metagRoot

F460328

General Info

Members	Datasets	Scaffolds	Average Seq Length
532	333	484	227

Family's Representative Sequence

Representative Sequence	3300048926\|Ga0496123_0089655\|Ga0496123_0089655_791_1540
Length	249
Sequence	MRSRKFLKAEQAPLVWDAPGLMAGVDEAGRGPLAGPVVAAAVILDDLRPIRGLADSKTLTALQRERLHDQILAKALCCSIAQATVEEIDTHNILQATMLAMRRAVEGLRLKPVKVLVDGNRLPTLDVLAEAIVKGDARVKAISAASILAKVHRDRLCEQLHTEFPHYGFAGHKGYGTPEHLEALQRHGACVHHRRSFSPVAAALARTGGVLNVMLPVQVVDGMNGVSGVTADMVIGVAEPVRLDLRAAP

Samples

	Sample ID	Description	Type	Environment
1	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
2	2547132374	Acidovorax radicis N35	Isolate	Unclassified
3	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
4	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
5	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
6	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
7	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
8	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
9	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
10	2643221658	Variovorax sp. Root411	Isolate	Unclassified
11	2643221672	Variovorax sp. Root434	Isolate	Unclassified
12	2643221683	Variovorax sp. Root473	Isolate	Unclassified
13	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
14	2738541277	Variovorax sp. GV051	Isolate	Unclassified
15	2738541307	Variovorax sp. GV008	Isolate	Unclassified
16	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
17	2738543013	Variovorax sp. BT01	Isolate	Unclassified
18	2738543019	Variovorax sp. GV040	Isolate	Unclassified
19	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
20	2818991446	Variovorax sp. 1180	Isolate	Unclassified
21	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
22	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
23	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
24	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
25	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
26	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
27	2885198086	Variovorax sp. 679	Isolate	Unclassified
28	2885211737	Variovorax sp. 553	Isolate	Unclassified
29	2899924645	Variovorax sp. 369	Isolate	Unclassified
30	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
31	2904456579	Variovorax sp. 2002	Isolate	Unclassified
32	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
33	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
34	2928037797	Variovorax sp. 1126	Isolate	Unclassified
35	2928044640	Variovorax sp. 1128	Isolate	Unclassified
36	2928051484	Variovorax sp. 1133	Isolate	Unclassified
37	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
38	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
39	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
40	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
41	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
42	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
43	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
44	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
45	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
46	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
47	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
48	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
49	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
50	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
51	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
52	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
53	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
54	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
55	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
56	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
57	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
58	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
59	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
60	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
61	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
62	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
63	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
64	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
65	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
66	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
67	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
68	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
69	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
70	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
71	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
72	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
73	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
74	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
75	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
76	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
77	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
78	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
79	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
80	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
81	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
82	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
83	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
84	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
85	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
86	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
87	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
88	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
89	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
90	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
91	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
92	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
93	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
94	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
95	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
96	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
97	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
98	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
99	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
100	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
101	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
102	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
103	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
104	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
105	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
106	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
107	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
108	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
109	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
110	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
111	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
112	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
113	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
114	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
115	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
116	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
117	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
118	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
119	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
120	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
121	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
122	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
123	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
124	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
125	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
126	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
127	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
128	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
129	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
130	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
131	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
132	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
133	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
134	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
135	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
136	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
137	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
138	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
139	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
140	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
141	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
142	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
144	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
145	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
146	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
148	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
151	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
152	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
154	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
192	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
197	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
198	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
199	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
200	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
201	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
202	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
203	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
204	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
205	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
206	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
207	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
208	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
209	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
210	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
211	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
212	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
213	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
214	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
215	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
216	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
217	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
218	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
219	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
220	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
221	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
222	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
223	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
224	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
225	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
226	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
227	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
228	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
229	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
230	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
231	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
232	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
233	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
234	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
235	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
236	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
237	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
238	3300042123	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228	Metagenome	Rhizosphere
239	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
240	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
241	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
242	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
243	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
244	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
245	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
246	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
247	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
248	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
249	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
250	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
251	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
252	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
253	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
254	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
255	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
256	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
257	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
258	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
259	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
260	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
261	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
262	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
263	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
264	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
265	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
266	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
267	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
268	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
269	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
270	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
271	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
272	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
273	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
274	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
275	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
276	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
277	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
278	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
279	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
280	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
281	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
282	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
283	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
284	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
285	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
286	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
287	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
288	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
289	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
290	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
291	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
292	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
293	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
294	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
295	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
296	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
297	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
298	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
299	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
300	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
301	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
302	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
303	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
304	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
305	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
306	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
307	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
308	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
309	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
310	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
311	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
312	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
313	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
314	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
315	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
316	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
317	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
318	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
319	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
320	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
321	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
322	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
323	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
324	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
325	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
326	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
327	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
328	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
329	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
330	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
331	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
332	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
333	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	90.41
Metatranscriptomes	0.56
Isolates	9.02

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	32.71
Nodule	0.75
Rhizoplane	3.57
Rhizosphere	48.87
Stem	0
Stem Tuber	0
Unclassified	14.1

