 Ga0466963_0126582_553_837 94
135 3300044694 Ga0466963_0456882 Ga0466963_0456882_379_663 94
136 3300044706 Ga0466964_0054521 Ga0466964_0054521_1157_1441 94
137 3300044706 Ga0466964_0284046 Ga0466964_0284046_367_651 94
138 3300044719 Ga0466971_0022922 Ga0466971_0022922_2409_2693 94
139 3300044719 Ga0466971_0195228 Ga0466971_0195228_97_381 94
140 3300044735 Ga0466968_0169779 Ga0466968_0169779_413_697 94
141 3300044735 Ga0466968_0170594 Ga0466968_0170594_682_966 94
142 3300044735 Ga0466968_0223583 Ga0466968_0223583_532_816 94
143 3300044735 Ga0466968_0515188 Ga0466968_0515188_255_539 94
144 3300044765 Ga0466970_0170890 Ga0466970_0170890_622_906 94
145 3300044842 Ga0466957_0014845 Ga0466957_0014845_2224_2508 94
146 3300044842 Ga0466957_0383676 Ga0466957_0383676_246_530 94
147 3300044842 Ga0466957_0446525 Ga0466957_0446525_277_561 94
148 3300044842 Ga0466957_0591223 Ga0466957_0591223_199_483 94
149 3300045049 Ga0466959_0014324 Ga0466959_0014324_2576_2860 94
150 3300045049 Ga0466959_0033567 Ga0466959_0033567_3008_3292 94
151 3300045049 Ga0466959_0045864 Ga0466959_0045864_609_893 94
152 3300045049 Ga0466959_0320791 Ga0466959_0320791_604_888 94
153 3300045049 Ga0466959_0705016 Ga0466959_0705016_22_306 94
154 3300045836 Ga0466958_0000261 Ga0466958_0000261_14821_15105 94
155 3300045836 Ga0466958_0025299 Ga0466958_0025299_642_926 94
156 3300045836 Ga0466958_0123084 Ga0466958_0123084_559_843 94
157 3300045836 Ga0466958_0611396 Ga0466958_0611396_32_316 94
158 3300045836 Ga0466958_0816720 Ga0466958_0816720_229_513 94
159 3300045976 Ga0466967_0002486 Ga0466967_0002486_9305_9589 94
160 3300045976 Ga0466967_0338121 Ga0466967_0338121_547_831 94
161 3300045976 Ga0466967_0819291 Ga0466967_0819291_488_787 94
162 3300045976 Ga0466967_2395441 Ga0466967_2395441_208_492 94
163 3300046454 Ga0495592_0027796 Ga0495592_0027796_3042_3326 94
164 3300046459 Ga0495629_0170945 Ga0495629_0170945_182_466 94
165 3300046461 Ga0495641_0058565 Ga0495641_0058565_977_1261 94
166 3300046462 Ga0495651_0001413 Ga0495651_0001413_7708_7992 94
167 3300046463 Ga0495653_0005685 Ga0495653_0005685_1669_1953 94
168 3300046477 Ga0495664_0842313 Ga0495664_0842313_46_330 94
169 3300046499 Ga0495594_0214463 Ga0495594_0214463_229_513 94
170 3300046511 Ga0495608_0003483 Ga0495608_0003483_3190_3474 94
171 3300046511 Ga0495608_0853069 Ga0495608_0853069_35_319 94
172 3300046516 Ga0495628_0125849 Ga0495628_0125849_25_309 94
173 3300046516 Ga0495628_1122886 Ga0495628_1122886_159_443 94
174 3300046517 Ga0495630_0532280 Ga0495630_0532280_415_699 94
175 3300046529 Ga0495652_0045491 Ga0495652_0045491_3446_3730 94
176 3300046533 Ga0495640_0006746 Ga0495640_0006746_7266_7550 94
177 3300046536 Ga0495587_0041876 Ga0495587_0041876_1528_1812 94
178 3300046543 Ga0495645_0007716 Ga0495645_0007716_5565_5849 94
179 3300046543 Ga0495645_0245881 Ga0495645_0245881_741_1025 94
180 3300046559 Ga0495667_0003251 Ga0495667_0003251_2508_2792 94
181 3300046642 Ga0495634_0321633 Ga0495634_0321633_121_405 94
182 3300046663 Ga0495635_0074943 Ga0495635_0074943_66_350 94
