F460402

General Info

Members Datasets Scaffolds Average Seq Length
533 237 1066 442

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10000013|Ga0105238_1000001338
Length 468
Sequence MATTTDAPTVIRSSFHPDVESYEQVNRDADRLLTKPGKGYLALLGMAISLVGLMVIAELHNIWFGLGMSGLTNPVGWGVYITTFVFWVGIGHAGTLISAILYLFRAPWRQSIYRFAEAMTVFAVLTAALFPIIHIGRPWFFYWLLPLPSQRHLWPNFRSPLLWDVFAVTTYLTVSSVFFYIGLIPDIAAARDTAVNPMRKRVYTILSLGWKGTDREWRHFTRAYLFLAALATPLVLSVHSVVSWDFAVSIVPGWHTTIFAPYFVAGAILSGVAMVVTLMVPVHRIFGLGAYFTPTHYDRLAKLLLLTSLIVGYAYGMEYFMAYYSGELFERDVFWDRVTGQYWWAGWSMITFNAFVPQLLWIPRIRRNLNAFFLISIFVNIGMWWERFVIIVPSLAHSYEPWKFMNYHLTWVEASILLGSFGWSIAEIKEVLPPPMKRHDPEEHMEQIDASGPAGLLPTGYFDHAASR

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
143 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
144 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 1.13
Rhizosphere 98.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10000013 3300009551 Bacteria 257248
2 JGI26145J50221_1000569 3300003371 Bacteria 3150
3 Ga0065712_10078073 3300005290 Bacteria 3399
4 Ga0065715_10002243 3300005293 Bacteria 5465
5 Ga0065707_10094603 3300005295 Bacteria 3476
6 Ga0070676_10020004 3300005328 Bacteria 3731
7 Ga0070690_100033631 3300005330 Bacteria 3211
8 Ga0070670_100017109 3300005331 Bacteria 6221
9 Ga0070670_100057854 3300005331 Bacteria 3327
10 Ga0068869_100000454 3300005334 Bacteria 22524
11 Ga0068869_100002372 3300005334 Bacteria 11330
12 Ga0070680_100000745 3300005336 Bacteria 22728
13 Ga0070680_100170009 3300005336 Bacteria 1834
14 Ga0070682_100000164 3300005337 Bacteria 50996
15 Ga0068868_100011970 3300005338 Bacteria 6331
16 Ga0070660_100001192 3300005339 Bacteria 17625
17 Ga0070689_100001844 3300005340 Bacteria 13658
18 Ga0070689_100151087 3300005340 Bacteria 1873
19 Ga0070691_10005084 3300005341 Bacteria 5978
20 Ga0070691_10014674 3300005341 Bacteria 3595
21 Ga0070687_100001960 3300005343 Bacteria 7523
22 Ga0070661_100008371 3300005344 Bacteria 7146
23 Ga0070692_10000185 3300005345 Bacteria 16429
24 Ga0070692_10002417 3300005345 Bacteria 7241
25 Ga0070669_100021415 3300005353 Bacteria 4619
26 Ga0070673_100075603 3300005364 Bacteria 2717
27 Ga0070673_100102458 3300005364 Bacteria 2360
28 Ga0070688_100000685 3300005365 Bacteria 16865
29 Ga0070688_100009871 3300005365 Bacteria 5246
30 Ga0070659_100000169 3300005366 Bacteria 50438
31 Ga0070703_10028752 3300005406 Bacteria 1663
32 Ga0070701_10000434 3300005438 Bacteria 14271
33 Ga0070701_10024538 3300005438 Bacteria 2917
34 Ga0070701_10043040 3300005438 Bacteria 2308
35 Ga0070705_100018069 3300005440 Bacteria 3690
36 Ga0070705_100086402 3300005440 Bacteria 1941
37 Ga0070694_100000153 3300005444 Bacteria 35445
38 Ga0070694_100000394 3300005444 Bacteria 23658
39 Ga0070694_100003625 3300005444 Bacteria 9226
40 Ga0070694_100037165 3300005444 Bacteria 3229
41 Ga0070694_100041527 3300005444 Bacteria 3069
42 Ga0070708_100030956 3300005445 Bacteria 4629
43 Ga0070708_100053641 3300005445 Bacteria 3578
44 Ga0070708_100110492 3300005445 Bacteria 2526
45 Ga0070681_10030371 3300005458 Bacteria 5422
46 Ga0070681_10042257 3300005458 Bacteria 4568
47 Ga0068867_100003177 3300005459 Bacteria 11583
48 Ga0068867_100118067 3300005459 Bacteria 2046
49 Ga0070685_10002669 3300005466 Bacteria 9130
50 Ga0070706_100002480 3300005467 Bacteria 18577
51 Ga0070706_100038669 3300005467 Bacteria 4403
52 Ga0070706_100049561 3300005467 Bacteria 3875
53 Ga0070706_100111998 3300005467 Bacteria 2540
54 Ga0070707_100004480 3300005468 Bacteria 13085
55 Ga0070707_100029700 3300005468 Bacteria 5203
56 Ga0070707_100106664 3300005468 Bacteria 2717
57 Ga0070698_100002229 3300005471 Bacteria 21462
58 Ga0070698_100013773 3300005471 Bacteria 8559
59 Ga0070698_100015432 3300005471 Bacteria 8071
60 Ga0070698_100132543 3300005471 Bacteria 2447
61 Ga0070699_100007122 3300005518 Bacteria 9716
62 Ga0070699_100022592 3300005518 Bacteria 5421
63 Ga0070699_100028896 3300005518 Bacteria 4780
64 Ga0070699_100059410 3300005518 Bacteria 3312
65 Ga0070699_100074234 3300005518 Bacteria 2959
66 Ga0070679_100000780 3300005530 Bacteria 27672
67 Ga0070697_100004341 3300005536 Bacteria 10878
68 Ga0070697_100011711 3300005536 Bacteria 6859
69 Ga0070697_100016067 3300005536 Bacteria 5886
70 Ga0070697_100060234 3300005536 Bacteria 3093
71 Ga0070697_100076471 3300005536 Bacteria 2753
72 Ga0068853_100001544 3300005539 Bacteria 16734
73 Ga0070672_100023678 3300005543 Bacteria 4529
74 Ga0070672_100029057 3300005543 Bacteria 4142
75 Ga0070686_100000005 3300005544 Bacteria 248346
76 Ga0070695_100001873 3300005545 Bacteria 11885
77 Ga0070695_100002060 3300005545 Bacteria 11494
78 Ga0070695_100003497 3300005545 Bacteria 9168
79 Ga0070695_100004592 3300005545 Bacteria 8103
80 Ga0070696_100001217 3300005546 Bacteria 16726
81 Ga0070696_100162211 3300005546 Bacteria 1648
82 Ga0070693_100000018 3300005547 Bacteria 62344
83 Ga0070693_100045130 3300005547 Bacteria 2497
84 Ga0070704_100012918 3300005549 Bacteria 5166
85 Ga0070704_100015621 3300005549 Bacteria 4774
86 Ga0070704_100069128 3300005549 Bacteria 2557
87 Ga0068855_100000233 3300005563 Bacteria 70757