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10005715	3300001979	Bacteria	5231
2	JGI25152J39213_1007270	3300002773	Bacteria	2891
3	JGI25152J39213_1008929	3300002773	Bacteria	2432
4	JGI25150J39212_1003237	3300002774	Bacteria	3848
5	JGI25150J39212_1010012	3300002774	Bacteria	1781
6	JGI25159J45721_1008640	3300002987	Bacteria	2776
7	JGI25159J45721_1008674	3300002987	Bacteria	2770
8	JGI25151J46595_10011029	3300003187	Bacteria	4172
9	JGI25151J46595_10012019	3300003187	Bacteria	3951
10	JGI25151J46595_10012786	3300003187	Bacteria	3803
11	JGI25151J46595_10020818	3300003187	Bacteria	2758
12	JGI25153J46596_10006888	3300003215	Bacteria	5675
13	JGI25153J46596_10018022	3300003215	Bacteria	2758
14	rootH1_10040779	3300003316	Bacteria	4159
15	rootH2_10134121	3300003320	Bacteria	1778
16	rootH2_10164701	3300003320	Bacteria	1835
17	JGI25160J50197_1013530	3300003354	Bacteria	2776
18	JGI25160J50197_1013569	3300003354	Bacteria	2770
19	JGI25161J50226_1004775	3300003374	Bacteria	2776
20	Ga0006562J51391_1057758	3300003578	Bacteria	4525
21	Ga0006562J51391_1057760	3300003578	Bacteria	3140
22	Ga0006562J51391_1168943	3300003578	Bacteria	2374
23	Ga0055535_1000565	3300003761	Bacteria	31393
24	Ga0055542_1000004	3300003762	Bacteria	553532
25	Ga0055526_1011495	3300003771	Bacteria	3978
26	Ga0055526_1013573	3300003771	Bacteria	3432
27	Ga0055526_1020744	3300003771	Bacteria	2318
28	Ga0055537_1000517	3300003773	Bacteria	22772
29	Ga0055537_1006948	3300003773	Bacteria	2797
30	Ga0055537_1007075	3300003773	Bacteria	2758
31	Ga0055524_1009408	3300003775	Bacteria	3976
32	Ga0055524_1015635	3300003775	Bacteria	2758
33	Ga0055536_1005393	3300003781	Bacteria	6265
34	Ga0055536_1006615	3300003781	Bacteria	5343
35	Ga0055536_1014681	3300003781	Bacteria	2727
36	Ga0055534_1000797	3300003784	Bacteria	14671
37	Ga0055534_1000912	3300003784	Bacteria	13322
38	Ga0055534_1002903	3300003784	Bacteria	5686
39	Ga0055534_1004581	3300003784	Bacteria	3951
40	Ga0055528_1003487	3300003790	Bacteria	7849
41	Ga0055528_1015183	3300003790	Bacteria	2797
42	Ga0055528_1015450	3300003790	Bacteria	2758
43	Ga0055530_10002424	3300003791	Bacteria	12070
44	Ga0055540_1005450	3300003792	Bacteria	5342
45	Ga0055540_1007311	3300003792	Bacteria	4197
46	Ga0055540_1010488	3300003792	Bacteria	3079
47	Ga0055540_1011983	3300003792	Bacteria	2752
48	Ga0055540_1018491	3300003792	Bacteria	1908
49	Ga0055531_10011609	3300003794	Bacteria	4226
50	Ga0055531_10019367	3300003794	Bacteria	2756
51	Ga0055531_10024617	3300003794	Bacteria	2214
52	Ga0055543_1006446	3300004625	Bacteria	2835
53	Ga0055543_1006537	3300004625	Bacteria	2802
54	Ga0065165_1016217	3300005262	Bacteria	2799
55	Ga0065165_1024877	3300005262	Bacteria	2002
56	Ga0065714_10006248	3300005288	Bacteria	4654
57	Ga0070676_10186905	3300005328	Bacteria	1350
58	Ga0070683_100638901	3300005329	Bacteria	1019
59	Ga0070677_10015931	3300005333	Bacteria	2669
60	Ga0068868_100058881	3300005338	Bacteria	3037
61	Ga0070661_100014556	3300005344	Bacteria	5544
62	Ga0070661_100193945	3300005344	Bacteria	1550
63	Ga0070668_100074187	3300005347	Bacteria	2654
64	Ga0070669_100038656	3300005353	Bacteria	3465
65	Ga0070669_100119811	3300005353	Bacteria	2006
66	Ga0070671_100331941	3300005355	Bacteria	1296
67	Ga0070674_100096845	3300005356	Bacteria	2142
68	Ga0070674_100181349	3300005356	Bacteria	1613
69	Ga0070659_100003584	3300005366	Bacteria	11044
70	Ga0070667_100308866	3300005367	Bacteria	1425
71	Ga0070700_100210247	3300005441	Bacteria	1372
72	Ga0070663_100151080	3300005455	Bacteria	1781
73	Ga0070662_100090726	3300005457	Bacteria	2294
74	Ga0068867_100003794	3300005459	Bacteria	10633
75	Ga0070684_100277864	3300005535	Bacteria	1534
76	Ga0068853_100062477	3300005539	Bacteria	3223
77	Ga0068853_100089365	3300005539	Bacteria	2705
78	Ga0068853_100510981	3300005539	Bacteria	1135
79	Ga0070672_100332344	3300005543	Bacteria	1293
80	Ga0070665_100070441	3300005548	Bacteria	3503
81	Ga0068855_100105467	3300005563	Bacteria	3240
82	Ga0068855_100125288	3300005563	Bacteria	2938
83	Ga0070664_100044685	3300005564	Bacteria	3740
84	Ga0070664_100053817	3300005564	Bacteria	3413
85	Ga0068857_100160877	3300005577	Bacteria	2037
86	Ga0068854_100682843	3300005578	Bacteria	885
87	Ga0068852_100014355	3300005616	Bacteria	6095
88	Ga0068852_100062958	3300005616	Bacteria	3228
89	Ga0068852_100411598	3300005616	Bacteria	1332
90	Ga0068859_100637190	3300005617	Bacteria	1158
91	Ga0068866_10035167	3300005718	Bacteria	2445
92	Ga0068861_100013699	3300005719	Bacteria	5678
93	Ga0068858_100109232	3300005842	Bacteria	2582
94	Ga0068860_100012061	3300005843	Bacteria	8511
95	Ga0068862_100015675	3300005844	Bacteria	6297
96	Ga0068862_100125933	3300005844	Bacteria	2262
97	Ga0075368_10073619	3300006042	Bacteria	1383
98	Ga0075363_100021159	3300006048	Bacteria	3272
99	Ga0075363_100048648	3300006048	Bacteria	2255
100	Ga0075363_100049875	3300006048	Bacteria	2229
101	Ga0075364_10049770	3300006051	Bacteria	2734
102	Ga0075362_10070033	3300006177	Bacteria	1600
103	Ga0075362_10081838	3300006177	Bacteria	1489
104	Ga0075367_10075531	3300006178	Bacteria	2033
105	Ga0075366_10008097	3300006195	Bacteria	5830
106	Ga0075366_10029845	3300006195	Bacteria	3204
107	Ga0075366_10031533	3300006195	Bacteria	3120
108	Ga0075366_10036975	3300006195	Bacteria	2880
109	Ga0075366_10257699	3300006195	Bacteria	1064
110	Ga0075370_10015145	3300006353	Bacteria	4122
111	Ga0075370_10019020	3300006353	Bacteria	3732
112	Ga0075370_10027866	3300006353	Bacteria	3137
113	Ga0075370_10054623	3300006353	Bacteria	2269
114	Ga0075370_10222426	3300006353	Bacteria	1116
115	Ga0068865_100001876	3300006881	Bacteria	12358
116	Ga0068865_100062038	3300006881	Bacteria	2623
117	Ga0097620_100637102	3300006931	Bacteria	1158
118	Ga0099826_10032460	3300006948	Bacteria	3764
119	Ga0099826_10085527	3300006948	Bacteria	1947
120	Ga0105244_10013562	3300009036	Bacteria	4754
121	Ga0105240_10068561	3300009093	Bacteria	4392
122	Ga0105240_10313076	3300009093	Bacteria	1792
123	Ga0105240_10391406	3300009093	Bacteria	1567
124	Ga0105245_10044061	3300009098	Bacteria	3982
125	Ga0105245_10361906	3300009098	Bacteria	1440
126	Ga0105243_10009566	3300009148	Bacteria	7380
127	Ga0105243_10029224	3300009148	Bacteria	4238
128	Ga0105241_10117821	3300009174	Bacteria	2134
129	Ga0105237_10124940	3300009545	Bacteria	2567
130	Ga0105238_10060933	3300009551	Bacteria	3777
131	Ga0105249_10128612	3300009553	Bacteria	2415
132	Ga0105239_10062335	3300010375	Bacteria	4092
133	Ga0105246_10035571	3300011119	Bacteria	3329
134	Ga0105246_10157199	3300011119	Bacteria	1728
135	Ga0157373_10141551	3300013100	Bacteria	1692
136	Ga0157373_10335341	3300013100	Bacteria	1077
137	Ga0157371_10068251	3300013102	Bacteria	2516
138	Ga0157371_10238705	3300013102	Bacteria	1307
139	Ga0157371_10408641	3300013102	Bacteria	994
140	Ga0157370_10049846	3300013104	Bacteria	4005
141	Ga0157369_10008736	3300013105	Bacteria	11607
142	Ga0157369_10027755	3300013105	Bacteria	6270
143	Ga0157378_10001293	3300013297	Bacteria	22554
144	Ga0163162_10002927	3300013306	Bacteria	16284
145	Ga0163162_10056434	3300013306	Bacteria	3955
146	Ga0163162_10259132	3300013306	Bacteria	1871
147	Ga0157372_10016275	3300013307	Bacteria	7981
148	Ga0157375_10005638	3300013308	Bacteria	10900
149	Ga0157375_10501002	3300013308	Bacteria	1378
150	Ga0157380_10011518	3300014326	Bacteria	6392
151	Ga0157380_11283658	3300014326	Bacteria	779
152	Ga0182008_10004629	3300014497	Bacteria	8007
153	Ga0182008_10013717	3300014497	Bacteria	4258
154	Ga0182008_10018820	3300014497	Bacteria	3573
155	Ga0157379_10017144	3300014968	Bacteria	6378
156	Ga0157379_10035840	3300014968	Bacteria	4424
157	Ga0157376_10239172	3300014969	Bacteria	1691
158	Ga0182006_1001462	3300015261	Bacteria	14236
159	Ga0182007_10000299	3300015262	Bacteria	32151
160	Ga0182007_10003566	3300015262	Bacteria	7320
161	Ga0183362_10001	3300015683	Bacteria	2046624
162	Ga0163161_10016142	3300017792	Bacteria	5213
163	Ga0163161_10030121	3300017792	Bacteria	3860
164	Ga0163161_10068532	3300017792	Bacteria	2592
165	Ga0209258_100022	3300025242	Bacteria	553584
166	Ga0207425_1000496	3300025245	Bacteria	24684
167	Ga0207425_1004744	3300025245	Bacteria	4004
168	Ga0209148_1000034	3300025254	Bacteria	553584
169	Ga0209129_1000023	3300025258	Bacteria	420646
170	Ga0209129_1005099	3300025258	Bacteria	4816
171	Ga0209565_1000114	3300025263	Bacteria	116078
172	Ga0209565_1000125	3300025263	Bacteria	110485
173	Ga0209565_1000471	3300025263	Bacteria	30241
174	Ga0209673_1000192	3300025273	Bacteria	123155
175	Ga0209673_1002101	3300025273	Bacteria	14957
176	Ga0209673_1002567	3300025273	Bacteria	12332
177	Ga0209673_1026912	3300025273	Bacteria	1880
178	Ga0209673_1043386	3300025273	Bacteria	1256
179	Ga0209130_1000069	3300025284	Bacteria	179177
180	Ga0209130_1001539	3300025284	Bacteria	14744
181	Ga0209130_1001710	3300025284	Bacteria	13240
182	Ga0209675_1000029	3300025291	Bacteria	281053
183	Ga0209675_1000693	3300025291	Bacteria	23430
184	Ga0209675_1000694	3300025291	Bacteria	23424
185	Ga0209675_1000707	3300025291	Bacteria	22937
186	Ga0209675_1015099	3300025291	Bacteria	2313
187	Ga0209676_1000005	3300025292	Bacteria	1076001
188	Ga0209676_1000285	3300025292	Bacteria	104459
189	Ga0209676_1000614	3300025292	Bacteria	52075
190	Ga0209676_1000923	3300025292	Bacteria	36308