183 3300046663 Ga0495635_1105449 Ga0495635_1105449_175_459 94
184 3300046675 Ga0495657_0039487 Ga0495657_0039487_321_605 94
185 3300046678 Ga0495599_0064012 Ga0495599_0064012_1811_2095 94
186 3300046678 Ga0495599_0639551 Ga0495599_0639551_315_599 94
187 3300046679 Ga0495623_0066748 Ga0495623_0066748_1129_1413 94
188 3300046683 Ga0495658_0945335 Ga0495658_0945335_177_461 94
189 3300046689 Ga0495613_0139436 Ga0495613_0139436_594_878 94
190 3300046689 Ga0495613_0771274 Ga0495613_0771274_241_525 94
191 3300046809 Ga0495600_0002543 Ga0495600_0002543_8871_9155 94
192 3300047317 Ga0495604_0003422 Ga0495604_0003422_7766_8050 94
193 3300047319 Ga0495674_0009390 Ga0495674_0009390_854_1138 94
194 3300047319 Ga0495674_0082511 Ga0495674_0082511_103_387 94
195 3300047322 Ga0495680_0003728 Ga0495680_0003728_5692_5976 94
196 3300047471 Ga0495684_0513892 Ga0495684_0513892_307_591 94
197 3300047471 Ga0495684_0789280 Ga0495684_0789280_95_379 94
198 3300047673 Ga0495593_0092548 Ga0495593_0092548_434_718 94
199 3300048088 Ga0495602_0011071 Ga0495602_0011071_2508_2792 94
200 3300048907 Ga0496104_0027785 Ga0496104_0027785_47_331 94
201 3300048907 Ga0496104_0078929 Ga0496104_0078929_2738_3022 94
202 3300048907 Ga0496104_0829480 Ga0496104_0829480_36_320 94
203 3300048908 Ga0496105_0061225 Ga0496105_0061225_2359_2643 94
204 3300048908 Ga0496105_0292683 Ga0496105_0292683_916_1200 94
205 3300048912 Ga0496109_0251405 Ga0496109_0251405_1147_1431 94
206 3300048912 Ga0496109_1940611 Ga0496109_1940611_96_380 94
207 3300048913 Ga0496110_0077309 Ga0496110_0077309_1586_1870 94
208 3300048914 Ga0496111_0108036 Ga0496111_0108036_483_767 94
209 3300048915 Ga0496112_0008981 Ga0496112_0008981_1883_2167 94
210 3300048916 Ga0496113_0456135 Ga0496113_0456135_606_890 94
211 3300048916 Ga0496113_1047163 Ga0496113_1047163_18_302 94
212 3300048917 Ga0496114_0042759 Ga0496114_0042759_2084_2368 94
213 3300048918 Ga0496115_0120214 Ga0496115_0120214_323_607 94
214 3300048918 Ga0496115_0291850 Ga0496115_0291850_1032_1316 94
215 3300053078 Ga0495612_0025865 Ga0495612_0025865_79_363 94
216 3300053084 Ga0495595_0095606 Ga0495595_0095606_428_712 94
217 3300053085 Ga0495619_0006527 Ga0495619_0006527_1554_1838 94
218 3300061719 Ga0466962_0096161 Ga0466962_0096161_92_376 94
219 3300005436 Ga0070713_100132573 Ga0070713_1001325732 95
220 3300006028 Ga0070717_10179315 Ga0070717_101793152 95
221 3300021358 Ga0213873_10124045 Ga0213873_101240452 95
222 3300025929 Ga0207664_10094461 Ga0207664_100944612 95
223 3300028556 Ga0265337_1002017 Ga0265337_10020173 95
224 3300028558 Ga0265326_10000360 Ga0265326_1000036024 95
225 3300028563 Ga0265319_1002401 Ga0265319_10024016 95
226 3300028573 Ga0265334_10248550 Ga0265334_102485502 95
227 3300028577 Ga0265318_10012809 Ga0265318_100128095 95
228 3300028666 Ga0265336_10000001 Ga0265336_1000000146 95
229 3300028800 Ga0265338_10000228 Ga0265338_1000022867 95
230 3300029957 Ga0265324_10010308 Ga0265324_100103085 95
231 3300031247 Ga0265340_10000005 Ga0265340_1000000546 95
232 3300031249 Ga0265339_10081256 Ga0265339_100812563 95