88 Ga0070664_100001518 3300005564 Bacteria 18521
89 Ga0068857_100024893 3300005577 Bacteria 5272
90 Ga0068857_100094110 3300005577 Bacteria 2683
91 Ga0068854_100000372 3300005578 Bacteria 28633
92 Ga0068856_100000806 3300005614 Bacteria 33848
93 Ga0068859_100003308 3300005617 Bacteria 16381
94 Ga0068864_100004417 3300005618 Bacteria 11548
95 Ga0068864_100032781 3300005618 Bacteria 4416
96 Ga0068861_100184408 3300005719 Bacteria 1739
97 Ga0068870_10000059 3300005840 Bacteria 34564
98 Ga0068870_10003266 3300005840 Bacteria 6845
99 Ga0068863_100041774 3300005841 Bacteria 4360
100 Ga0068863_100249167 3300005841 Bacteria 1715
101 Ga0068858_100026041 3300005842 Bacteria 5439
102 Ga0068860_100003577 3300005843 Bacteria 15976
103 Ga0068860_100017134 3300005843 Bacteria 7063
104 Ga0068860_100075469 3300005843 Bacteria 3207
105 Ga0068862_100004793 3300005844 Bacteria 11385
106 Ga0068862_100096325 3300005844 Bacteria 2583
107 Ga0068862_100127188 3300005844 Bacteria 2251
108 Ga0081455_10001251 3300005937 Bacteria 31750
109 Ga0081455_10040979 3300005937 Bacteria 4079
110 Ga0081538_10003971 3300005981 Bacteria 13780
111 Ga0081540_1016094 3300005983 Bacteria 4703
112 Ga0081539_10000092 3300005985 Bacteria 208968
113 Ga0070712_100001609 3300006175 Bacteria 13807
114 Ga0068871_100046576 3300006358 Bacteria 3493
115 Ga0075428_100000421 3300006844 Bacteria 42169
116 Ga0075428_100001299 3300006844 Bacteria 26507
117 Ga0075428_100002483 3300006844 Bacteria 20019
118 Ga0075428_100007223 3300006844 Bacteria 12303
119 Ga0075428_100019738 3300006844 Bacteria 7457
120 Ga0075428_100023192 3300006844 Bacteria 6864
121 Ga0075428_100030256 3300006844 Bacteria 5989
122 Ga0075430_100000103 3300006846 Bacteria 51038
123 Ga0075430_100000301 3300006846 Bacteria 34954
124 Ga0075430_100000341 3300006846 Bacteria 33734
125 Ga0075430_100002061 3300006846 Bacteria 16580
126 Ga0075430_100011035 3300006846 Bacteria 7656
127 Ga0075430_100039423 3300006846 Bacteria 4000
128 Ga0075430_100098720 3300006846 Bacteria 2439
129 Ga0075431_100000072 3300006847 Bacteria 58754
130 Ga0075431_100000339 3300006847 Bacteria 36926
131 Ga0075431_100000470 3300006847 Bacteria 33363
132 Ga0075431_100002219 3300006847 Bacteria 18607
133 Ga0075431_100002902 3300006847 Bacteria 16586
134 Ga0075431_100004853 3300006847 Bacteria 13244
135 Ga0075431_100005382 3300006847 Bacteria 12638
136 Ga0075431_100014905 3300006847 Bacteria 7870
137 Ga0075433_10000783 3300006852 Bacteria 21957
138 Ga0075433_10003027 3300006852 Bacteria 12915
139 Ga0075433_10005303 3300006852 Bacteria 10112
140 Ga0075433_10009022 3300006852 Bacteria 7964
141 Ga0075433_10015010 3300006852 Bacteria 6342
142 Ga0075433_10054172 3300006852 Bacteria 3499
143 Ga0075433_10067896 3300006852 Bacteria 3129
144 Ga0075433_10157932 3300006852 Bacteria 2018
145 Ga0075434_100001918 3300006871 Bacteria 18027
146 Ga0075434_100003368 3300006871 Bacteria 14308
147 Ga0075434_100014433 3300006871 Bacteria 7551
148 Ga0075434_100016705 3300006871 Bacteria 7059
149 Ga0075434_100023882 3300006871 Bacteria 5967
150 Ga0075434_100025611 3300006871 Bacteria 5772
151 Ga0075434_100031771 3300006871 Bacteria 5206
152 Ga0075434_100063510 3300006871 Bacteria 3675
153 Ga0075434_100074923 3300006871 Bacteria 3378
154 Ga0075434_100080694 3300006871 Bacteria 3250
155 Ga0075429_100000014 3300006880 Bacteria 79603
156 Ga0075429_100000169 3300006880 Bacteria 41871
157 Ga0075429_100000305 3300006880 Bacteria 34736
158 Ga0075429_100010608 3300006880 Bacteria 7971
159 Ga0075429_100047570 3300006880 Bacteria 3731
160 Ga0075429_100098795 3300006880 Bacteria 2547
161 Ga0075436_100001117 3300006914 Bacteria 18139
162 Ga0075436_100020775 3300006914 Bacteria 4505
163 Ga0097620_100003308 3300006931 Bacteria 16381
164 Ga0075435_100000798 3300007076 Bacteria 19609
165 Ga0075435_100010585 3300007076 Bacteria 6750
166 Ga0075435_100026498 3300007076 Bacteria 4524
167 Ga0075435_100030401 3300007076 Bacteria 4246
168 Ga0075435_100046221 3300007076 Bacteria 3491
169 Ga0075435_100226040 3300007076 Bacteria 1590
170 Ga0099794_10002669 3300007265 Bacteria 6641
171 Ga0099794_10006698 3300007265 Bacteria 4681
172 Ga0111539_10000557 3300009094 Bacteria 47767
173 Ga0111539_10008896 3300009094 Bacteria 12713
174 Ga0111539_10013419 3300009094 Bacteria 10242
175 Ga0111539_10159564 3300009094 Bacteria 2638
176 Ga0111539_10166243 3300009094 Bacteria 2579
177 Ga0105247_10025279 3300009101 Bacteria 3582
178 Ga0114129_10000704 3300009147 Bacteria 42132
179 Ga0114129_10000726 3300009147 Bacteria 41775
180 Ga0114129_10001085 3300009147 Bacteria 35711
181 Ga0114129_10002365 3300009147 Bacteria 26178
182 Ga0114129_10006119 3300009147 Bacteria 17065
183 Ga0114129_10009632 3300009147 Bacteria 13784
184 Ga0114129_10027225 3300009147 Bacteria 8094
185 Ga0114129_10030802 3300009147 Bacteria 7587
186 Ga0114129_10034435 3300009147 Bacteria 7153
187 Ga0114129_10039569 3300009147 Bacteria 6648
188 Ga0114129_10046202 3300009147 Bacteria 6121
189 Ga0114129_10083058 3300009147 Bacteria 4451
190 Ga0114129_10294797 3300009147 Bacteria 2163
191 Ga0114129_10418542 3300009147 Bacteria 1763