191	Ga0209676_1003259	3300025292	Bacteria	10211
192	Ga0209676_1010220	3300025292	Bacteria	3944
193	Ga0209676_1037823	3300025292	Bacteria	1387
194	Ga0209025_1000316	3300025294	Bacteria	107447
195	Ga0209025_1000435	3300025294	Bacteria	82663
196	Ga0209025_1000652	3300025294	Bacteria	60620
197	Ga0209025_1002952	3300025294	Bacteria	16911
198	Ga0209025_1038217	3300025294	Bacteria	2115
199	Ga0209564_1000270	3300025295	Bacteria	108503
200	Ga0209564_1000791	3300025295	Bacteria	43583
201	Ga0209758_1000064	3300025297	Bacteria	311812
202	Ga0209758_1011778	3300025297	Bacteria	5009
203	Ga0209050_1000007	3300025298	Bacteria	1187891
204	Ga0209050_1001583	3300025298	Bacteria	23577
205	Ga0209050_1004672	3300025298	Bacteria	9103
206	Ga0209256_1000020	3300025299	Bacteria	542402
207	Ga0209256_1000022	3300025299	Bacteria	481843
208	Ga0209256_1017947	3300025299	Bacteria	2324
209	Ga0207426_1000001	3300025302	Bacteria	1341301
210	Ga0207426_1000031	3300025302	Bacteria	460699
211	Ga0207426_1050931	3300025302	Bacteria	1232
212	Ga0209051_1000036	3300025303	Bacteria	339863
213	Ga0209051_1000465	3300025303	Bacteria	53039
214	Ga0209051_1000711	3300025303	Bacteria	36515
215	Ga0209051_1001116	3300025303	Bacteria	24506
216	Ga0209051_1011938	3300025303	Bacteria	4242
217	Ga0209051_1040233	3300025303	Bacteria	1678
218	Ga0209051_1072425	3300025303	Bacteria	1030
219	Ga0209257_1000011	3300025304	Bacteria	1112630
220	Ga0209257_1000821	3300025304	Bacteria	45031
221	Ga0209257_1027137	3300025304	Bacteria	1912
222	Ga0207656_10046404	3300025321	Bacteria	1864
223	Ga0207655_1000916	3300025728	Bacteria	30603
224	Ga0207682_10049037	3300025893	Bacteria	1742
225	Ga0207642_10079162	3300025899	Bacteria	1590
226	Ga0207645_10119666	3300025907	Bacteria	1709
227	Ga0207705_10044460	3300025909	Bacteria	3192
228	Ga0207695_10185361	3300025913	Bacteria	2000
229	Ga0207695_10224827	3300025913	Bacteria	1783
230	Ga0207649_10000417	3300025920	Bacteria	31299
231	Ga0207681_10047729	3300025923	Bacteria	2887
232	Ga0207681_10183263	3300025923	Bacteria	1596
233	Ga0207694_10032877	3300025924	Bacteria	3973
234	Ga0207694_10323074	3300025924	Bacteria	1274
235	Ga0207659_10401908	3300025926	Bacteria	1146
236	Ga0207644_10290288	3300025931	Bacteria	1315
237	Ga0207690_10152064	3300025932	Bacteria	1716
238	Ga0207706_10014026	3300025933	Bacteria	7266
239	Ga0207686_10122190	3300025934	Bacteria	1774
240	Ga0207709_10000478	3300025935	Bacteria	36537
241	Ga0207709_10000653	3300025935	Bacteria	28149
242	Ga0207709_10105675	3300025935	Bacteria	1871
243	Ga0207709_10136960	3300025935	Bacteria	1677
244	Ga0207669_10235243	3300025937	Bacteria	1354
245	Ga0207704_10001317	3300025938	Bacteria	11110
246	Ga0207704_10042042	3300025938	Bacteria	2687
247	Ga0207691_10324902	3300025940	Bacteria	1319
248	Ga0207691_10366149	3300025940	Bacteria	1232
249	Ga0207689_10178674	3300025942	Bacteria	1750
250	Ga0207679_10000200	3300025945	Bacteria	48169
251	Ga0207679_10072145	3300025945	Bacteria	2607
252	Ga0207667_10095353	3300025949	Bacteria	3071
253	Ga0207667_10182533	3300025949	Bacteria	2154
254	Ga0207651_10169289	3300025960	Bacteria	1721
255	Ga0207712_10122505	3300025961	Bacteria	1969
256	Ga0207658_10000754	3300025986	Bacteria	27858
257	Ga0207658_10140871	3300025986	Bacteria	1951
258	Ga0207677_10062140	3300026023	Bacteria	2589
259	Ga0207677_10348090	3300026023	Bacteria	1241
260	Ga0207703_10094806	3300026035	Bacteria	2517
261	Ga0207639_10103250	3300026041	Bacteria	2309
262	Ga0207678_10174417	3300026067	Bacteria	1836
263	Ga0207708_10265300	3300026075	Bacteria	1387
264	Ga0207648_10014226	3300026089	Bacteria	7359
265	Ga0207674_10164194	3300026116	Bacteria	2175
266	Ga0207683_10097913	3300026121	Bacteria	2617
267	Ga0207683_10122400	3300026121	Bacteria	2336
268	Ga0207698_10009355	3300026142	Bacteria	6245
269	Ga0209282_1000094	3300027666	Bacteria	61877
270	Ga0209974_10049562	3300027876	Bacteria	1409
271	Ga0268266_10204901	3300028379	Bacteria	1807
272	Ga0268266_10393917	3300028379	Bacteria	1308
273	Ga0268265_10041973	3300028380	Bacteria	3390
274	Ga0268264_10160249	3300028381	Bacteria	2026
275	Ga0307517_10229181	3300028786	Bacteria	1118
276	Ga0307515_10063163	3300028794	Bacteria	5210
277	Ga0307515_10212518	3300028794	Bacteria	1775
278	Ga0307515_10388695	3300028794	Bacteria	1025
279	Ga0316179_1105361	3300030734	Bacteria	1546
280	Ga0316180_1090273	3300030736	Bacteria	1278
281	Ga0316181_1116937	3300030744	Bacteria	2092
282	Ga0316182_1066914	3300030745	Bacteria	3740
283	Ga0316182_1115469	3300030745	Bacteria	2705
284	Ga0265327_10007439	3300031251	Bacteria	8449
285	Ga0307513_10000006	3300031456	Bacteria	470848
286	Ga0307513_10085366	3300031456	Bacteria	3240
287	Ga0307513_10198073	3300031456	Bacteria	1853
288	Ga0307509_10159977	3300031507	Bacteria	2152
289	Ga0307509_10297651	3300031507	Bacteria	1364
290	Ga0307408_100242669	3300031548	Bacteria	1481
291	Ga0307408_100271777	3300031548	Bacteria	1407
292	Ga0307408_100564044	3300031548	Bacteria	1006
293	Ga0307408_100580239	3300031548	Bacteria	993
294	Ga0307514_10051538	3300031649	Bacteria	3189
295	Ga0265314_10327452	3300031711	Bacteria	850
296	Ga0307516_10027742	3300031730	Bacteria	5739
297	Ga0307405_10032495	3300031731	Bacteria	3085
298	Ga0307405_10094065	3300031731	Bacteria	1992
299	Ga0307410_10416058	3300031852	Bacteria	1089
300	Ga0307406_10016086	3300031901	Bacteria	4339
301	Ga0307406_10121658	3300031901	Bacteria	1816
302	Ga0307412_10069305	3300031911	Bacteria	2400
303	Ga0307412_10396025	3300031911	Bacteria	1123
304	Ga0307412_10406703	3300031911	Bacteria	1110
305	Ga0307416_100243261	3300032002	Bacteria	1745
306	Ga0307414_10022029	3300032004	Bacteria	4010
307	Ga0307414_10172737	3300032004	Bacteria	1729
308	Ga0307414_10375328	3300032004	Bacteria	1228
309	Ga0307411_10183677	3300032005	Bacteria	1590
310	Ga0307411_10314095	3300032005	Bacteria	1262
311	Ga0307510_10058449	3300033180	Bacteria	3992
312	Ga0373931_0246128	3300035691	Bacteria	1086
313	Ga0373925_0048232	3300037068	Bacteria	3173
314	Ga0395900_0555488	3300037418	Bacteria	1092
315	Ga0395898_0275695	3300037466	Bacteria	1604
316	Ga0395901_0047217	3300038443	Bacteria	4471
317	Ga0439436_0002750	3300041404	Bacteria	5316
318	Ga0439436_0052593	3300041404	Bacteria	1148
319	Ga0439439_0002165	3300041406	Bacteria	4122
320	Ga0439447_015390	3300041407	Bacteria	2123
321	Ga0439447_022672	3300041407	Bacteria	1642
322	Ga0439461_0008513	3300041410	Bacteria	1840
323	Ga0439466_0015324	3300041411	Bacteria	2785
324	Ga0439466_0032341	3300041411	Bacteria	1784
325	Ga0439465_0011647	3300041413	Bacteria	2759
326	Ga0451791_0106561	3300041451	Bacteria	1020
327	Ga0439431_0000590	3300041997	Bacteria	7681
328	Ga0439431_0005565	3300041997	Bacteria	2779
329	Ga0439433_0000567	3300041999	Bacteria	7015
330	Ga0439445_0026530	3300042004	Bacteria	1483
331	Ga0439432_009840	3300042006	Bacteria	3325
332	Ga0439449_0001151	3300042007	Bacteria	10381
333	Ga0439452_001770	3300042010	Bacteria	8426
334	Ga0439457_002985	3300042014	Bacteria	4702
335	Ga0439462_0006539	3300042015	Bacteria	2897
336	Ga0450919_011439	3300042121	Bacteria	1010
337	Ga0450921_000807	3300042123	Bacteria	1669
338	Ga0450923_026427	3300042125	Bacteria	1163
339	Ga0450923_032866	3300042125	Bacteria	1065
340	Ga0450899_004454	3300042135	Bacteria	1500
341	Ga0450906_002960	3300042145	Bacteria	3689
342	Ga0450906_004122	3300042145	Bacteria	3074
343	Ga0450907_012136	3300042146	Bacteria	1432
344	Ga0450910_011580	3300042147	Bacteria	1266
345	Ga0439446_0014464	3300042156	Bacteria	2179
346	Ga0450908_003143	3300042184	Bacteria	3218
347	Ga0439434_0018215	3300042435	Bacteria	2100
348	Ga0450918_000141	3300042531	Bacteria	15768
349	Ga0451577_0001353	3300042876	Bacteria	33109
350	Ga0451577_0016346	3300042876	Bacteria	6875
351	Ga0451577_0021755	3300042876	Bacteria	5864
352	Ga0466965_0022079	3300044683	Bacteria	3068
353	Ga0453684_0028245	3300044712	Bacteria	8016
354	Ga0453684_0264447	3300044712	Bacteria	1969
355	Ga0466960_0127005	3300044901	Bacteria	1341
356	Ga0451576_0002066	3300045051	Bacteria	31484
357	Ga0451576_0082437	3300045051	Bacteria	3345
358	Ga0495627_009544	3300046453	Bacteria	3565
359	Ga0495627_019068	3300046453	Bacteria	2305
360	Ga0495650_0050624	3300046471	Bacteria	1716
361	Ga0495616_0005502	3300046513	Bacteria	7783
362	Ga0495618_0148315	3300046514	Bacteria	1499
363	Ga0495620_0038679	3300046515	Bacteria	2115
364	Ga0495630_0137606	3300046517	Bacteria	1856
365	Ga0495630_0459628	3300046517	Bacteria	975
366	Ga0495631_0001491	3300046518	Bacteria	14163
367	Ga0495632_0006526	3300046519	Bacteria	7487
368	Ga0495637_0036596	3300046520	Bacteria	2136
369	Ga0495642_0134539	3300046528	Bacteria	1065
370	Ga0495654_0068740	3300046530	Bacteria	1683
371	Ga0495586_0191712	3300046535	Bacteria	1158
372	Ga0495609_0038333	3300046538	Bacteria	2161
373	Ga0495621_0003606	3300046539	Bacteria	4276
374	Ga0495656_0018956	3300046615	Bacteria	2649
375	Ga0495668_0064116	3300046616	Bacteria	2023
376	Ga0495625_0003637	3300046660	Bacteria	15115
377	Ga0495625_0066886	3300046660	Bacteria	2530
378	Ga0495588_0101311	3300046674	Bacteria	1513
379	Ga0495588_0171164	3300046674	Bacteria	1148
380	Ga0495613_0052553	3300046689	Bacteria	3001
381	Ga0495624_0032373	3300046690	Bacteria	3391
382	Ga0495671_0008813	3300046692	Bacteria	5665