233 3300031344 Ga0265316_10726217 Ga0265316_107262172 95
234 3300031712 Ga0265342_10019136 Ga0265342_100191366 95
235 3300039437 Ga0436365_0021944 Ga0436365_0021944_1111_1401 95
236 3300039447 Ga0436361_0857302 Ga0436361_0857302_129_416 95
237 3300039453 Ga0436362_0417090 Ga0436362_0417090_144_434 95
238 3300045976 Ga0466967_0369590 Ga0466967_0369590_178_465 95
239 3300005329 Ga0070683_101895639 Ga0070683_1018956392 96
240 3300005436 Ga0070713_102157103 Ga0070713_1021571031 96
241 3300005437 Ga0070710_11033918 Ga0070710_110339181 96
242 3300006028 Ga0070717_10011586 Ga0070717_100115864 96
243 3300006028 Ga0070717_10326240 Ga0070717_103262402 96
244 3300009093 Ga0105240_11184187 Ga0105240_111841872 96
245 3300020077 Ga0206351_10987354 Ga0206351_109873542 96
246 3300022467 Ga0224712_10358651 Ga0224712_103586512 96
247 3300025913 Ga0207695_10820506 Ga0207695_108205062 96
248 3300025928 Ga0207700_10858729 Ga0207700_108587292 96
249 3300025928 Ga0207700_11517890 Ga0207700_115178901 96
250 3300025928 Ga0207700_11862825 Ga0207700_118628252 96
251 3300025929 Ga0207664_10091272 Ga0207664_100912722 96
252 3300025939 Ga0207665_10305172 Ga0207665_103051722 96
253 3300028800 Ga0265338_10552190 Ga0265338_105521901 96
254 3300037853 Ga0436364_0272422 Ga0436364_0272422_97_387 96
255 3300037853 Ga0436364_1425427 Ga0436364_1425427_297_587 96
256 3300038443 Ga0395901_0451985 Ga0395901_0451985_649_954 96
257 3300044694 Ga0466963_0266732 Ga0466963_0266732_804_1094 96
258 3300045976 Ga0466967_0005377 Ga0466967_0005377_349_639 96
259 3300046477 Ga0495664_0734123 Ga0495664_0734123_98_388 96
260 3300046516 Ga0495628_0592296 Ga0495628_0592296_246_536 96
261 3300047317 Ga0495604_0002449 Ga0495604_0002449_7240_7569 96
262 3300047319 Ga0495674_1491047 Ga0495674_1491047_26_316 96
263 3300049586 Ga0501070_0240280 Ga0501070_0240280_451_759 96
264 3300053077 Ga0495601_1043038 Ga0495601_1043038_198_488 96
265 3300053078 Ga0495612_0530725 Ga0495612_0530725_210_500 96
266 3300005327 Ga0070658_10616283 Ga0070658_106162831 97
267 3300005455 Ga0070663_100672623 Ga0070663_1006726232 97
268 3300005535 Ga0070684_100750752 Ga0070684_1007507522 97
269 3300005548 Ga0070665_100000608 Ga0070665_10000060830 97
270 3300005618 Ga0068864_101699453 Ga0068864_1016994532 97
271 3300005842 Ga0068858_102340635 Ga0068858_1023406352 97
272 3300006028 Ga0070717_10775223 Ga0070717_107752232 97
273 3300006175 Ga0070712_100967534 Ga0070712_1009675342 97
274 3300006881 Ga0068865_100921921 Ga0068865_1009219212 97
275 3300009177 Ga0105248_12138886 Ga0105248_121388862 97
276 3300013104 Ga0157370_11058342 Ga0157370_110583422 97
277 3300013297 Ga0157378_11884227 Ga0157378_118842272 97
278 3300013307 Ga0157372_11134515 Ga0157372_111345152 97
279 3300014497 Ga0182008_10278168 Ga0182008_102781682 97
280 3300021377 Ga0213874_10000485 Ga0213874_100004855 97
281 3300021384 Ga0213876_10193809 Ga0213876_101938091 97
282 3300025909 Ga0207705_10208791 Ga0207705_102087912 97
283 3300025921 Ga0207652_10681678 Ga0207652_106816782 97