192 Ga0105243_10005054 3300009148 Bacteria 10351
193 Ga0105241_10002337 3300009174 Bacteria 14247
194 Ga0105241_10133394 3300009174 Bacteria 2013
195 Ga0105248_10153001 3300009177 Bacteria 2603
196 Ga0105248_10294887 3300009177 Bacteria 1826
197 Ga0105237_10139440 3300009545 Bacteria 2419
198 Ga0105239_10056136 3300010375 Bacteria 4319
199 Ga0157373_10007582 3300013100 Bacteria 8065
200 Ga0157373_10093046 3300013100 Bacteria 2123
201 Ga0157371_10036447 3300013102 Bacteria 3522
202 Ga0157370_10104620 3300013104 Bacteria 2650
203 Ga0157378_10056755 3300013297 Bacteria 3490
204 Ga0157378_10262644 3300013297 Bacteria 1657
205 Ga0163162_10037969 3300013306 Bacteria 4807
206 Ga0157375_10221895 3300013308 Bacteria 2048
207 Ga0163163_10017157 3300014325 Bacteria 6746
208 Ga0207653_10000836 3300025885 Bacteria 10267
209 Ga0207688_10033944 3300025901 Bacteria 2823
210 Ga0207647_10055210 3300025904 Bacteria 2441
211 Ga0207645_10000340 3300025907 Bacteria 39096
212 Ga0207645_10108854 3300025907 Bacteria 1793
213 Ga0207643_10000105 3300025908 Bacteria 57132
214 Ga0207684_10000242 3300025910 Bacteria 81735
215 Ga0207684_10007913 3300025910 Bacteria 9500
216 Ga0207684_10015825 3300025910 Bacteria 6485
217 Ga0207684_10023335 3300025910 Bacteria 5282
218 Ga0207684_10065669 3300025910 Bacteria 3081
219 Ga0207684_10075817 3300025910 Bacteria 2858
220 Ga0207684_10084029 3300025910 Bacteria 2711
221 Ga0207684_10089683 3300025910 Bacteria 2620
222 Ga0207684_10100792 3300025910 Bacteria 2468
223 Ga0207684_10145131 3300025910 Bacteria 2041
224 Ga0207684_10257066 3300025910 Bacteria 1507
225 Ga0207707_10000034 3300025912 Bacteria 152677
226 Ga0207707_10095175 3300025912 Bacteria 2603
227 Ga0207693_10019184 3300025915 Bacteria 5442
228 Ga0207660_10001489 3300025917 Bacteria 15764
229 Ga0207660_10017413 3300025917 Bacteria 4774
230 Ga0207660_10018530 3300025917 Bacteria 4642
231 Ga0207660_10075616 3300025917 Bacteria 2461
232 Ga0207662_10012480 3300025918 Bacteria 4731
233 Ga0207657_10000066 3300025919 Bacteria 98663
234 Ga0207649_10003921 3300025920 Bacteria 8118
235 Ga0207652_10000740 3300025921 Bacteria 31505
236 Ga0207646_10000574 3300025922 Bacteria 48122
237 Ga0207646_10004220 3300025922 Bacteria 15726
238 Ga0207646_10008590 3300025922 Bacteria 10208
239 Ga0207646_10045524 3300025922 Bacteria 3939
240 Ga0207646_10067055 3300025922 Bacteria 3204
241 Ga0207646_10081770 3300025922 Bacteria 2888
242 Ga0207646_10181986 3300025922 Bacteria 1898
243 Ga0207681_10013079 3300025923 Bacteria 5132
244 Ga0207694_10000026 3300025924 Bacteria 257192
245 Ga0207650_10042574 3300025925 Bacteria 3331
246 Ga0207690_10001729 3300025932 Bacteria 13423
247 Ga0207686_10036827 3300025934 Bacteria 2949
248 Ga0207709_10039249 3300025935 Bacteria 2827
249 Ga0207670_10000227 3300025936 Bacteria 36201
250 Ga0207670_10009664 3300025936 Bacteria 5514
251 Ga0207670_10055904 3300025936 Bacteria 2669
252 Ga0207665_10004527 3300025939 Bacteria 9220
253 Ga0207691_10026319 3300025940 Bacteria 5460
254 Ga0207691_10047273 3300025940 Bacteria 3949
255 Ga0207689_10000365 3300025942 Bacteria 42716
256 Ga0207689_10004878 3300025942 Bacteria 12094
257 Ga0207689_10009184 3300025942 Bacteria 8556
258 Ga0207679_10000248 3300025945 Bacteria 41174
259 Ga0207651_10033513 3300025960 Bacteria 3314
260 Ga0207651_10106548 3300025960 Bacteria 2093
261 Ga0207712_10014025 3300025961 Bacteria 5144
262 Ga0207640_10003855 3300025981 Bacteria 8092
263 Ga0207677_10021867 3300026023 Bacteria 3919
264 Ga0207703_10017210 3300026035 Bacteria 5640
265 Ga0207678_10002576 3300026067 Bacteria 16517
266 Ga0207702_10002703 3300026078 Bacteria 16651
267 Ga0207641_10060699 3300026088 Bacteria 3223
268 Ga0207641_10081442 3300026088 Bacteria 2811
269 Ga0207641_10109755 3300026088 Bacteria 2444
270 Ga0207648_10000856 3300026089 Bacteria 34281
271 Ga0207648_10057155 3300026089 Bacteria 3404
272 Ga0207648_10144012 3300026089 Bacteria 2102
273 Ga0207676_10013750 3300026095 Bacteria 5811
274 Ga0207676_10111649 3300026095 Bacteria 2288
275 Ga0207676_10158536 3300026095 Bacteria 1958
276 Ga0207674_10000050 3300026116 Bacteria 116782
277 Ga0207674_10091008 3300026116 Bacteria 3042
278 Ga0207675_100059243 3300026118 Bacteria 3573
279 Ga0209973_1000647 3300027252 Bacteria 2727
280 Ga0209996_1002066 3300027395 Bacteria 2476
281 Ga0209995_1000625 3300027471 Bacteria 5452
282 Ga0209970_1001083 3300027614 Bacteria 4806
283 Ga0210002_1001659 3300027617 Bacteria 3172
284 Ga0209983_1000978 3300027665 Bacteria 6293
285 Ga0209971_1000128 3300027682 Bacteria 22582
286 Ga0209966_1000071 3300027695 Bacteria 45482
287 Ga0209998_10000113 3300027717 Bacteria 32266
288 Ga0209974_10003286 3300027876 Bacteria 5845
289 Ga0207428_10000033 3300027907 Bacteria 232081
290 Ga0207428_10000054 3300027907 Bacteria 175237
291 Ga0207428_10000213 3300027907 Bacteria 80079
292 Ga0207428_10008425 3300027907 Bacteria 9309
293 Ga0207428_10040774 3300027907 Bacteria 3762
294 Ga0268265_10127253 3300028380 Bacteria 2110
295 Ga0268264_10004690 3300028381 Bacteria 11621
296 Ga0268264_10029403 3300028381 Bacteria 4500
297 Ga0265326_10002394 3300028558 Bacteria 6325