383	Ga0495660_0120739	3300046810	Bacteria	1326
384	Ga0495676_0070511	3300047321	Bacteria	2691
385	Ga0495676_0126965	3300047321	Bacteria	1847
386	Ga0495676_0196152	3300047321	Bacteria	1406
387	Ga0495593_0021407	3300047673	Bacteria	3613
388	Ga0495593_0066441	3300047673	Bacteria	1879
389	Ga0495615_0071952	3300048090	Bacteria	933
390	Ga0496100_0031584	3300048903	Bacteria	3294
391	Ga0496101_0002384	3300048904	Bacteria	11530
392	Ga0496101_0071764	3300048904	Bacteria	2539
393	Ga0496102_0069391	3300048905	Bacteria	3235
394	Ga0496102_0155427	3300048905	Bacteria	2150
395	Ga0496103_0167474	3300048906	Bacteria	1410
396	Ga0496104_0002611	3300048907	Bacteria	15520
397	Ga0496105_0265754	3300048908	Bacteria	1386
398	Ga0496106_0081543	3300048909	Bacteria	2485
399	Ga0496108_0091683	3300048911	Bacteria	2583
400	Ga0496109_0046906	3300048912	Bacteria	3926
401	Ga0496110_0076583	3300048913	Bacteria	2974
402	Ga0496111_0038676	3300048914	Bacteria	3419
403	Ga0496112_0675159	3300048915	Bacteria	962
404	Ga0496114_0086678	3300048917	Bacteria	2654
405	Ga0496116_0046571	3300048919	Bacteria	2926
406	Ga0496117_0042123	3300048920	Bacteria	3336
407	Ga0496117_0060788	3300048920	Bacteria	2601
408	Ga0496117_0102879	3300048920	Bacteria	1801
409	Ga0496117_0255576	3300048920	Bacteria	953
410	Ga0496117_0288029	3300048920	Bacteria	876
411	Ga0496118_0045498	3300048921	Bacteria	3425
412	Ga0496119_0095011	3300048922	Bacteria	1685
413	Ga0496121_0075757	3300048924	Bacteria	2686
414	Ga0496121_0115452	3300048924	Bacteria	2038
415	Ga0496121_0138028	3300048924	Bacteria	1813
416	Ga0496121_0149040	3300048924	Bacteria	1724
417	Ga0496121_0162454	3300048924	Bacteria	1632
418	Ga0496122_0000428	3300048925	Bacteria	88816
419	Ga0496122_0203725	3300048925	Bacteria	1154
420	Ga0496123_0000890	3300048926	Bacteria	47301
421	Ga0496123_0020099	3300048926	Bacteria	5238
422	Ga0496123_0049075	3300048926	Bacteria	2834
423	Ga0496123_0089655	3300048926	Bacteria	1831
424	Ga0496123_0114912	3300048926	Bacteria	1529
425	Ga0496124_0009588	3300048927	Bacteria	9929
426	Ga0496124_0027162	3300048927	Bacteria	5143
427	Ga0496124_0143391	3300048927	Bacteria	1882
428	Ga0496124_0207411	3300048927	Bacteria	1485
429	Ga0496125_0018681	3300048928	Bacteria	6575
430	Ga0496125_0052692	3300048928	Bacteria	3344
431	Ga0496125_0281752	3300048928	Bacteria	1029
432	Ga0496126_0117539	3300048929	Bacteria	2310
433	Ga0501249_009924	3300049679	Bacteria	1984
434	Ga0501262_000140	3300049759	Bacteria	9019
435	nmdc:mga03683_10446_c1	3300050489	Bacteria	2189
436	nmdc:mga03683_14740_c2	3300050489	Bacteria	1308
437	nmdc:mga03683_177393_c1	3300050489	Bacteria	971
438	nmdc:mga03683_224770_c1	3300050489	Bacteria	867
439	nmdc:mga03n38_100233_c1	3300050490	Bacteria	1396
440	nmdc:mga03n38_12749_c1	3300050490	Bacteria	3173
441	nmdc:mga03n38_40769_c1	3300050490	Bacteria	2019
442	nmdc:mga0yw44_196890_c1	3300050492	Bacteria	1330
443	nmdc:mga0yw44_41094_c1	3300050492	Bacteria	2751
444	nmdc:mga0k408_109973_c1	3300050493	Bacteria	1629
445	nmdc:mga0k408_32890_c1	3300050493	Bacteria	2963
446	nmdc:mga0k408_35197_c1	3300050493	Bacteria	2871
447	nmdc:mga0k408_35565_c1	3300050493	Bacteria	2856
448	nmdc:mga0k408_68830_c1	3300050493	Bacteria	2065
449	nmdc:mga0k408_91519_c1	3300050493	Bacteria	1787
450	nmdc:mga06z11_122128_c1	3300050494	Bacteria	1454
451	nmdc:mga04h51_54786_c1	3300050495	Bacteria	1349
452	nmdc:mga07m45_31232_c1	3300050496	Bacteria	2951
453	nmdc:mga07m45_414343_c1	3300050496	Bacteria	782
454	nmdc:mga07m45_45047_c1	3300050496	Bacteria	2476
455	nmdc:mga07m45_8648_c1	3300050496	Bacteria	5243
456	nmdc:mga07m45_92875_c1	3300050496	Bacteria	1730
457	nmdc:mga0sz30_59732_c1	3300050516	Bacteria	1338
458	Ga0500610_0008393	3300053079	Bacteria	4499
459	Ga0500610_0011742	3300053079	Bacteria	4004
460	Ga0500643_022563	3300053087	Bacteria	2023
461	Ga0500651_0006036	3300053093	Bacteria	6956
462	Ga0500571_000476	3300053110	Bacteria	16306
463	Ga0500592_007004	3300053116	Bacteria	1793
464	Ga0500593_000666	3300053117	Bacteria	13069
465	Ga0500594_0002230	3300053118	Bacteria	4195
466	Ga0500607_010124	3300053121	Bacteria	5635
467	Ga0500607_052987	3300053121	Bacteria	2152
468	Ga0500608_004657	3300053122	Bacteria	5341
469	Ga0500618_015792	3300053125	Bacteria	1901
470	Ga0500626_093336	3300053128	Bacteria	1319
471	Ga0500655_001312	3300053133	Bacteria	4716
472	Ga0500658_0004899	3300053134	Bacteria	4990
473	Ga0500658_0004911	3300053134	Bacteria	4986
474	Ga0500559_0001970	3300053136	Bacteria	11089
475	Ga0500564_054645	3300053138	Bacteria	1821
476	Ga0500568_0003724	3300053139	Bacteria	8355
477	Ga0500573_0050670	3300053140	Bacteria	2388
478	Ga0500574_001649	3300053141	Bacteria	3410
479	Ga0500619_000015	3300053154	Bacteria	54620
480	Ga0500627_0003757	3300053158	Bacteria	4761
481	Ga0500634_0004638	3300053161	Bacteria	6395
482	Ga0500634_0010370	3300053161	Bacteria	4760
483	Ga0500638_072597	3300053162	Bacteria	1643
484	Ga0500636_0137191	3300053177	Bacteria	1357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300013102	Ga0157371_10408641	Ga0157371_104086412	200
2	3300048920	Ga0496117_0288029	Ga0496117_0288029_204_863	200
3	3300009553	Ga0105249_10128612	Ga0105249_101286122	201
4	3300013297	Ga0157378_10001293	Ga0157378_1000129314	201
5	3300013306	Ga0163162_10002927	Ga0163162_100029274	201
6	3300013308	Ga0157375_10005638	Ga0157375_100056382	201
7	3300014326	Ga0157380_10011518	Ga0157380_100115188	201
8	3300014968	Ga0157379_10017144	Ga0157379_100171445	201
9	3300003784	Ga0055534_1000912	Ga0055534_10009125	202
10	3300025273	Ga0209673_1043386	Ga0209673_10433861	202
11	3300025284	Ga0209130_1001710	Ga0209130_100171014	202
12	3300025291	Ga0209675_1000707	Ga0209675_10007076	202
13	3300025303	Ga0209051_1011938	Ga0209051_10119384	202
14	3300045051	Ga0451576_0002066	Ga0451576_0002066_26641_27297	202
15	iso_pu_bacteria	2547132374	2548496924	202
16	iso_pu_bacteria	2643221717	2644645572	202
17	3300005329	Ga0070683_100638901	Ga0070683_1006389012	203
18	3300005535	Ga0070684_100277864	Ga0070684_1002778642	203
19	3300005539	Ga0068853_100510981	Ga0068853_1005109812	203
20	3300005563	Ga0068855_100125288	Ga0068855_1001252882	203
21	3300005578	Ga0068854_100682843	Ga0068854_1006828431	203
22	3300005616	Ga0068852_100014355	Ga0068852_1000143554	203
23	3300009093	Ga0105240_10068561	Ga0105240_100685615	203
24	3300009551	Ga0105238_10060933	Ga0105238_100609334	203
25	3300013105	Ga0157369_10027755	Ga0157369_100277555	203
26	3300013307	Ga0157372_10016275	Ga0157372_100162754	203
27	3300025292	Ga0209676_1003259	Ga0209676_10032598	203
28	3300025909	Ga0207705_10044460	Ga0207705_100444604	203
29	3300025913	Ga0207695_10185361	Ga0207695_101853613	203
30	3300025924	Ga0207694_10032877	Ga0207694_100328773	203
31	3300025949	Ga0207667_10095353	Ga0207667_100953532	203
32	3300026142	Ga0207698_10009355	Ga0207698_100093554	203
33	3300046674	Ga0495588_0101311	Ga0495588_0101311_26_637	203
34	3300006881	Ga0068865_100062038	Ga0068865_1000620383	204
35	3300009098	Ga0105245_10361906	Ga0105245_103619062	204
36	3300014968	Ga0157379_10035840	Ga0157379_100358403	204
37	3300025938	Ga0207704_10042042	Ga0207704_100420422	204
38	3300025986	Ga0207658_10000754	Ga0207658_1000075425	204
39	3300031456	Ga0307513_10085366	Ga0307513_100853662	204
40	3300031507	Ga0307509_10159977	Ga0307509_101599772	204
41	3300031507	Ga0307509_10297651	Ga0307509_102976512	204
42	3300033180	Ga0307510_10058449	Ga0307510_100584493	204
43	3300037068	Ga0373925_0048232	Ga0373925_0048232_2460_3074	204
44	3300046517	Ga0495630_0137606	Ga0495630_0137606_789_1403	204
45	3300046690	Ga0495624_0032373	Ga0495624_0032373_603_1217	204
46	3300047321	Ga0495676_0070511	Ga0495676_0070511_1154_1768	204
47	3300047673	Ga0495593_0066441	Ga0495593_0066441_1056_1670	204
48	3300048924	Ga0496121_0162454	Ga0496121_0162454_582_1196	204
49	3300053136	Ga0500559_0001970	Ga0500559_0001970_4001_4615	204
50	iso_pu_bacteria	2643221654	2644304822	204
51	3300028794	Ga0307515_10063163	Ga0307515_100631632	205
52	3300028794	Ga0307515_10212518	Ga0307515_102125182	205
53	3300031456	Ga0307513_10000006	Ga0307513_1000000657	205
54	3300031730	Ga0307516_10027742	Ga0307516_100277425	205
55	3300044712	Ga0453684_0028245	Ga0453684_0028245_2859_3482	205
56	3300053093	Ga0500651_0006036	Ga0500651_0006036_5437_6054	205
57	3300027876	Ga0209974_10049562	Ga0209974_100495622	206
58	3300031548	Ga0307408_100580239	Ga0307408_1005802391	206
59	3300042125	Ga0450923_032866	Ga0450923_032866_210_836	206
60	3300042876	Ga0451577_0016346	Ga0451577_0016346_2767_3387	206
61	3300044712	Ga0453684_0264447	Ga0453684_0264447_1016_1636	206
62	3300053154	Ga0500619_000015	Ga0500619_000015_7707_8327	206
63	3300005328	Ga0070676_10186905	Ga0070676_101869052	207
64	3300005347	Ga0070668_100074187	Ga0070668_1000741872	207
65	3300005353	Ga0070669_100038656	Ga0070669_1000386564	207
66	3300005355	Ga0070671_100331941	Ga0070671_1003319411	207
67	3300005356	Ga0070674_100181349	Ga0070674_1001813492	207
68	3300005367	Ga0070667_100308866	Ga0070667_1003088662	207
69	3300005441	Ga0070700_100210247	Ga0070700_1002102472	207
70	3300005455	Ga0070663_100151080	Ga0070663_1001510802	207
71	3300005459	Ga0068867_100003794	Ga0068867_1000037949	207
72	3300005616	Ga0068852_100411598	Ga0068852_1004115982	207