284 3300025926 Ga0207659_10857445 Ga0207659_108574451 97
285 3300025929 Ga0207664_10689277 Ga0207664_106892772 97
286 3300025944 Ga0207661_11319574 Ga0207661_113195741 97
287 3300026067 Ga0207678_10584015 Ga0207678_105840152 97
288 3300028379 Ga0268266_11032445 Ga0268266_110324451 97
289 3300031911 Ga0307412_11150506 Ga0307412_111505062 97
290 3300032002 Ga0307416_100218719 Ga0307416_1002187192 97
291 3300035170 Ga0373943_0027436 Ga0373943_0027436_1763_2056 97
292 3300035725 Ga0373947_0125154 Ga0373947_0125154_28_321 97
293 3300039437 Ga0436365_0210228 Ga0436365_0210228_268_564 97
294 3300039450 Ga0436363_0678117 Ga0436363_0678117_22352_22648 97
295 3300046455 Ga0495603_0279410 Ga0495603_0279410_41_334 97
296 3300047319 Ga0495674_0384697 Ga0495674_0384697_60_371 97
297 3300048912 Ga0496109_1283600 Ga0496109_1283600_40_357 97
298 3300050512 nmdc:mga0n895_1554227_c1 nmdc:mga0n895_1554227_c1_202_510 97
299 3300044694 Ga0466963_0007310 Ga0466963_0007310_2610_2906 98
300 3300044719 Ga0466971_0653601 Ga0466971_0653601_95_403 98
301 3300045836 Ga0466958_0039126 Ga0466958_0039126_2119_2415 98
302 3300009553 Ga0105249_10256245 Ga0105249_102562452 99
303 3300013306 Ga0163162_10665995 Ga0163162_106659952 99
304 3300025933 Ga0207706_10173595 Ga0207706_101735952 99
305 3300025961 Ga0207712_10153793 Ga0207712_101537932 99
306 3300041452 Ga0451793_1648871 Ga0451793_1648871_267_569 99
307 3300044694 Ga0466963_0910211 Ga0466963_0910211_163_462 99
308 3300005841 Ga0068863_100548138 Ga0068863_1005481382 100
309 3300009098 Ga0105245_10093908 Ga0105245_100939082 100
310 3300009551 Ga0105238_12522509 Ga0105238_125225091 100
311 3300010375 Ga0105239_10748975 Ga0105239_107489752 100
312 3300013307 Ga0157372_10894673 Ga0157372_108946732 100
313 3300014968 Ga0157379_11380994 Ga0157379_113809942 100
314 3300020081 Ga0206354_10759756 Ga0206354_107597562 100
315 3300020082 Ga0206353_11884886 Ga0206353_118848862 100
316 3300025912 Ga0207707_10896537 Ga0207707_108965372 100
317 3300025919 Ga0207657_10677442 Ga0207657_106774422 100
318 3300026078 Ga0207702_10210484 Ga0207702_102104842 100
319 3300026088 Ga0207641_11349573 Ga0207641_113495732 100
320 3300032005 Ga0307411_10939459 Ga0307411_109394591 100
321 3300039447 Ga0436361_0592023 Ga0436361_0592023_121_438 100
322 3300044693 Ga0466961_0001786 Ga0466961_0001786_4625_4972 100
323 3300044693 Ga0466961_0104002 Ga0466961_0104002_382_687 100
324 3300044719 Ga0466971_0024791 Ga0466971_0024791_599_904 100
325 3300044735 Ga0466968_0342001 Ga0466968_0342001_37_342 100
326 3300044765 Ga0466970_0102109 Ga0466970_0102109_118_459 100
327 3300045049 Ga0466959_0005361 Ga0466959_0005361_5222_5527 100
328 3300045049 Ga0466959_0087868 Ga0466959_0087868_1480_1827 100
329 3300045049 Ga0466959_0577647 Ga0466959_0577647_96_407 100
330 3300045049 Ga0466959_0943083 Ga0466959_0943083_199_540 100
331 3300045836 Ga0466958_0009591 Ga0466958_0009591_4715_5020 100
332 3300045836 Ga0466958_0047139 Ga0466958_0047139_1209_1556 100
333 3300048903 Ga0496100_0305914 Ga0496100_0305914_841_1152 100