298 Ga0265319_1000340 3300028563 Bacteria 34215
299 Ga0265319_1002588 3300028563 Bacteria 9755
300 Ga0265334_10003273 3300028573 Bacteria 7393
301 Ga0265318_10002166 3300028577 Bacteria 10647
302 Ga0265323_10001268 3300028653 Bacteria 12645
303 Ga0265322_10001951 3300028654 Bacteria 6523
304 Ga0265336_10000109 3300028666 Bacteria 62807
305 Ga0265338_10001759 3300028800 Bacteria 34223
306 Ga0265338_10015892 3300028800 Bacteria 8236
307 Ga0265324_10001359 3300029957 Bacteria 14225
308 Ga0265330_10004782 3300031235 Bacteria 6836
309 Ga0265332_10001135 3300031238 Bacteria 15461
310 Ga0265320_10007425 3300031240 Bacteria 6801
311 Ga0265320_10028634 3300031240 Bacteria 2890
312 Ga0265325_10007958 3300031241 Bacteria 6295
313 Ga0265329_10002540 3300031242 Bacteria 8236
314 Ga0265339_10001023 3300031249 Bacteria 21319
315 Ga0265331_10006936 3300031250 Bacteria 6615
316 Ga0265316_10011778 3300031344 Bacteria 7866
317 Ga0265316_10021430 3300031344 Bacteria 5473
318 Ga0307408_100020223 3300031548 Bacteria 4490
319 Ga0307408_100056849 3300031548 Bacteria 2838
320 Ga0265313_10000728 3300031595 Bacteria 33869
321 Ga0265314_10005079 3300031711 Bacteria 11994
322 Ga0265342_10005224 3300031712 Bacteria 9964
323 Ga0307405_10023338 3300031731 Bacteria 3515
324 Ga0307410_10161391 3300031852 Bacteria 1680
325 Ga0307409_100028659 3300031995 Bacteria 3972
326 Ga0307411_10056470 3300032005 Bacteria 2588
327 Ga0373959_0000126 3300034820 Bacteria 16941
328 Ga0373959_0005494 3300034820 Bacteria 2078
329 Ga0373940_0001138 3300035088 Bacteria 4653
330 Ga0373940_0009158 3300035088 Bacteria 2295
331 Ga0373949_0002486 3300035090 Bacteria 4717
332 Ga0373932_0021798 3300035112 Bacteria 1695
333 Ga0373941_0025243 3300035115 Bacteria 1715
334 Ga0373960_0005764 3300035121 Bacteria 2881
335 Ga0373942_0007939 3300035207 Bacteria 2467
336 Ga0373961_0013609 3300035241 Bacteria 2054
337 Ga0373931_0001032 3300035691 Bacteria 11771
338 Ga0373933_0038008 3300035724 Bacteria 2827
339 Ga0395900_0003509 3300037418 Bacteria 16929
340 Ga0395900_0005123 3300037418 Bacteria 13764
341 Ga0395900_0038364 3300037418 Bacteria 4937
342 Ga0395898_0176777 3300037466 Bacteria 2040
343 Ga0395898_0191618 3300037466 Bacteria 1953
344 Ga0395905_0032970 3300037471 Bacteria 4869
345 Ga0395905_0188914 3300037471 Bacteria 1933
346 Ga0436364_1507082 3300037853 Bacteria 10580
347 Ga0395901_0001380 3300038443 Bacteria 25404
348 Ga0395901_0008385 3300038443 Bacteria 10447
349 Ga0395901_0011843 3300038443 Bacteria 8842
350 Ga0395901_0022100 3300038443 Bacteria 6518
351 Ga0242420_006184 3300038996 Bacteria 1884
352 Ga0439450_004526 3300042008 Bacteria 2381
353 Ga0439455_0007607 3300042012 Bacteria 2297
354 Ga0450889_004869 3300042144 Bacteria 1330
355 Ga0439464_0008575 3300042439 Bacteria 2679
356 Ga0439460_0004618 3300042461 Bacteria 3361
357 Ga0453683_0018255 3300044673 Bacteria 4505
358 Ga0453683_0038740 3300044673 Bacteria 2997
359 Ga0453683_0048876 3300044673 Bacteria 2652
360 Ga0466961_0003380 3300044693 Bacteria 9962
361 Ga0453684_0025528 3300044712 Bacteria 8575
362 Ga0453684_0099104 3300044712 Bacteria 3571
363 Ga0451576_0005487 3300045051 Bacteria 15871
364 Ga0451576_0012143 3300045051 Bacteria 9711
365 Ga0451576_0033448 3300045051 Bacteria 5465
366 Ga0451576_0038895 3300045051 Bacteria 5035
367 Ga0451576_0092310 3300045051 Bacteria 3149
368 Ga0451576_0199194 3300045051 Bacteria 2091
369 Ga0451576_0209941 3300045051 Bacteria 2033
370 Ga0495603_0151421 3300046455 Bacteria 1347
371 Ga0495580_0023796 3300046472 Bacteria 4492
372 Ga0495580_0046572 3300046472 Bacteria 3076
373 Ga0495584_0029594 3300046491 Bacteria 2777
374 Ga0495618_0000568 3300046514 Bacteria 26224
375 Ga0495628_0017705 3300046516 Bacteria 5922
376 Ga0495643_0000144 3300046522 Bacteria 114698
377 Ga0495642_0013888 3300046528 Bacteria 3119
378 Ga0495587_0011898 3300046536 Bacteria 5501
379 Ga0495600_0046920 3300046809 Bacteria 2818
380 Ga0496102_0014983 3300048905 Bacteria 6748
381 Ga0496102_0044734 3300048905 Bacteria 4019
382 Ga0496106_0166736 3300048909 Bacteria 1744
383 Ga0496108_0138779 3300048911 Bacteria 2094
384 Ga0496108_0223056 3300048911 Bacteria 1638
385 Ga0496110_0044500 3300048913 Bacteria 3877
386 Ga0501033_0009404 3300049570 Bacteria 7527
387 Ga0501033_0018150 3300049570 Bacteria 5316
388 Ga0501034_0065130 3300049571 Bacteria 3657
389 Ga0501036_0129057 3300049572 Bacteria 2135
390 Ga0501036_0166351 3300049572 Bacteria 1859
391 Ga0501037_0140631 3300049573 Bacteria 1728
392 Ga0501038_0048782 3300049574 Bacteria 3663
393 Ga0501038_0142387 3300049574 Bacteria 1961
394 Ga0501039_0012773 3300049575 Bacteria 6419
395 Ga0501039_0114173 3300049575 Bacteria 2113
396 Ga0501040_0012627 3300049576 Bacteria 5540
397 Ga0501040_0159816 3300049576 Bacteria 1592
398 Ga0501041_0001796 3300049577 Bacteria 12024
399 Ga0501042_0008891 3300049578 Bacteria 6661
400 Ga0501042_0059543 3300049578 Bacteria 2727
401 Ga0501046_0009916 3300049580 Bacteria 8207
402 Ga0501046_0050119 3300049580 Bacteria 3299
403 Ga0501046_0090523 3300049580 Bacteria 2354
404 Ga0501047_0001551 3300049581 Bacteria 22489