73	3300005617	Ga0068859_100637190	Ga0068859_1006371902	207
74	3300005718	Ga0068866_10035167	Ga0068866_100351672	207
75	3300005719	Ga0068861_100013699	Ga0068861_1000136994	207
76	3300005842	Ga0068858_100109232	Ga0068858_1001092322	207
77	3300005843	Ga0068860_100012061	Ga0068860_1000120619	207
78	3300005844	Ga0068862_100015675	Ga0068862_1000156757	207
79	3300006353	Ga0075370_10222426	Ga0075370_102224262	207
80	3300006881	Ga0068865_100001876	Ga0068865_1000018764	207
81	3300006931	Ga0097620_100637102	Ga0097620_1006371022	207
82	3300025899	Ga0207642_10079162	Ga0207642_100791622	207
83	3300025907	Ga0207645_10119666	Ga0207645_101196662	207
84	3300025923	Ga0207681_10047729	Ga0207681_100477292	207
85	3300025931	Ga0207644_10290288	Ga0207644_102902882	207
86	3300025934	Ga0207686_10122190	Ga0207686_101221902	207
87	3300025935	Ga0207709_10105675	Ga0207709_101056752	207
88	3300025937	Ga0207669_10235243	Ga0207669_102352432	207
89	3300025938	Ga0207704_10001317	Ga0207704_100013179	207
90	3300025961	Ga0207712_10122505	Ga0207712_101225052	207
91	3300025986	Ga0207658_10140871	Ga0207658_101408712	207
92	3300026035	Ga0207703_10094806	Ga0207703_100948062	207
93	3300026067	Ga0207678_10174417	Ga0207678_101744172	207
94	3300026075	Ga0207708_10265300	Ga0207708_102653002	207
95	3300026089	Ga0207648_10014226	Ga0207648_100142264	207
96	3300026121	Ga0207683_10122400	Ga0207683_101224003	207
97	3300028381	Ga0268264_10160249	Ga0268264_101602492	207
98	3300048905	Ga0496102_0155427	Ga0496102_0155427_888_1523	207
99	3300050496	nmdc:mga07m45_45047_c1	nmdc:mga07m45_45047_c1_268_891	207
100	iso_pu_bacteria	2738543012	2739245420	207
101	iso_pu_bacteria	2816332133	2816474783	207
102	3300031456	Ga0307513_10198073	Ga0307513_101980732	208
103	3300045051	Ga0451576_0082437	Ga0451576_0082437_78_761	208
104	3300050495	nmdc:mga04h51_54786_c1	nmdc:mga04h51_54786_c1_638_1336	208
105	3300053140	Ga0500573_0050670	Ga0500573_0050670_202_879	208
106	3300025935	Ga0207709_10136960	Ga0207709_101369602	209
107	3300031711	Ga0265314_10327452	Ga0265314_103274522	209
108	3300042876	Ga0451577_0001353	Ga0451577_0001353_692_1324	209
109	3300050493	nmdc:mga0k408_35197_c1	nmdc:mga0k408_35197_c1_26_742	209
110	iso_pu_bacteria	2939631187	2939634766	209
111	3300006195	Ga0075366_10031533	Ga0075366_100315334	210
112	3300011119	Ga0105246_10157199	Ga0105246_101571992	210
113	3300013306	Ga0163162_10056434	Ga0163162_100564342	210
114	3300013306	Ga0163162_10259132	Ga0163162_102591322	210
115	3300013308	Ga0157375_10501002	Ga0157375_105010022	210
116	3300014969	Ga0157376_10239172	Ga0157376_102391722	210
117	3300025273	Ga0209673_1026912	Ga0209673_10269122	210
118	3300025292	Ga0209676_1037823	Ga0209676_10378232	210
119	3300005333	Ga0070677_10015931	Ga0070677_100159312	211
120	iso_pu_bacteria	2928115317	2928116358	211
121	3300005344	Ga0070661_100014556	Ga0070661_1000145564	212
122	3300005366	Ga0070659_100003584	Ga0070659_1000035849	212
123	3300005564	Ga0070664_100044685	Ga0070664_1000446854	212
124	3300014497	Ga0182008_10013717	Ga0182008_100137173	212
125	3300015262	Ga0182007_10003566	Ga0182007_100035664	212
126	3300025920	Ga0207649_10000417	Ga0207649_1000041735	212
127	3300025932	Ga0207690_10152064	Ga0207690_101520642	212
128	3300025945	Ga0207679_10000200	Ga0207679_1000020038	212
129	iso_pu_bacteria	2738543013	2739250812	212
130	3300031911	Ga0307412_10406703	Ga0307412_104067032	213
131	3300044683	Ga0466965_0022079	Ga0466965_0022079_1477_2181	213
132	3300044901	Ga0466960_0127005	Ga0466960_0127005_547_1251	213
133	iso_pu_bacteria	2643221611	2644076474	213
134	3300005353	Ga0070669_100119811	Ga0070669_1001198112	214
135	3300025258	Ga0209129_1005099	Ga0209129_10050994	214
136	3300025294	Ga0209025_1000435	Ga0209025_100043552	214
137	3300025923	Ga0207681_10183263	Ga0207681_101832632	214
138	3300046519	Ga0495632_0006526	Ga0495632_0006526_972_1634	214
139	3300003187	JGI25151J46595_10011029	JGI25151J46595_100110294	215
140	3300006042	Ga0075368_10073619	Ga0075368_100736192	215
141	3300006353	Ga0075370_10019020	Ga0075370_100190204	215
142	3300035691	Ga0373931_0246128	Ga0373931_0246128_53_718	215
143	3300005543	Ga0070672_100332344	Ga0070672_1003323442	216
144	3300006048	Ga0075363_100049875	Ga0075363_1000498752	216
145	3300006177	Ga0075362_10070033	Ga0075362_100700332	216
146	3300006178	Ga0075367_10075531	Ga0075367_100755312	216
147	3300009093	Ga0105240_10313076	Ga0105240_103130762	216
148	3300009545	Ga0105237_10124940	Ga0105237_101249402	216
149	3300013105	Ga0157369_10008736	Ga0157369_100087363	216
150	3300025893	Ga0207682_10049037	Ga0207682_100490371	216
151	3300025926	Ga0207659_10401908	Ga0207659_104019082	216
152	3300025940	Ga0207691_10366149	Ga0207691_103661492	216
153	3300028379	Ga0268266_10204901	Ga0268266_102049012	216
154	3300037418	Ga0395900_0555488	Ga0395900_0555488_89_742	216
155	3300037466	Ga0395898_0275695	Ga0395898_0275695_342_995	216
156	3300038443	Ga0395901_0047217	Ga0395901_0047217_2921_3574	216
157	3300046514	Ga0495618_0148315	Ga0495618_0148315_438_1094	216
158	3300046517	Ga0495630_0459628	Ga0495630_0459628_96_752	216
159	3300046528	Ga0495642_0134539	Ga0495642_0134539_170_826	216
160	3300048903	Ga0496100_0031584	Ga0496100_0031584_1052_1708	216
161	3300048904	Ga0496101_0002384	Ga0496101_0002384_8240_8896	216
162	3300048905	Ga0496102_0069391	Ga0496102_0069391_2045_2701	216
163	3300048907	Ga0496104_0002611	Ga0496104_0002611_13910_14566	216
164	3300048908	Ga0496105_0265754	Ga0496105_0265754_101_757	216
165	3300048909	Ga0496106_0081543	Ga0496106_0081543_178_834	216
166	3300048914	Ga0496111_0038676	Ga0496111_0038676_2007_2663	216
167	3300048920	Ga0496117_0255576	Ga0496117_0255576_249_914	216
168	3300048927	Ga0496124_0027162	Ga0496124_0027162_2606_3256	216
169	3300050493	nmdc:mga0k408_32890_c1	nmdc:mga0k408_32890_c1_373_1026	216
170	3300050496	nmdc:mga07m45_414343_c1	nmdc:mga07m45_414343_c1_44_697	216
171	3300053125	Ga0500618_015792	Ga0500618_015792_915_1586	216
172	3300014497	Ga0182008_10004629	Ga0182008_100046294	217
173	3300031911	Ga0307412_10396025	Ga0307412_103960252	217
174	3300005338	Ga0068868_100058881	Ga0068868_1000588812	218
175	3300009098	Ga0105245_10044061	Ga0105245_100440615	218
176	3300009174	Ga0105241_10117821	Ga0105241_101178213	218
177	3300025942	Ga0207689_10178674	Ga0207689_101786742	218
178	3300026023	Ga0207677_10062140	Ga0207677_100621402	218
179	3300026023	Ga0207677_10348090	Ga0207677_103480902	218
180	3300026121	Ga0207683_10097913	Ga0207683_100979132	218
181	3300046535	Ga0495586_0191712	Ga0495586_0191712_14_682	218
182	3300046689	Ga0495613_0052553	Ga0495613_0052553_1788_2456	218
183	3300047321	Ga0495676_0196152	Ga0495676_0196152_590_1258	218
184	3300048911	Ga0496108_0091683	Ga0496108_0091683_1605_2273	218
185	3300048912	Ga0496109_0046906	Ga0496109_0046906_2880_3548	218
186	3300048913	Ga0496110_0076583	Ga0496110_0076583_1684_2352	218
187	3300048915	Ga0496112_0675159	Ga0496112_0675159_23_691	218
188	3300048917	Ga0496114_0086678	Ga0496114_0086678_1349_2017	218
189	3300013100	Ga0157373_10335341	Ga0157373_103353412	219
190	3300048922	Ga0496119_0095011	Ga0496119_0095011_985_1644	219
191	3300015683	Ga0183362_10001	Ga0183362_100011411	220
192	3300048927	Ga0496124_0009588	Ga0496124_0009588_695_1417	220
193	3300048929	Ga0496126_0117539	Ga0496126_0117539_35_757	220
194	iso_pu_bacteria	2643221628	2644159530	220
195	3300048925	Ga0496122_0000428	Ga0496122_0000428_52041_52763	221
196	3300048926	Ga0496123_0000890	Ga0496123_0000890_10529_11251	221
197	iso_pu_bacteria	2513020051	2513230968	221
198	iso_pu_bacteria	2643221658	2644327982	221
199	iso_pu_bacteria	2643221672	2644398711	221
200	iso_pu_bacteria	2885198086	2885198915	221
201	3300041407	Ga0439447_022672	Ga0439447_022672_795_1496	222
202	3300041411	Ga0439466_0015324	Ga0439466_0015324_1965_2666	222
203	3300042876	Ga0451577_0021755	Ga0451577_0021755_2209_2886	222
204	3300025298	Ga0209050_1004672	Ga0209050_10046723	223
205	3300025924	Ga0207694_10323074	Ga0207694_103230741	223
206	3300006048	Ga0075363_100021159	Ga0075363_1000211593	224
207	3300006048	Ga0075363_100048648	Ga0075363_1000486483	224
208	3300006195	Ga0075366_10008097	Ga0075366_100080973	224
209	3300006195	Ga0075366_10036975	Ga0075366_100369752	224
210	3300006353	Ga0075370_10027866	Ga0075370_100278664	224
211	3300006948	Ga0099826_10085527	Ga0099826_100855272	224
212	3300017792	Ga0163161_10030121	Ga0163161_100301214	224
213	3300032004	Ga0307414_10172737	Ga0307414_101727372	224
214	3300032005	Ga0307411_10314095	Ga0307411_103140952	224
215	3300050493	nmdc:mga0k408_35565_c1	nmdc:mga0k408_35565_c1_502_1176	224
216	3300050494	nmdc:mga06z11_122128_c1	nmdc:mga06z11_122128_c1_664_1338	224
217	iso_pu_bacteria	2904541872	2904544674	224
218	iso_pu_bacteria	2929160207	2929163654	224
219	3300005288	Ga0065714_10006248	Ga0065714_100062485	225
220	3300005564	Ga0070664_100053817	Ga0070664_1000538173	225
221	3300005577	Ga0068857_100160877	Ga0068857_1001608772	225
222	3300005616	Ga0068852_100062958	Ga0068852_1000629582	225
223	3300005844	Ga0068862_100125933	Ga0068862_1001259332	225
224	3300006051	Ga0075364_10049770	Ga0075364_100497703	225
225	3300006195	Ga0075366_10029845	Ga0075366_100298451	225
226	3300025292	Ga0209676_1000923	Ga0209676_10009232	225