334 3300048904 Ga0496101_0169680 Ga0496101_0169680_1099_1410 100
335 3300048907 Ga0496104_0075301 Ga0496104_0075301_2848_3159 100
336 3300048909 Ga0496106_0650273 Ga0496106_0650273_263_574 100
337 3300048911 Ga0496108_0142587 Ga0496108_0142587_183_494 100
338 3300048912 Ga0496109_0045735 Ga0496109_0045735_763_1074 100
339 3300048913 Ga0496110_0142549 Ga0496110_0142549_648_959 100
340 3300048914 Ga0496111_0278156 Ga0496111_0278156_748_1059 100
341 3300048915 Ga0496112_0128989 Ga0496112_0128989_637_948 100
342 3300048916 Ga0496113_0023040 Ga0496113_0023040_2215_2526 100
343 3300061719 Ga0466962_0001652 Ga0466962_0001652_9926_10231 100
344 3300003659 JGI25404J52841_10046620 JGI25404J52841_100466202 101
345 3300005330 Ga0070690_100345412 Ga0070690_1003454122 101
346 3300005331 Ga0070670_101006402 Ga0070670_1010064022 101
347 3300005337 Ga0070682_100077108 Ga0070682_1000771082 101
348 3300005337 Ga0070682_100660106 Ga0070682_1006601062 101
349 3300005337 Ga0070682_101717580 Ga0070682_1017175801 101
350 3300005338 Ga0068868_100041722 Ga0068868_1000417222 101
351 3300005339 Ga0070660_100535146 Ga0070660_1005351462 101
352 3300005340 Ga0070689_100273323 Ga0070689_1002733232 101
353 3300005341 Ga0070691_10487038 Ga0070691_104870382 101
354 3300005347 Ga0070668_100005261 Ga0070668_1000052615 101
355 3300005354 Ga0070675_100645666 Ga0070675_1006456661 101
356 3300005356 Ga0070674_100810670 Ga0070674_1008106701 101
357 3300005364 Ga0070673_102072852 Ga0070673_1020728522 101
358 3300005366 Ga0070659_100730798 Ga0070659_1007307982 101
359 3300005437 Ga0070710_10148957 Ga0070710_101489572 101
360 3300005438 Ga0070701_10457122 Ga0070701_104571222 101
361 3300005439 Ga0070711_100244675 Ga0070711_1002446751 101
362 3300005441 Ga0070700_100135600 Ga0070700_1001356002 101
363 3300005444 Ga0070694_100412260 Ga0070694_1004122602 101
364 3300005455 Ga0070663_100115398 Ga0070663_1001153981 101
365 3300005455 Ga0070663_101112500 Ga0070663_1011125002 101
366 3300005459 Ga0068867_100218209 Ga0068867_1002182091 101
367 3300005466 Ga0070685_10097997 Ga0070685_100979972 101
368 3300005543 Ga0070672_100814893 Ga0070672_1008148932 101
369 3300005545 Ga0070695_101594213 Ga0070695_1015942132 101
370 3300005547 Ga0070693_100485286 Ga0070693_1004852862 101
371 3300005549 Ga0070704_101412246 Ga0070704_1014122462 101
372 3300005564 Ga0070664_100093820 Ga0070664_1000938203 101
373 3300005577 Ga0068857_100740328 Ga0068857_1007403282 101
374 3300005578 Ga0068854_100214300 Ga0068854_1002143002 101
375 3300005614 Ga0068856_100141096 Ga0068856_1001410962 101
376 3300005614 Ga0068856_100340626 Ga0068856_1003406262 101
377 3300005615 Ga0070702_100014883 Ga0070702_1000148832 101
378 3300005615 Ga0070702_101109526 Ga0070702_1011095262 101
379 3300005616 Ga0068852_100674433 Ga0068852_1006744332 101
380 3300005616 Ga0068852_102036742 Ga0068852_1020367422 101
381 3300005617 Ga0068859_100282130 Ga0068859_1002821301 101
382 3300005618 Ga0068864_100507929 Ga0068864_1005079292 101
383 3300005718 Ga0068866_10055523 Ga0068866_100555233 101
384 3300005719 Ga0068861_100058341 Ga0068861_1000583413 101