405 Ga0501047_0015428 3300049581 Bacteria 7278
406 Ga0501047_0020029 3300049581 Bacteria 6424
407 Ga0501067_0020043 3300049583 Bacteria 3701
408 Ga0501071_0046897 3300049587 Bacteria 3104
409 Ga0501071_0075474 3300049587 Bacteria 2461
410 Ga0501072_0018367 3300049588 Bacteria 5383
411 Ga0501072_0026081 3300049588 Bacteria 4554
412 Ga0501072_0088006 3300049588 Bacteria 2464
413 Ga0501074_0002552 3300049590 Bacteria 12706
414 Ga0501075_0000742 3300049591 Bacteria 20270
415 Ga0501075_0020507 3300049591 Bacteria 4810
416 Ga0501075_0024846 3300049591 Bacteria 4398
417 Ga0501075_0037146 3300049591 Bacteria 3638
418 Ga0501075_0068867 3300049591 Bacteria 2674
419 Ga0501075_0111618 3300049591 Bacteria 2079
420 Ga0501076_0002350 3300049592 Bacteria 12941
421 Ga0501076_0002927 3300049592 Bacteria 11839
422 Ga0501076_0043690 3300049592 Bacteria 3532
423 Ga0501076_0226640 3300049592 Bacteria 1528
424 Ga0501077_0096914 3300049593 Bacteria 1869
425 Ga0501079_0000847 3300049741 Bacteria 20853
426 Ga0501079_0001826 3300049741 Bacteria 15236
427 Ga0501079_0007619 3300049741 Bacteria 8199
428 Ga0501079_0010075 3300049741 Bacteria 7177
429 Ga0501081_0003354 3300049743 Bacteria 10189
430 Ga0501081_0003988 3300049743 Bacteria 9456
431 Ga0501081_0007247 3300049743 Bacteria 7209
432 Ga0501081_0009320 3300049743 Bacteria 6396
433 Ga0501081_0012977 3300049743 Bacteria 5481
434 Ga0501081_0112150 3300049743 Bacteria 1936
435 Ga0501083_0003803 3300049744 Bacteria 10601
436 Ga0501035_0000352 3300049822 Bacteria 52889
437 Ga0501044_0002748 3300049823 Bacteria 20018
438 Ga0501044_0047301 3300049823 Bacteria 4449
439 Ga0501045_0001154 3300049824 Bacteria 17499
440 Ga0501045_0010020 3300049824 Bacteria 6629
441 Ga0501045_0044819 3300049824 Bacteria 3222
442 nmdc:mga05p37_11107_c1 3300050507 Bacteria 10702
443 nmdc:mga05p37_132342_c1 3300050507 Bacteria 3060
444 nmdc:mga05p37_16568_c1 3300050507 Bacteria 8878
445 nmdc:mga05p37_18659_c1 3300050507 Bacteria 8384
446 nmdc:mga05p37_20033_c1 3300050507 Bacteria 8094
447 nmdc:mga05p37_20869_c1 3300050507 Bacteria 7928
448 nmdc:mga05p37_21239_c1 3300050507 Bacteria 7859
449 nmdc:mga05p37_25637_c1 3300050507 Bacteria 7172
450 nmdc:mga05p37_293005_c1 3300050507 Bacteria 1936
451 nmdc:mga05p37_320782_c1 3300050507 Bacteria 1834
452 nmdc:mga05p37_37004_c1 3300050507 Bacteria 5986
453 nmdc:mga05p37_4529_c1 3300050507 Bacteria 16242
454 nmdc:mga05p37_4740_c1 3300050507 Bacteria 15888
455 nmdc:mga05p37_4991_c1 3300050507 Bacteria 15553
456 nmdc:mga05p37_571_c1 3300050507 Bacteria 40489
457 nmdc:mga05p37_58063_c1 3300050507 Bacteria 4766
458 nmdc:mga05p37_58080_c1 3300050507 Bacteria 4765
459 nmdc:mga05p37_64990_c1 3300050507 Bacteria 4490
460 nmdc:mga05p37_99662_c1 3300050507 Bacteria 3578
461 nmdc:mga09592_112151_c1 3300050508 Bacteria 2340
462 nmdc:mga09592_116180_c1 3300050508 Bacteria 2296
463 nmdc:mga09592_22323_c1 3300050508 Bacteria 5223
464 nmdc:mga09592_2684_c1 3300050508 Bacteria 14393
465 nmdc:mga09592_39801_c1 3300050508 Bacteria 3949
466 nmdc:mga09592_45364_c1 3300050508 Bacteria 3703
467 nmdc:mga09592_5004_c1 3300050508 Bacteria 10743
468 nmdc:mga09592_5510_c1 3300050508 Bacteria 10298
469 nmdc:mga09592_56_c1 3300050508 Bacteria 62143
470 nmdc:mga09592_596_c1 3300050508 Bacteria 27392
471 nmdc:mga09592_84099_c1 3300050508 Bacteria 2713
472 nmdc:mga0qj67_10290_c1 3300050509 Bacteria 6985
473 nmdc:mga0qj67_143391_c1 3300050509 Bacteria 1937
474 nmdc:mga0qj67_40400_c1 3300050509 Bacteria 3666
475 nmdc:mga0qj67_54404_c1 3300050509 Bacteria 3169
476 nmdc:mga0qj67_711_c1 3300050509 Bacteria 22648
477 nmdc:mga0qj67_761_c1 3300050509 Bacteria 21944
478 nmdc:mga06r32_1136_c1 3300050510 Bacteria 23891
479 nmdc:mga06r32_132_c1 3300050510 Bacteria 54848
480 nmdc:mga06r32_14962_c1 3300050510 Bacteria 7043
481 nmdc:mga06r32_16935_c1 3300050510 Bacteria 6649
482 nmdc:mga06r32_414_c1 3300050510 Bacteria 35862
483 nmdc:mga06r32_42468_c1 3300050510 Bacteria 4323
484 nmdc:mga06r32_4664_c1 3300050510 Bacteria 12301
485 nmdc:mga06r32_51433_c1 3300050510 Bacteria 3943
486 nmdc:mga06r32_739_c1 3300050510 Bacteria 28672
487 nmdc:mga06r32_8388_c1 3300050510 Bacteria 9306
488 nmdc:mga08y16_324528_c1 3300050511 Bacteria 1584
489 nmdc:mga08y16_3353_c1 3300050511 Bacteria 16592
490 nmdc:mga08y16_569_c1 3300050511 Bacteria 34274
491 nmdc:mga08y16_61998_c1 3300050511 Bacteria 3905
492 nmdc:mga08y16_751_c1 3300050511 Bacteria 30845
493 nmdc:mga08y16_9111_c1 3300050511 Bacteria 10423
494 nmdc:mga0n895_191_c1 3300050512 Bacteria 38035
495 nmdc:mga0n895_228983_c1 3300050512 Bacteria 1887
496 nmdc:mga0n895_23889_c1 3300050512 Bacteria 5753
497 nmdc:mga0n895_247213_c1 3300050512 Bacteria 1810
498 nmdc:mga0n895_26_c1 3300050512 Bacteria 89958
499 nmdc:mga0n895_33499_c1 3300050512 Bacteria 4938
500 nmdc:mga0n895_33747_c1 3300050512 Bacteria 4920
501 nmdc:mga0n895_34226_c1 3300050512 Bacteria 4888
502 nmdc:mga0n895_67872_c1 3300050512 Bacteria 3532
503 nmdc:mga0n895_9325_c1 3300050512 Bacteria 8577
504 nmdc:mga0n895_99867_c1 3300050512 Bacteria 2911
505 nmdc:mga0rr50_10638_c1 3300050513 Bacteria 5849