227	3300025298	Ga0209050_1001583	Ga0209050_100158322	225
228	3300025303	Ga0209051_1001116	Ga0209051_100111622	225
229	3300025304	Ga0209257_1000821	Ga0209257_100082144	225
230	3300025728	Ga0207655_1000916	Ga0207655_100091630	225
231	3300025933	Ga0207706_10014026	Ga0207706_100140267	225
232	3300025935	Ga0207709_10000653	Ga0207709_1000065324	225
233	3300025945	Ga0207679_10072145	Ga0207679_100721452	225
234	3300026041	Ga0207639_10103250	Ga0207639_101032502	225
235	3300026116	Ga0207674_10164194	Ga0207674_101641942	225
236	3300028380	Ga0268265_10041973	Ga0268265_100419732	225
237	3300028786	Ga0307517_10229181	Ga0307517_102291812	225
238	3300048926	Ga0496123_0049075	Ga0496123_0049075_338_1030	225
239	3300053121	Ga0500607_010124	Ga0500607_010124_2248_2925	225
240	3300002774	JGI25150J39212_1010012	JGI25150J39212_10100121	226
241	3300003187	JGI25151J46595_10012019	JGI25151J46595_100120194	226
242	3300003578	Ga0006562J51391_1168943	Ga0006562J51391_11689432	226
243	3300003771	Ga0055526_1013573	Ga0055526_10135734	226
244	3300003781	Ga0055536_1005393	Ga0055536_10053933	226
245	3300005262	Ga0065165_1024877	Ga0065165_10248772	226
246	3300009036	Ga0105244_10013562	Ga0105244_100135624	226
247	3300009148	Ga0105243_10029224	Ga0105243_100292245	226
248	3300011119	Ga0105246_10035571	Ga0105246_100355714	226
249	3300015261	Ga0182006_1001462	Ga0182006_100146214	226
250	3300015262	Ga0182007_10000299	Ga0182007_1000029933	226
251	3300031251	Ga0265327_10007439	Ga0265327_100074398	226
252	3300042135	Ga0450899_004454	Ga0450899_004454_499_1233	226
253	3300042184	Ga0450908_003143	Ga0450908_003143_2242_2976	226
254	3300046539	Ga0495621_0003606	Ga0495621_0003606_1655_2365	226
255	3300050493	nmdc:mga0k408_91519_c1	nmdc:mga0k408_91519_c1_210_935	227
256	iso_pu_bacteria	2885211737	2885212822	227
257	3300041406	Ga0439439_0002165	Ga0439439_0002165_1351_2070	228
258	3300041410	Ga0439461_0008513	Ga0439461_0008513_477_1196	228
259	3300042125	Ga0450923_026427	Ga0450923_026427_366_1085	228
260	3300042145	Ga0450906_004122	Ga0450906_004122_1876_2595	228
261	3300042156	Ga0439446_0014464	Ga0439446_0014464_246_965	228
262	iso_pu_bacteria	2885192300	2885192770	228
263	3300005548	Ga0070665_100070441	Ga0070665_1000704412	229
264	3300025960	Ga0207651_10169289	Ga0207651_101692892	229
265	3300028379	Ga0268266_10393917	Ga0268266_103939172	229
266	3300041451	Ga0451791_0106561	Ga0451791_0106561_277_969	229
267	3300046471	Ga0495650_0050624	Ga0495650_0050624_955_1647	229
268	3300046810	Ga0495660_0120739	Ga0495660_0120739_402_1091	229
269	iso_pu_bacteria	2842733646	2842734809	229
270	iso_pu_bacteria	2842747753	2842751475	229
271	iso_pu_bacteria	2904449895	2904454496	229
272	iso_pu_bacteria	2904456579	2904461061	229
273	iso_pu_bacteria	2919462493	2919465938	229
274	3300003187	JGI25151J46595_10012786	JGI25151J46595_100127863	230
275	3300049679	Ga0501249_009924	Ga0501249_009924_1178_1897	230
276	iso_pu_bacteria	2838054893	2838057087	230
277	iso_pu_bacteria	2928037797	2928038704	230
278	iso_pu_bacteria	2928051484	2928053308	230
279	3300005356	Ga0070674_100096845	Ga0070674_1000968452	231
280	3300010375	Ga0105239_10062335	Ga0105239_100623354	231
281	3300014326	Ga0157380_11283658	Ga0157380_112836581	231
282	3300025940	Ga0207691_10324902	Ga0207691_103249022	231
283	3300041404	Ga0439436_0052593	Ga0439436_0052593_338_1036	231
284	3300046538	Ga0495609_0038333	Ga0495609_0038333_818_1534	231
285	3300046615	Ga0495656_0018956	Ga0495656_0018956_1602_2303	231
286	3300048090	Ga0495615_0071952	Ga0495615_0071952_35_736	231
287	3300025294	Ga0209025_1000652	Ga0209025_10006523	232
288	3300041404	Ga0439436_0002750	Ga0439436_0002750_1855_2562	232
289	3300041407	Ga0439447_015390	Ga0439447_015390_523_1230	232
290	3300041411	Ga0439466_0032341	Ga0439466_0032341_1051_1758	232
291	3300041413	Ga0439465_0011647	Ga0439465_0011647_47_754	232
292	3300041997	Ga0439431_0000590	Ga0439431_0000590_1468_2175	232
293	3300041999	Ga0439433_0000567	Ga0439433_0000567_164_871	232
294	3300042004	Ga0439445_0026530	Ga0439445_0026530_228_935	232
295	3300042006	Ga0439432_009840	Ga0439432_009840_1004_1711	232
296	3300042007	Ga0439449_0001151	Ga0439449_0001151_8442_9149	232
297	3300042010	Ga0439452_001770	Ga0439452_001770_6718_7425	232
298	3300042014	Ga0439457_002985	Ga0439457_002985_2243_2950	232
299	3300042015	Ga0439462_0006539	Ga0439462_0006539_653_1360	232
300	3300042435	Ga0439434_0018215	Ga0439434_0018215_451_1158	232
301	3300006195	Ga0075366_10257699	Ga0075366_102576992	233
302	3300013100	Ga0157373_10141551	Ga0157373_101415512	233
303	3300013104	Ga0157370_10049846	Ga0157370_100498464	233
304	3300014497	Ga0182008_10018820	Ga0182008_100188203	233
305	3300050489	nmdc:mga03683_177393_c1	nmdc:mga03683_177393_c1_173_892	233
306	3300050490	nmdc:mga03n38_40769_c1	nmdc:mga03n38_40769_c1_1221_1940	233
307	3300050516	nmdc:mga0sz30_59732_c1	nmdc:mga0sz30_59732_c1_231_950	233
308	3300009093	Ga0105240_10391406	Ga0105240_103914062	234
309	3300009148	Ga0105243_10009566	Ga0105243_100095662	234
310	3300013102	Ga0157371_10068251	Ga0157371_100682512	234
311	3300013102	Ga0157371_10238705	Ga0157371_102387052	234
312	3300046530	Ga0495654_0068740	Ga0495654_0068740_764_1471	234
313	3300048927	Ga0496124_0207411	Ga0496124_0207411_110_814	234
314	3300053128	Ga0500626_093336	Ga0500626_093336_415_1119	234
315	iso_pu_bacteria	2945909444	2945912333	234
316	iso_pu_bacteria	2945984333	2945985353	234
317	3300028794	Ga0307515_10388695	Ga0307515_103886952	235
318	3300046453	Ga0495627_019068	Ga0495627_019068_40_747	235
319	3300046515	Ga0495620_0038679	Ga0495620_0038679_1089_1796	235
320	3300046674	Ga0495588_0171164	Ga0495588_0171164_288_995	235
321	3300046692	Ga0495671_0008813	Ga0495671_0008813_2655_3362	235
322	3300053079	Ga0500610_0008393	Ga0500610_0008393_1229_1936	235
323	3300053079	Ga0500610_0011742	Ga0500610_0011742_2319_3026	235
324	3300053117	Ga0500593_000666	Ga0500593_000666_689_1396	235
325	3300053158	Ga0500627_0003757	Ga0500627_0003757_2477_3184	235
326	3300053161	Ga0500634_0004638	Ga0500634_0004638_3986_4693	235
327	iso_pu_bacteria	2842677519	2842678888	235
328	iso_pu_bacteria	2929520902	2929526945	235
329	iso_pu_bacteria	2945945610	2945948255	235
330	iso_pu_bacteria	2945972063	2945977104	235
331	iso_pu_bacteria	2954767861	2954772375	235
332	iso_pu_bacteria	2599185214	2599624411	236
333	iso_pu_bacteria	2599185226	2599672727	236
334	iso_pu_bacteria	2599185227	2599683727	236
335	iso_pu_bacteria	2599185229	2599694336	236
336	iso_pu_bacteria	2643221683	2644468495	236
337	iso_pu_bacteria	2738541277	2738720289	236
338	iso_pu_bacteria	2738541307	2738881830	236
339	iso_pu_bacteria	2738543019	2739279488	236
340	iso_pu_bacteria	2818991446	2819595825	236
341	iso_pu_bacteria	2831265667	2831267028	236
342	iso_pu_bacteria	2899924645	2899925171	236
343	iso_pu_bacteria	2928044640	2928045691	236
344	iso_pu_bacteria	2928064002	2928066913	236
345	iso_pu_bacteria	2928070936	2928071206	236
346	iso_pu_bacteria	2928084124	2928084869	236
347	3300003773	Ga0055537_1000517	Ga0055537_100051710	237
348	3300003784	Ga0055534_1000797	Ga0055534_100079714	237
349	3300003790	Ga0055528_1003487	Ga0055528_10034875	237
350	3300005563	Ga0068855_100105467	Ga0068855_1001054672	237
351	3300006353	Ga0075370_10015145	Ga0075370_100151453	237
352	3300006948	Ga0099826_10032460	Ga0099826_100324603	237
353	3300025263	Ga0209565_1000114	Ga0209565_100011433	237
354	3300025273	Ga0209673_1002567	Ga0209673_10025672	237
355	3300025291	Ga0209675_1000029	Ga0209675_1000029198	237
356	3300025299	Ga0209256_1017947	Ga0209256_10179472	237
357	3300025913	Ga0207695_10224827	Ga0207695_102248272	237
358	3300025949	Ga0207667_10182533	Ga0207667_101825332	237
359	3300027666	Ga0209282_1000094	Ga0209282_100009441	237
360	3300042121	Ga0450919_011439	Ga0450919_011439_223_939	237
361	3300042123	Ga0450921_000807	Ga0450921_000807_631_1347	237
362	3300042531	Ga0450918_000141	Ga0450918_000141_13450_14166	237
363	3300048925	Ga0496122_0203725	Ga0496122_0203725_56_769	237
364	3300050496	nmdc:mga07m45_8648_c1	nmdc:mga07m45_8648_c1_2362_3078	237
365	3300031911	Ga0307412_10069305	Ga0307412_100693053	238
366	3300046453	Ga0495627_009544	Ga0495627_009544_677_1435	238
367	3300046660	Ga0495625_0003637	Ga0495625_0003637_976_1695	238
368	3300050489	nmdc:mga03683_224770_c1	nmdc:mga03683_224770_c1_84_803	238
369	3300050490	nmdc:mga03n38_12749_c1	nmdc:mga03n38_12749_c1_1407_2126	238
370	3300050492	nmdc:mga0yw44_41094_c1	nmdc:mga0yw44_41094_c1_1055_1774	238
371	3300050493	nmdc:mga0k408_109973_c1	nmdc:mga0k408_109973_c1_465_1184	238
372	3300003578	Ga0006562J51391_1057758	Ga0006562J51391_10577585	239
373	3300003578	Ga0006562J51391_1057760	Ga0006562J51391_10577602	239
374	3300003781	Ga0055536_1014681	Ga0055536_10146814	239
375	3300003792	Ga0055540_1007311	Ga0055540_10073114	239
376	3300003792	Ga0055540_1010488	Ga0055540_10104883	239
377	3300003794	Ga0055531_10011609	Ga0055531_100116094	239
378	3300005344	Ga0070661_100193945	Ga0070661_1001939452	239
379	3300005457	Ga0070662_100090726	Ga0070662_1000907262	239
380	3300005539	Ga0068853_100062477	Ga0068853_1000624772	239
381	3300006177	Ga0075362_10081838	Ga0075362_100818382	239
382	3300017792	Ga0163161_10016142	Ga0163161_100161423	239