385 3300005719 Ga0068861_100914728 Ga0068861_1009147282 101
386 3300005842 Ga0068858_100061612 Ga0068858_1000616122 101
387 3300005842 Ga0068858_101134348 Ga0068858_1011343482 101
388 3300005843 Ga0068860_100518155 Ga0068860_1005181552 101
389 3300005843 Ga0068860_101795037 Ga0068860_1017950372 101
390 3300005844 Ga0068862_100097500 Ga0068862_1000975003 101
391 3300005983 Ga0081540_1002546 Ga0081540_10025464 101
392 3300005985 Ga0081539_10007029 Ga0081539_100070298 101
393 3300006048 Ga0075363_100340252 Ga0075363_1003402522 101
394 3300006358 Ga0068871_102329148 Ga0068871_1023291481 101
395 3300006847 Ga0075431_100749358 Ga0075431_1007493581 101
396 3300006881 Ga0068865_100043877 Ga0068865_1000438773 101
397 3300006931 Ga0097620_100282126 Ga0097620_1002821261 101
398 3300009094 Ga0111539_10193928 Ga0111539_101939283 101
399 3300009098 Ga0105245_10089818 Ga0105245_100898182 101
400 3300009098 Ga0105245_10200195 Ga0105245_102001952 101
401 3300009098 Ga0105245_10823088 Ga0105245_108230882 101
402 3300009101 Ga0105247_10218659 Ga0105247_102186592 101
403 3300009147 Ga0114129_11826138 Ga0114129_118261382 101
404 3300009148 Ga0105243_10391745 Ga0105243_103917452 101
405 3300009148 Ga0105243_10404534 Ga0105243_104045342 101
406 3300009176 Ga0105242_10032371 Ga0105242_100323713 101
407 3300009176 Ga0105242_10820652 Ga0105242_108206521 101
408 3300009176 Ga0105242_12312501 Ga0105242_123125012 101
409 3300009177 Ga0105248_12674692 Ga0105248_126746922 101
410 3300009551 Ga0105238_10285483 Ga0105238_102854832 101
411 3300009553 Ga0105249_10185790 Ga0105249_101857903 101
412 3300009553 Ga0105249_10452318 Ga0105249_104523182 101
413 3300009553 Ga0105249_12451333 Ga0105249_124513331 101
414 3300009553 Ga0105249_13546777 Ga0105249_135467771 101
415 3300010375 Ga0105239_10304265 Ga0105239_103042653 101
416 3300012488 Ga0157343_1016857 Ga0157343_10168572 101
417 3300013105 Ga0157369_11507778 Ga0157369_115077782 101
418 3300013296 Ga0157374_11099105 Ga0157374_110991052 101
419 3300013297 Ga0157378_11675470 Ga0157378_116754702 101
420 3300013306 Ga0163162_10474454 Ga0163162_104744541 101
421 3300013307 Ga0157372_10233221 Ga0157372_102332212 101
422 3300013307 Ga0157372_11060895 Ga0157372_110608952 101
423 3300013308 Ga0157375_10164994 Ga0157375_101649942 101
424 3300013308 Ga0157375_10799135 Ga0157375_107991352 101
425 3300014325 Ga0163163_10209479 Ga0163163_102094792 101
426 3300014325 Ga0163163_10440315 Ga0163163_104403153 101
427 3300014325 Ga0163163_11418129 Ga0163163_114181292 101
428 3300014326 Ga0157380_10155234 Ga0157380_101552342 101
429 3300014745 Ga0157377_10142248 Ga0157377_101422482 101
430 3300014968 Ga0157379_10886916 Ga0157379_108869162 101
431 3300014969 Ga0157376_10789525 Ga0157376_107895252 101
432 3300025321 Ga0207656_10069807 Ga0207656_100698072 101
433 3300025898 Ga0207692_10118676 Ga0207692_101186762 101
434 3300025899 Ga0207642_10062516 Ga0207642_100625162 101
435 3300025900 Ga0207710_10148272 Ga0207710_101482722 101
436 3300025907 Ga0207645_10562857 Ga0207645_105628572 101