506 nmdc:mga0rr50_176309_c1 3300050513 Bacteria 1745
507 nmdc:mga0rr50_8223_c1 3300050513 Bacteria 6482
508 nmdc:mga08x19_18789_c1 3300050514 Bacteria 4237
509 nmdc:mga08x19_399_c1 3300050514 Bacteria 30610
510 nmdc:mga0a205_10976_c1 3300050515 Bacteria 8337
511 nmdc:mga0a205_131694_c1 3300050515 Bacteria 2401
512 nmdc:mga0a205_19323_c1 3300050515 Bacteria 6423
513 nmdc:mga0a205_32_c1 3300050515 Bacteria 79060
514 nmdc:mga0a205_33741_c1 3300050515 Bacteria 4908
515 nmdc:mga0a205_43821_c1 3300050515 Bacteria 4313
516 nmdc:mga0a205_50762_c1 3300050515 Bacteria 4005
517 nmdc:mga0a205_5347_c1 3300050515 Bacteria 11573
518 nmdc:mga0a205_55533_c1 3300050515 Bacteria 3825
519 nmdc:mga0a205_57716_c1 3300050515 Bacteria 3748
520 nmdc:mga0a205_65327_c1 3300050515 Bacteria 3515
521 Ga0500628_001016 3300053129 Bacteria 4903
522 Ga0501084_0000494 3300054114 Bacteria 30250
523 Ga0501084_0004153 3300054114 Bacteria 11804
524 Ga0501084_0008622 3300054114 Bacteria 8428
525 Ga0501084_0012477 3300054114 Bacteria 7041
526 Ga0501084_0055866 3300054114 Bacteria 3304
527 Ga0501084_0139170 3300054114 Bacteria 2044
528 Ga0501082_0000376 3300060353 Bacteria 39540
529 Ga0501082_0005247 3300060353 Bacteria 11261
530 Ga0501082_0012779 3300060353 Bacteria 7216
531 Ga0501082_0016069 3300060353 Bacteria 6439
532 Ga0501082_0043237 3300060353 Bacteria 3884
533 Ga0530510_0035303 3300061734 Bacteria 3603
534 Ga0105238_10000013
535 JGI26145J50221_1000569
536 Ga0065712_10078073
537 Ga0065715_10002243
538 Ga0065707_10094603
539 Ga0070676_10020004
540 Ga0070690_100033631
541 Ga0070670_100017109
542 Ga0070670_100057854
543 Ga0068869_100000454
544 Ga0068869_100002372
545 Ga0070680_100000745
546 Ga0070680_100170009
547 Ga0070682_100000164
548 Ga0068868_100011970
549 Ga0070660_100001192
550 Ga0070689_100001844
551 Ga0070689_100151087
552 Ga0070691_10005084
553 Ga0070691_10014674
554 Ga0070687_100001960
555 Ga0070661_100008371
556 Ga0070692_10000185
557 Ga0070692_10002417
558 Ga0070669_100021415
559 Ga0070673_100075603
560 Ga0070673_100102458
561 Ga0070688_100000685
562 Ga0070688_100009871
563 Ga0070659_100000169
564 Ga0070703_10028752
565 Ga0070701_10000434
566 Ga0070701_10024538
567 Ga0070701_10043040
568 Ga0070705_100018069
569 Ga0070705_100086402
570 Ga0070694_100000153
571 Ga0070694_100000394
572 Ga0070694_100003625
573 Ga0070694_100037165
574 Ga0070694_100041527
575 Ga0070708_100030956
576 Ga0070708_100053641
577 Ga0070708_100110492
578 Ga0070681_10030371
579 Ga0070681_10042257
580 Ga0068867_100003177
581 Ga0068867_100118067
582 Ga0070685_10002669
583 Ga0070706_100002480
584 Ga0070706_100038669
585 Ga0070706_100049561
586 Ga0070706_100111998
587 Ga0070707_100004480
588 Ga0070707_100029700
589 Ga0070707_100106664
590 Ga0070698_100002229
591 Ga0070698_100013773
592 Ga0070698_100015432
593 Ga0070698_100132543
594 Ga0070699_100007122
595 Ga0070699_100022592
596 Ga0070699_100028896
597 Ga0070699_100059410
598 Ga0070699_100074234
599 Ga0070679_100000780
600 Ga0070697_100004341
601 Ga0070697_100011711
602 Ga0070697_100016067
603 Ga0070697_100060234
604 Ga0070697_100076471
605 Ga0068853_100001544
606 Ga0070672_100023678
607 Ga0070672_100029057
608 Ga0070686_100000005
609 Ga0070695_100001873
610 Ga0070695_100002060
611 Ga0070695_100003497
612 Ga0070695_100004592
613 Ga0070696_100001217
614 Ga0070696_100162211
615 Ga0070693_100000018
616 Ga0070693_100045130
617 Ga0070704_100012918
618 Ga0070704_100015621
619 Ga0070704_100069128
620 Ga0068855_100000233
621 Ga0070664_100001518
622 Ga0068857_100024893
623 Ga0068857_100094110
624 Ga0068854_100000372
625 Ga0068856_100000806
626 Ga0068859_100003308
627 Ga0068864_100004417
628 Ga0068864_100032781
629 Ga0068861_100184408
630 Ga0068870_10000059
631 Ga0068870_10003266
632 Ga0068863_100041774
633 Ga0068863_100249167
634 Ga0068858_100026041
635 Ga0068860_100003577
636 Ga0068860_100017134
637 Ga0068860_100075469
638 Ga0068862_100004793
639 Ga0068862_100096325
640 Ga0068862_100127188
641 Ga0081455_10001251
642 Ga0081455_10040979
643 Ga0081538_10003971
644 Ga0081540_1016094
645 Ga0081539_10000092
646 Ga0070712_100001609
647 Ga0068871_100046576
648 Ga0075428_100000421
649 Ga0075428_100001299
650 Ga0075428_100002483
651 Ga0075428_100007223
652 Ga0075428_100019738
653 Ga0075428_100023192
654 Ga0075428_100030256
655 Ga0075430_100000103
656 Ga0075430_100000301
657 Ga0075430_100000341
658 Ga0075430_100002061
659 Ga0075430_100011035
660 Ga0075430_100039423
661 Ga0075430_100098720
662 Ga0075431_100000072
663 Ga0075431_100000339
664 Ga0075431_100000470
665 Ga0075431_100002219
666 Ga0075431_100002902
667 Ga0075431_100004853
668 Ga0075431_100005382
669 Ga0075431_100014905
670 Ga0075433_10000783
671 Ga0075433_10003027
672 Ga0075433_10005303
673 Ga0075433_10009022
674 Ga0075433_10015010
675 Ga0075433_10054172
676 Ga0075433_10067896
677 Ga0075433_10157932
678 Ga0075434_100001918
679 Ga0075434_100003368
680 Ga0075434_100014433
681 Ga0075434_100016705
682 Ga0075434_100023882
683 Ga0075434_100025611
684 Ga0075434_100031771
685 Ga0075434_100063510
686 Ga0075434_100074923
687 Ga0075434_100080694
688 Ga0075429_100000014
689 Ga0075429_100000169