383	3300025303	Ga0209051_1000465	Ga0209051_100046521	239
384	3300030734	Ga0316179_1105361	Ga0316179_11053611	239
385	3300030736	Ga0316180_1090273	Ga0316180_10902732	239
386	3300030744	Ga0316181_1116937	Ga0316181_11169372	239
387	3300030745	Ga0316182_1066914	Ga0316182_10669142	239
388	3300031548	Ga0307408_100242669	Ga0307408_1002426692	239
389	3300031548	Ga0307408_100271777	Ga0307408_1002717772	239
390	3300031548	Ga0307408_100564044	Ga0307408_1005640442	239
391	3300031649	Ga0307514_10051538	Ga0307514_100515383	239
392	3300031731	Ga0307405_10094065	Ga0307405_100940652	239
393	3300031852	Ga0307410_10416058	Ga0307410_104160581	239
394	3300031901	Ga0307406_10016086	Ga0307406_100160865	239
395	3300031901	Ga0307406_10121658	Ga0307406_101216582	239
396	3300032002	Ga0307416_100243261	Ga0307416_1002432612	239
397	3300032004	Ga0307414_10022029	Ga0307414_100220292	239
398	3300032005	Ga0307411_10183677	Ga0307411_101836772	239
399	3300041997	Ga0439431_0005565	Ga0439431_0005565_874_1596	239
400	3300042145	Ga0450906_002960	Ga0450906_002960_464_1186	239
401	3300042146	Ga0450907_012136	Ga0450907_012136_219_941	239
402	3300042147	Ga0450910_011580	Ga0450910_011580_284_1006	239
403	3300048906	Ga0496103_0167474	Ga0496103_0167474_118_840	239
404	3300048920	Ga0496117_0102879	Ga0496117_0102879_21_743	239
405	3300048924	Ga0496121_0075757	Ga0496121_0075757_1116_1838	239
406	3300048927	Ga0496124_0143391	Ga0496124_0143391_1022_1744	239
407	3300048928	Ga0496125_0018681	Ga0496125_0018681_4239_4961	239
408	3300048928	Ga0496125_0281752	Ga0496125_0281752_290_1012	239
409	3300049759	Ga0501262_000140	Ga0501262_000140_4443_5162	239
410	3300050489	nmdc:mga03683_10446_c1	nmdc:mga03683_10446_c1_1357_2079	239
411	3300050489	nmdc:mga03683_14740_c2	nmdc:mga03683_14740_c2_502_1224	239
412	3300050490	nmdc:mga03n38_100233_c1	nmdc:mga03n38_100233_c1_193_915	239
413	3300050492	nmdc:mga0yw44_196890_c1	nmdc:mga0yw44_196890_c1_163_885	239
414	3300050493	nmdc:mga0k408_68830_c1	nmdc:mga0k408_68830_c1_131_853	239
415	3300050496	nmdc:mga07m45_92875_c1	nmdc:mga07m45_92875_c1_491_1213	239
416	3300053122	Ga0500608_004657	Ga0500608_004657_4062_4781	239
417	3300001979	JGI24740J21852_10005715	JGI24740J21852_100057153	240
418	3300002773	JGI25152J39213_1007270	JGI25152J39213_10072702	240
419	3300002773	JGI25152J39213_1008929	JGI25152J39213_10089292	240
420	3300002774	JGI25150J39212_1003237	JGI25150J39212_10032373	240
421	3300002987	JGI25159J45721_1008640	JGI25159J45721_10086402	240
422	3300002987	JGI25159J45721_1008674	JGI25159J45721_10086742	240
423	3300003187	JGI25151J46595_10020818	JGI25151J46595_100208182	240
424	3300003215	JGI25153J46596_10006888	JGI25153J46596_100068886	240
425	3300003215	JGI25153J46596_10018022	JGI25153J46596_100180222	240
426	3300003316	rootH1_10040779	rootH1_100407792	240
427	3300003320	rootH2_10134121	rootH2_101341212	240
428	3300003320	rootH2_10164701	rootH2_101647012	240
429	3300003354	JGI25160J50197_1013530	JGI25160J50197_10135302	240
430	3300003354	JGI25160J50197_1013569	JGI25160J50197_10135692	240
431	3300003374	JGI25161J50226_1004775	JGI25161J50226_10047752	240
432	3300003761	Ga0055535_1000565	Ga0055535_100056519	240
433	3300003762	Ga0055542_1000004	Ga0055542_100000432	240
434	3300003771	Ga0055526_1011495	Ga0055526_10114954	240
435	3300003771	Ga0055526_1020744	Ga0055526_10207442	240
436	3300003773	Ga0055537_1006948	Ga0055537_10069482	240
437	3300003773	Ga0055537_1007075	Ga0055537_10070752	240
438	3300003775	Ga0055524_1009408	Ga0055524_10094084	240
439	3300003775	Ga0055524_1015635	Ga0055524_10156352	240
440	3300003781	Ga0055536_1006615	Ga0055536_10066156	240
441	3300003784	Ga0055534_1002903	Ga0055534_10029036	240
442	3300003784	Ga0055534_1004581	Ga0055534_10045812	240
443	3300003790	Ga0055528_1015183	Ga0055528_10151832	240
444	3300003790	Ga0055528_1015450	Ga0055528_10154502	240
445	3300003791	Ga0055530_10002424	Ga0055530_1000242411	240
446	3300003792	Ga0055540_1005450	Ga0055540_10054506	240
447	3300003792	Ga0055540_1011983	Ga0055540_10119832	240
448	3300003792	Ga0055540_1018491	Ga0055540_10184912	240
449	3300003794	Ga0055531_10019367	Ga0055531_100193672	240
450	3300003794	Ga0055531_10024617	Ga0055531_100246172	240
451	3300004625	Ga0055543_1006446	Ga0055543_10064462	240
452	3300004625	Ga0055543_1006537	Ga0055543_10065372	240
453	3300005262	Ga0065165_1016217	Ga0065165_10162172	240
454	3300005539	Ga0068853_100089365	Ga0068853_1000893652	240
455	3300006353	Ga0075370_10054623	Ga0075370_100546232	240
456	3300017792	Ga0163161_10068532	Ga0163161_100685322	240
457	3300025242	Ga0209258_100022	Ga0209258_10002232	240
458	3300025245	Ga0207425_1000496	Ga0207425_10004963	240
459	3300025245	Ga0207425_1004744	Ga0207425_10047442	240
460	3300025254	Ga0209148_1000034	Ga0209148_100003432	240
461	3300025258	Ga0209129_1000023	Ga0209129_1000023110	240
462	3300025263	Ga0209565_1000125	Ga0209565_100012594	240
463	3300025263	Ga0209565_1000471	Ga0209565_100047121	240
464	3300025273	Ga0209673_1000192	Ga0209673_100019298	240
465	3300025273	Ga0209673_1002101	Ga0209673_100210111	240
466	3300025284	Ga0209130_1000069	Ga0209130_1000069113	240
467	3300025284	Ga0209130_1001539	Ga0209130_10015392	240
468	3300025291	Ga0209675_1000693	Ga0209675_10006932	240
469	3300025291	Ga0209675_1000694	Ga0209675_100069421	240
470	3300025291	Ga0209675_1015099	Ga0209675_10150992	240
471	3300025292	Ga0209676_1000005	Ga0209676_1000005691	240
472	3300025292	Ga0209676_1000285	Ga0209676_100028598	240
473	3300025292	Ga0209676_1000614	Ga0209676_100061452	240
474	3300025292	Ga0209676_1010220	Ga0209676_10102202	240
475	3300025294	Ga0209025_1000316	Ga0209025_100031653	240
476	3300025294	Ga0209025_1002952	Ga0209025_100295217	240
477	3300025294	Ga0209025_1038217	Ga0209025_10382173	240
478	3300025295	Ga0209564_1000270	Ga0209564_10002704	240
479	3300025295	Ga0209564_1000791	Ga0209564_10007914	240
480	3300025297	Ga0209758_1000064	Ga0209758_100006411	240
481	3300025297	Ga0209758_1011778	Ga0209758_10117782	240
482	3300025298	Ga0209050_1000007	Ga0209050_1000007406	240
483	3300025299	Ga0209256_1000020	Ga0209256_1000020382	240
484	3300025299	Ga0209256_1000022	Ga0209256_100002253	240
485	3300025302	Ga0207426_1000001	Ga0207426_10000011017	240
486	3300025302	Ga0207426_1000031	Ga0207426_1000031209	240
487	3300025302	Ga0207426_1050931	Ga0207426_10509312	240
488	3300025303	Ga0209051_1000036	Ga0209051_100003642	240
489	3300025303	Ga0209051_1000711	Ga0209051_10007112	240
490	3300025303	Ga0209051_1040233	Ga0209051_10402332	240
491	3300025303	Ga0209051_1072425	Ga0209051_10724252	240
492	3300025304	Ga0209257_1000011	Ga0209257_1000011665	240
493	3300025304	Ga0209257_1027137	Ga0209257_10271372	240
494	3300025321	Ga0207656_10046404	Ga0207656_100464042	240
495	3300025935	Ga0207709_10000478	Ga0207709_100004782	240
496	3300030745	Ga0316182_1115469	Ga0316182_11154692	240
497	3300031731	Ga0307405_10032495	Ga0307405_100324953	240
498	3300032004	Ga0307414_10375328	Ga0307414_103753282	240
499	3300046513	Ga0495616_0005502	Ga0495616_0005502_529_1254	240
500	3300046518	Ga0495631_0001491	Ga0495631_0001491_11598_12320	240
501	3300046520	Ga0495637_0036596	Ga0495637_0036596_421_1143	240
502	3300046616	Ga0495668_0064116	Ga0495668_0064116_498_1220	240
503	3300046660	Ga0495625_0066886	Ga0495625_0066886_798_1520	240
504	3300047321	Ga0495676_0126965	Ga0495676_0126965_586_1308	240
505	3300047673	Ga0495593_0021407	Ga0495593_0021407_633_1355	240
506	3300048904	Ga0496101_0071764	Ga0496101_0071764_605_1327	240
507	3300048919	Ga0496116_0046571	Ga0496116_0046571_286_1008	240
508	3300048920	Ga0496117_0042123	Ga0496117_0042123_1575_2297	240
509	3300048920	Ga0496117_0060788	Ga0496117_0060788_307_1029	240
510	3300048921	Ga0496118_0045498	Ga0496118_0045498_386_1108	240
511	3300048924	Ga0496121_0115452	Ga0496121_0115452_278_1000	240
512	3300048924	Ga0496121_0138028	Ga0496121_0138028_53_775	240
513	3300048924	Ga0496121_0149040	Ga0496121_0149040_857_1579	240
514	3300048926	Ga0496123_0020099	Ga0496123_0020099_4505_5227	240
515	3300048926	Ga0496123_0089655	Ga0496123_0089655_791_1540	240
516	3300048926	Ga0496123_0114912	Ga0496123_0114912_31_753	240
517	3300048928	Ga0496125_0052692	Ga0496125_0052692_1493_2215	240
518	3300050496	nmdc:mga07m45_31232_c1	nmdc:mga07m45_31232_c1_998_1723	240
519	3300053087	Ga0500643_022563	Ga0500643_022563_994_1716	240
520	3300053110	Ga0500571_000476	Ga0500571_000476_13346_14068	240
521	3300053116	Ga0500592_007004	Ga0500592_007004_358_1080	240
522	3300053118	Ga0500594_0002230	Ga0500594_0002230_1607_2332	240
523	3300053121	Ga0500607_052987	Ga0500607_052987_405_1127	240
524	3300053133	Ga0500655_001312	Ga0500655_001312_1981_2703	240
525	3300053134	Ga0500658_0004899	Ga0500658_0004899_3363_4088	240
526	3300053134	Ga0500658_0004911	Ga0500658_0004911_902_1624	240
527	3300053138	Ga0500564_054645	Ga0500564_054645_154_876	240
528	3300053139	Ga0500568_0003724	Ga0500568_0003724_2249_2974	240
529	3300053141	Ga0500574_001649	Ga0500574_001649_1879_2601	240
530	3300053161	Ga0500634_0010370	Ga0500634_0010370_560_1282	240
531	3300053162	Ga0500638_072597	Ga0500638_072597_208_930	240
532	3300053177	Ga0500636_0137191	Ga0500636_0137191_404_1126	240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01351