437 3300025915 Ga0207693_10135697 Ga0207693_101356973 101
438 3300025918 Ga0207662_10595002 Ga0207662_105950022 101
439 3300025919 Ga0207657_10919127 Ga0207657_109191272 101
440 3300025923 Ga0207681_10180959 Ga0207681_101809592 101
441 3300025926 Ga0207659_10322213 Ga0207659_103222132 101
442 3300025927 Ga0207687_10132530 Ga0207687_101325302 101
443 3300025927 Ga0207687_10633007 Ga0207687_106330071 101
444 3300025927 Ga0207687_11142406 Ga0207687_111424062 101
445 3300025931 Ga0207644_10270782 Ga0207644_102707822 101
446 3300025932 Ga0207690_10075932 Ga0207690_100759322 101
447 3300025934 Ga0207686_11291262 Ga0207686_112912622 101
448 3300025935 Ga0207709_10579844 Ga0207709_105798442 101
449 3300025936 Ga0207670_10155383 Ga0207670_101553832 101
450 3300025937 Ga0207669_10702153 Ga0207669_107021531 101
451 3300025938 Ga0207704_10394854 Ga0207704_103948541 101
452 3300025940 Ga0207691_10332220 Ga0207691_103322202 101
453 3300025941 Ga0207711_11721373 Ga0207711_117213731 101
454 3300025942 Ga0207689_10005969 Ga0207689_100059698 101
455 3300025944 Ga0207661_10150903 Ga0207661_101509033 101
456 3300025944 Ga0207661_10198911 Ga0207661_101989112 101
457 3300025945 Ga0207679_10044732 Ga0207679_100447323 101
458 3300025945 Ga0207679_10290417 Ga0207679_102904172 101
459 3300025949 Ga0207667_10544622 Ga0207667_105446222 101
460 3300025960 Ga0207651_11455122 Ga0207651_114551222 101
461 3300025961 Ga0207712_10085247 Ga0207712_100852473 101
462 3300025972 Ga0207668_10944225 Ga0207668_109442252 101
463 3300025981 Ga0207640_10294208 Ga0207640_102942082 101
464 3300025981 Ga0207640_11673559 Ga0207640_116735592 101
465 3300026023 Ga0207677_10209278 Ga0207677_102092782 101
466 3300026023 Ga0207677_10546292 Ga0207677_105462922 101
467 3300026035 Ga0207703_10054234 Ga0207703_100542343 101
468 3300026041 Ga0207639_10354056 Ga0207639_103540562 101
469 3300026067 Ga0207678_10159292 Ga0207678_101592921 101
470 3300026067 Ga0207678_10615264 Ga0207678_106152642 101
471 3300026075 Ga0207708_10103648 Ga0207708_101036483 101
472 3300026078 Ga0207702_10221586 Ga0207702_102215862 101
473 3300026078 Ga0207702_10406588 Ga0207702_104065882 101
474 3300026089 Ga0207648_10255491 Ga0207648_102554912 101
475 3300026095 Ga0207676_10392140 Ga0207676_103921401 101
476 3300026116 Ga0207674_10515905 Ga0207674_105159051 101
477 3300026118 Ga0207675_100058914 Ga0207675_1000589143 101
478 3300026118 Ga0207675_100232924 Ga0207675_1002329242 101
479 3300026118 Ga0207675_100918410 Ga0207675_1009184101 101
480 3300026121 Ga0207683_10087091 Ga0207683_100870913 101
481 3300026142 Ga0207698_10126833 Ga0207698_101268332 101
482 3300026142 Ga0207698_11991480 Ga0207698_119914801 101
483 3300028380 Ga0268265_10187238 Ga0268265_101872382 101
484 3300028381 Ga0268264_12165751 Ga0268264_121657511 101
485 3300031901 Ga0307406_10978111 Ga0307406_109781111 101
486 3300031995 Ga0307409_101585297 Ga0307409_1015852972 101
487 3300031995 Ga0307409_101792989 Ga0307409_1017929892 101
488 3300032002 Ga0307416_100602038 Ga0307416_1006020382 101