690 Ga0075429_100000305
691 Ga0075429_100010608
692 Ga0075429_100047570
693 Ga0075429_100098795
694 Ga0075436_100001117
695 Ga0075436_100020775
696 Ga0097620_100003308
697 Ga0075435_100000798
698 Ga0075435_100010585
699 Ga0075435_100026498
700 Ga0075435_100030401
701 Ga0075435_100046221
702 Ga0075435_100226040
703 Ga0099794_10002669
704 Ga0099794_10006698
705 Ga0111539_10000557
706 Ga0111539_10008896
707 Ga0111539_10013419
708 Ga0111539_10159564
709 Ga0111539_10166243
710 Ga0105247_10025279
711 Ga0114129_10000704
712 Ga0114129_10000726
713 Ga0114129_10001085
714 Ga0114129_10002365
715 Ga0114129_10006119
716 Ga0114129_10009632
717 Ga0114129_10027225
718 Ga0114129_10030802
719 Ga0114129_10034435
720 Ga0114129_10039569
721 Ga0114129_10046202
722 Ga0114129_10083058
723 Ga0114129_10294797
724 Ga0114129_10418542
725 Ga0105243_10005054
726 Ga0105241_10002337
727 Ga0105241_10133394
728 Ga0105248_10153001
729 Ga0105248_10294887
730 Ga0105237_10139440
731 Ga0105239_10056136
732 Ga0157373_10007582
733 Ga0157373_10093046
734 Ga0157371_10036447
735 Ga0157370_10104620
736 Ga0157378_10056755
737 Ga0157378_10262644
738 Ga0163162_10037969
739 Ga0157375_10221895
740 Ga0163163_10017157
741 Ga0207653_10000836
742 Ga0207688_10033944
743 Ga0207647_10055210
744 Ga0207645_10000340
745 Ga0207645_10108854
746 Ga0207643_10000105
747 Ga0207684_10000242
748 Ga0207684_10007913
749 Ga0207684_10015825
750 Ga0207684_10023335
751 Ga0207684_10065669
752 Ga0207684_10075817
753 Ga0207684_10084029
754 Ga0207684_10089683
755 Ga0207684_10100792
756 Ga0207684_10145131
757 Ga0207684_10257066
758 Ga0207707_10000034
759 Ga0207707_10095175
760 Ga0207693_10019184
761 Ga0207660_10001489
762 Ga0207660_10017413
763 Ga0207660_10018530
764 Ga0207660_10075616
765 Ga0207662_10012480
766 Ga0207657_10000066
767 Ga0207649_10003921
768 Ga0207652_10000740
769 Ga0207646_10000574
770 Ga0207646_10004220
771 Ga0207646_10008590
772 Ga0207646_10045524
773 Ga0207646_10067055
774 Ga0207646_10081770
775 Ga0207646_10181986
776 Ga0207681_10013079
777 Ga0207694_10000026
778 Ga0207650_10042574
779 Ga0207690_10001729
780 Ga0207686_10036827
781 Ga0207709_10039249
782 Ga0207670_10000227
783 Ga0207670_10009664
784 Ga0207670_10055904
785 Ga0207665_10004527
786 Ga0207691_10026319
787 Ga0207691_10047273
788 Ga0207689_10000365
789 Ga0207689_10004878
790 Ga0207689_10009184
791 Ga0207679_10000248
792 Ga0207651_10033513
793 Ga0207651_10106548
794 Ga0207712_10014025
795 Ga0207640_10003855
796 Ga0207677_10021867
797 Ga0207703_10017210
798 Ga0207678_10002576
799 Ga0207702_10002703
800 Ga0207641_10060699
801 Ga0207641_10081442
802 Ga0207641_10109755
803 Ga0207648_10000856
804 Ga0207648_10057155
805 Ga0207648_10144012
806 Ga0207676_10013750
807 Ga0207676_10111649
808 Ga0207676_10158536
809 Ga0207674_10000050
810 Ga0207674_10091008
811 Ga0207675_100059243
812 Ga0209973_1000647
813 Ga0209996_1002066
814 Ga0209995_1000625
815 Ga0209970_1001083
816 Ga0210002_1001659
817 Ga0209983_1000978
818 Ga0209971_1000128
819 Ga0209966_1000071
820 Ga0209998_10000113
821 Ga0209974_10003286
822 Ga0207428_10000033
823 Ga0207428_10000054
824 Ga0207428_10000213
825 Ga0207428_10008425
826 Ga0207428_10040774
827 Ga0268265_10127253
828 Ga0268264_10004690
829 Ga0268264_10029403
830 Ga0265326_10002394
831 Ga0265319_1000340
832 Ga0265319_1002588
833 Ga0265334_10003273
834 Ga0265318_10002166
835 Ga0265323_10001268
836 Ga0265322_10001951
837 Ga0265336_10000109
838 Ga0265338_10001759
839 Ga0265338_10015892
840 Ga0265324_10001359
841 Ga0265330_10004782
842 Ga0265332_10001135
843 Ga0265320_10007425
844 Ga0265320_10028634
845 Ga0265325_10007958
846 Ga0265329_10002540
847 Ga0265339_10001023
848 Ga0265331_10006936
849 Ga0265316_10011778
850 Ga0265316_10021430
851 Ga0307408_100020223
852 Ga0307408_100056849
853 Ga0265313_10000728
854 Ga0265314_10005079
855 Ga0265342_10005224
856 Ga0307405_10023338
857 Ga0307410_10161391
858 Ga0307409_100028659
859 Ga0307411_10056470
860 Ga0373959_0000126
861 Ga0373959_0005494
862 Ga0373940_0001138
863 Ga0373940_0009158
864 Ga0373949_0002486
865 Ga0373932_0021798
866 Ga0373941_0025243
867 Ga0373960_0005764
868 Ga0373942_0007939
869 Ga0373961_0013609
870 Ga0373931_0001032
871 Ga0373933_0038008
872 Ga0395900_0003509
873 Ga0395900_0005123
874 Ga0395900_0038364
875 Ga0395898_0176777
876 Ga0395898_0191618
877 Ga0395905_0032970
878 Ga0395905_0188914
879 Ga0436364_1507082
880 Ga0395901_0001380
881 Ga0395901_0008385
882 Ga0395901_0011843
883 Ga0395901_0022100
884 Ga0242420_006184
885 Ga0439450_004526
886 Ga0439455_0007607
887 Ga0450889_004869
888 Ga0439464_0008575
889 Ga0439460_0004618
890 Ga0453683_0018255
891 Ga0453683_0038740
892 Ga0453683_0048876
893 Ga0466961_0003380
894 Ga0453684_0025528
895 Ga0453684_0099104
896 Ga0451576_0005487
897 Ga0451576_0012143
898 Ga0451576_0033448
899 Ga0451576_0038895
900 Ga0451576_0092310
901 Ga0451576_0199194
902 Ga0451576_0209941
903 Ga0495603_0151421
904 Ga0495580_0023796
905 Ga0495580_0046572
906 Ga0495584_0029594
907 Ga0495618_0000568
908 Ga0495628_0017705
909 Ga0495643_0000144
910 Ga0495642_0013888
911 Ga0495587_0011898
912 Ga0495600_0046920
913 Ga0496102_0014983