RNase_HII

Ribonuclease HII

23

200

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7uwe-assembly1.cif.gz_C	cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex	0.9794	21	204
7uwh-assembly1.cif.gz_C	cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex bound to ribonucleotide substrate	0.9499	19	206
7uwe-assembly1.cif.gz_C	cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex	0.9489	21	204
3o3g-assembly1.cif.gz_A	t. maritima rnase h2 in complex with nucleic acid substrate and calcium ions	0.9457	21	204
7uwh-assembly1.cif.gz_C	cryoem structure of e. coli transcription-coupled ribonucleotide excision repair (tc-rer) complex bound to ribonucleotide substrate	0.9355	19	206

ID	Description	Score	Start	End	Superfamily
af_P10442_2_197_3.30.420.10	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H	0.9795	21	205	3.30.420.10
af_Q2FZ38_49_255_3.30.420.10	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H	0.9478	20	202	3.30.420.10
af_P10442_2_197_3.30.420.10	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H	0.9206	21	205	3.30.420.10
af_P9WH01_18_234_3.30.420.10	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H	0.8815	22	222	3.30.420.10
1uaxB00	Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H	0.8482	21	206	3.30.420.10

ID	Description	Score	Start	End	GO Terms
AF-A0A5U8SW26-F1-model_v4	Ribonuclease (EC 3.1.26.4)	0.9833	17	160	GO:0003723 GO:0004523 GO:0005737 GO:0006298 GO:0032299 GO:0043137 GO:0046872
AF-A0A2W5RS99-F1-model_v4	Ribonuclease (EC 3.1.26.4)	0.9825	29	195	GO:0003723 GO:0004523 GO:0005737 GO:0006298 GO:0032299 GO:0043137 GO:0046872
AF-A0A5A7NI86-F1-model_v4	Ribonuclease (EC 3.1.26.4)	0.9809	19	156	GO:0003723 GO:0004523 GO:0005737 GO:0006298 GO:0032299 GO:0043137 GO:0046872
AF-A0A519HHR4-F1-model_v4	deleted	0.9803	19	204
AF-A0A383BB08-F1-model_v4	Ribonuclease HII (EC 3.1.26.4)	0.98	23	180	GO:0003723 GO:0004523 GO:0005737 GO:0006298 GO:0032299 GO:0043137 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
85.15	0.79	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F460328

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01351

RNase_HII

Ribonuclease HII

23

200

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map