489 3300032002 Ga0307416_103496763 Ga0307416_1034967632 101
490 3300032004 Ga0307414_10967388 Ga0307414_109673882 101
491 3300032126 Ga0307415_100628954 Ga0307415_1006289542 101
492 3300032126 Ga0307415_100954919 Ga0307415_1009549192 101
493 3300035691 Ga0373931_0687929 Ga0373931_0687929_349_657 101
494 3300044901 Ga0466960_0116061 Ga0466960_0116061_781_1086 101
495 3300044901 Ga0466960_0488253 Ga0466960_0488253_157_465 101
496 3300045976 Ga0466967_0223949 Ga0466967_0223949_1193_1501 101
497 3300046457 Ga0495590_0153265 Ga0495590_0153265_457_765 101
498 3300047447 Ga0495685_218407 Ga0495685_218407_269_577 101
499 3300048903 Ga0496100_0460861 Ga0496100_0460861_558_866 101
500 3300048903 Ga0496100_0747979 Ga0496100_0747979_119_427 101
501 3300048904 Ga0496101_0304675 Ga0496101_0304675_358_666 101
502 3300048905 Ga0496102_0118548 Ga0496102_0118548_552_860 101
503 3300048905 Ga0496102_0360687 Ga0496102_0360687_151_459 101
504 3300048906 Ga0496103_0197220 Ga0496103_0197220_833_1141 101
505 3300048908 Ga0496105_0099953 Ga0496105_0099953_1307_1615 101
506 3300048909 Ga0496106_0042130 Ga0496106_0042130_2953_3261 101
507 3300048909 Ga0496106_0095526 Ga0496106_0095526_1967_2275 101
508 3300048909 Ga0496106_0271647 Ga0496106_0271647_564_872 101
509 3300048909 Ga0496106_1492551 Ga0496106_1492551_91_399 101
510 3300048910 Ga0496107_0082914 Ga0496107_0082914_1500_1808 101
511 3300048910 Ga0496107_0322545 Ga0496107_0322545_263_571 101
512 3300048911 Ga0496108_0128448 Ga0496108_0128448_510_818 101
513 3300048911 Ga0496108_0912669 Ga0496108_0912669_180_488 101
514 3300048912 Ga0496109_0114360 Ga0496109_0114360_208_516 101
515 3300048912 Ga0496109_0759363 Ga0496109_0759363_102_410 101
516 3300048912 Ga0496109_2039270 Ga0496109_2039270_143_451 101
517 3300048913 Ga0496110_0073222 Ga0496110_0073222_2015_2323 101
518 3300048913 Ga0496110_1620965 Ga0496110_1620965_68_376 101
519 3300048914 Ga0496111_0096264 Ga0496111_0096264_1748_2056 101
520 3300048914 Ga0496111_0144057 Ga0496111_0144057_94_402 101
521 3300048915 Ga0496112_0108859 Ga0496112_0108859_382_690 101
522 3300048915 Ga0496112_0143607 Ga0496112_0143607_56_364 101
523 3300048915 Ga0496112_0499884 Ga0496112_0499884_37_345 101
524 3300048916 Ga0496113_0071501 Ga0496113_0071501_775_1083 101
525 3300048917 Ga0496114_0055365 Ga0496114_0055365_1509_1817 101
526 3300048918 Ga0496115_0718379 Ga0496115_0718379_283_591 101
527 3300049578 Ga0501042_0980899 Ga0501042_0980899_297_605 101
528 3300049824 Ga0501045_0938894 Ga0501045_0938894_48_356 101
529 3300050490 nmdc:mga03n38_509531_c1 nmdc:mga03n38_509531_c1_44_352 101
530 3300050510 nmdc:mga06r32_376754_c1 nmdc:mga06r32_376754_c1_524_829 101
531 3300050511 nmdc:mga08y16_1286377_c1 nmdc:mga08y16_1286377_c1_16_324 101
532 3300050512 nmdc:mga0n895_686859_c1 nmdc:mga0n895_686859_c1_649_957 101
533 3300054114 Ga0501084_0841736 Ga0501084_0841736_302_610 101
534 3300061734 Ga0530510_1172218 Ga0530510_1172218_111_419 101

Feature Viewer

pLDDT pTM Quality
71.73 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map