914 Ga0496102_0044734
915 Ga0496106_0166736
916 Ga0496108_0138779
917 Ga0496108_0223056
918 Ga0496110_0044500
919 Ga0501033_0009404
920 Ga0501033_0018150
921 Ga0501034_0065130
922 Ga0501036_0129057
923 Ga0501036_0166351
924 Ga0501037_0140631
925 Ga0501038_0048782
926 Ga0501038_0142387
927 Ga0501039_0012773
928 Ga0501039_0114173
929 Ga0501040_0012627
930 Ga0501040_0159816
931 Ga0501041_0001796
932 Ga0501042_0008891
933 Ga0501042_0059543
934 Ga0501046_0009916
935 Ga0501046_0050119
936 Ga0501046_0090523
937 Ga0501047_0001551
938 Ga0501047_0015428
939 Ga0501047_0020029
940 Ga0501067_0020043
941 Ga0501071_0046897
942 Ga0501071_0075474
943 Ga0501072_0018367
944 Ga0501072_0026081
945 Ga0501072_0088006
946 Ga0501074_0002552
947 Ga0501075_0000742
948 Ga0501075_0020507
949 Ga0501075_0024846
950 Ga0501075_0037146
951 Ga0501075_0068867
952 Ga0501075_0111618
953 Ga0501076_0002350
954 Ga0501076_0002927
955 Ga0501076_0043690
956 Ga0501076_0226640
957 Ga0501077_0096914
958 Ga0501079_0000847
959 Ga0501079_0001826
960 Ga0501079_0007619
961 Ga0501079_0010075
962 Ga0501081_0003354
963 Ga0501081_0003988
964 Ga0501081_0007247
965 Ga0501081_0009320
966 Ga0501081_0012977
967 Ga0501081_0112150
968 Ga0501083_0003803
969 Ga0501035_0000352
970 Ga0501044_0002748
971 Ga0501044_0047301
972 Ga0501045_0001154
973 Ga0501045_0010020
974 Ga0501045_0044819
975 nmdc:mga05p37_11107_c1
976 nmdc:mga05p37_132342_c1
977 nmdc:mga05p37_16568_c1
978 nmdc:mga05p37_18659_c1
979 nmdc:mga05p37_20033_c1
980 nmdc:mga05p37_20869_c1
981 nmdc:mga05p37_21239_c1
982 nmdc:mga05p37_25637_c1
983 nmdc:mga05p37_293005_c1
984 nmdc:mga05p37_320782_c1
985 nmdc:mga05p37_37004_c1
986 nmdc:mga05p37_4529_c1
987 nmdc:mga05p37_4740_c1
988 nmdc:mga05p37_4991_c1
989 nmdc:mga05p37_571_c1
990 nmdc:mga05p37_58063_c1
991 nmdc:mga05p37_58080_c1
992 nmdc:mga05p37_64990_c1
993 nmdc:mga05p37_99662_c1
994 nmdc:mga09592_112151_c1
995 nmdc:mga09592_116180_c1
996 nmdc:mga09592_22323_c1
997 nmdc:mga09592_2684_c1
998 nmdc:mga09592_39801_c1
999 nmdc:mga09592_45364_c1
1000 nmdc:mga09592_5004_c1
1001 nmdc:mga09592_5510_c1
1002 nmdc:mga09592_56_c1
1003 nmdc:mga09592_596_c1
1004 nmdc:mga09592_84099_c1
1005 nmdc:mga0qj67_10290_c1
1006 nmdc:mga0qj67_143391_c1
1007 nmdc:mga0qj67_40400_c1
1008 nmdc:mga0qj67_54404_c1
1009 nmdc:mga0qj67_711_c1
1010 nmdc:mga0qj67_761_c1
1011 nmdc:mga06r32_1136_c1
1012 nmdc:mga06r32_132_c1
1013 nmdc:mga06r32_14962_c1
1014 nmdc:mga06r32_16935_c1
1015 nmdc:mga06r32_414_c1
1016 nmdc:mga06r32_42468_c1
1017 nmdc:mga06r32_4664_c1
1018 nmdc:mga06r32_51433_c1
1019 nmdc:mga06r32_739_c1
1020 nmdc:mga06r32_8388_c1
1021 nmdc:mga08y16_324528_c1
1022 nmdc:mga08y16_3353_c1
1023 nmdc:mga08y16_569_c1
1024 nmdc:mga08y16_61998_c1
1025 nmdc:mga08y16_751_c1
1026 nmdc:mga08y16_9111_c1
1027 nmdc:mga0n895_191_c1
1028 nmdc:mga0n895_228983_c1
1029 nmdc:mga0n895_23889_c1
1030 nmdc:mga0n895_247213_c1
1031 nmdc:mga0n895_26_c1
1032 nmdc:mga0n895_33499_c1
1033 nmdc:mga0n895_33747_c1
1034 nmdc:mga0n895_34226_c1
1035 nmdc:mga0n895_67872_c1
1036 nmdc:mga0n895_9325_c1
1037 nmdc:mga0n895_99867_c1
1038 nmdc:mga0rr50_10638_c1
1039 nmdc:mga0rr50_176309_c1
1040 nmdc:mga0rr50_8223_c1
1041 nmdc:mga08x19_18789_c1
1042 nmdc:mga08x19_399_c1
1043 nmdc:mga0a205_10976_c1
1044 nmdc:mga0a205_131694_c1
1045 nmdc:mga0a205_19323_c1
1046 nmdc:mga0a205_32_c1
1047 nmdc:mga0a205_33741_c1
1048 nmdc:mga0a205_43821_c1
1049 nmdc:mga0a205_50762_c1
1050 nmdc:mga0a205_5347_c1
1051 nmdc:mga0a205_55533_c1
1052 nmdc:mga0a205_57716_c1
1053 nmdc:mga0a205_65327_c1
1054 Ga0500628_001016
1055 Ga0501084_0000494
1056 Ga0501084_0004153
1057 Ga0501084_0008622
1058 Ga0501084_0012477
1059 Ga0501084_0055866
1060 Ga0501084_0139170
1061 Ga0501082_0000376
1062 Ga0501082_0005247
1063 Ga0501082_0012779
1064 Ga0501082_0016069
1065 Ga0501082_0043237
1066 Ga0530510_0035303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03916

NrfD

Polysulphide reductase, NrfD

67

397

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8264 12 409
6btm-assembly1.cif.gz_C structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.8188 9 409
6f0k-assembly1.cif.gz_C alternative complex iii 0.817 12 416
6f0k-assembly1.cif.gz_C alternative complex iii 0.783 12 416
6loe-assembly1.cif.gz_C cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7795 12 409
ID Description Score Start End Superfamily
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.7117 44 350 1.20.1630.10
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6991 44 350 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6911 29 353 1.20.1630.10
af_P37180_41_337_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6566 29 353 1.20.1630.10
af_Q9Y4G6_789_912_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.5459 232 346 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A3B8WBV6-F1-model_v4 Hydrogenase 0.9914 231 351 GO:0016020
AF-A0A3B8WBV6-F1-model_v4 Hydrogenase 0.9676 231 351 GO:0016020
AF-A0A382YI40-F1-model_v4 Hydrogenase 0.9202 142 350 GO:0005886
AF-A0A382YI40-F1-model_v4 Hydrogenase 0.9078 142 350 GO:0005886
AF-A0A350PIB3-F1-model_v4 Hydrogenase 0.8928 180 409 GO:0005886

Map