F460283

General Info

Members Datasets Scaffolds Average Seq Length
532 260 531 107

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10383355|Ga0207641_103833551
Length 123
Sequence MNLQLTGHHVDITPAIRKYVVTKLERIERHFDHVIDVNVVMTVEKLDQKIEANVHLAGKEIHCECHEVDMYAAIDGLIDKLDRQVVKHKEKFKSNTRHSPGTIRQLPALGAKSAGSGFSSQVA

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
204 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
205 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
206 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
207 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
213 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
242 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
245 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
246 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.94
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 1.69
Rhizosphere 93.42
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10004064 3300005327 Bacteria 11996
2 Ga0070658_10440947 3300005327 Bacteria 1121
3 Ga0070658_11897317 3300005327 Bacteria 515
4 Ga0070676_10498886 3300005328 Bacteria 864
5 Ga0070676_10519757 3300005328 Bacteria 848
6 Ga0070676_11274005 3300005328 Bacteria 561
7 Ga0070683_100012926 3300005329 Bacteria 7266
8 Ga0070683_101077456 3300005329 Bacteria 772
9 Ga0070690_101040006 3300005330 Bacteria 647
10 Ga0070690_101342169 3300005330 Bacteria 574
11 Ga0070670_101993366 3300005331 Bacteria 535
12 Ga0070677_10039108 3300005333 Bacteria 1860
13 Ga0068869_100261777 3300005334 Bacteria 1385
14 Ga0070666_10744898 3300005335 Bacteria 720
15 Ga0070680_100017626 3300005336 Bacteria 5633
16 Ga0070680_100096304 3300005336 Bacteria 2454
17 Ga0070680_100431467 3300005336 Bacteria 1125
18 Ga0070682_100040696 3300005337 Bacteria 2860
19 Ga0068868_100025276 3300005338 Bacteria 4515
20 Ga0068868_100291409 3300005338 Bacteria 1384
21 Ga0068868_100877802 3300005338 Bacteria 814
22 Ga0068868_101837936 3300005338 Bacteria 573
23 Ga0070660_100355743 3300005339 Bacteria 1206
24 Ga0070660_100522465 3300005339 Bacteria 989
25 Ga0070689_100193767 3300005340 Bacteria 1656
26 Ga0070689_100721829 3300005340 Bacteria 872
27 Ga0070687_100239719 3300005343 Bacteria 1121
28 Ga0070687_100309199 3300005343 Bacteria 1006
29 Ga0070661_100036646 3300005344 Bacteria 3565
30 Ga0070661_100970726 3300005344 Bacteria 704
31 Ga0070692_10124298 3300005345 Bacteria 1443
32 Ga0070692_10797424 3300005345 Bacteria 645
33 Ga0070692_11007303 3300005345 Bacteria 583
34 Ga0070692_11064705 3300005345 Bacteria 569
35 Ga0070669_100344351 3300005353 Bacteria 1209
36 Ga0070675_100037600 3300005354 Bacteria 3944
37 Ga0070675_100045961 3300005354 Bacteria 3575
38 Ga0070675_100722622 3300005354 Bacteria 908
39 Ga0070671_100559463 3300005355 Bacteria 987
40 Ga0070671_100611987 3300005355 Bacteria 942
41 Ga0070674_100260273 3300005356 Bacteria 1366
42 Ga0070674_100378668 3300005356 Bacteria 1151
43 Ga0070674_100409536 3300005356 Bacteria 1110
44 Ga0070674_100495373 3300005356 Bacteria 1017
45 Ga0070673_100079991 3300005364 Bacteria 2647
46 Ga0070673_100146317 3300005364 Bacteria 1998
47 Ga0070688_100069533 3300005365 Bacteria 2248
48 Ga0070688_100124016 3300005365 Bacteria 1734
49 Ga0070659_100433286 3300005366 Bacteria 1113
50 Ga0070667_101425491 3300005367 Bacteria 650
51 Ga0070709_10529888 3300005434 Bacteria 899
52 Ga0070714_100095163 3300005435 Bacteria 2615
53 Ga0070714_100353336 3300005435 Bacteria 1381
54 Ga0070713_100604658 3300005436 Bacteria 1042
55 Ga0070713_100651500 3300005436 Bacteria 1003
56 Ga0070713_101545841 3300005436 Bacteria 644
57 Ga0070710_10706671 3300005437 Bacteria 712
58 Ga0070710_11102760 3300005437 Bacteria 583
59 Ga0070701_10105202 3300005438 Bacteria 1569
60 Ga0070701_10154080 3300005438 Bacteria 1326
61 Ga0070711_100204511 3300005439 Bacteria 1526
62 Ga0070705_100143439 3300005440 Bacteria 1575
63 Ga0070705_101164941 3300005440 Bacteria 634
64 Ga0070700_100080910 3300005441 Bacteria 2097
65 Ga0070700_100910586 3300005441 Bacteria 717
66 Ga0070694_101893563 3300005444 Bacteria 509
67 Ga0070678_100262245 3300005456 Bacteria 1454
68 Ga0070678_100655920 3300005456 Bacteria 942
69 Ga0070662_100952363 3300005457 Bacteria 734
70 Ga0070681_10018054 3300005458 Bacteria 7049
71 Ga0070681_10526151 3300005458 Bacteria 1096
72 Ga0070681_10854633 3300005458 Bacteria 828
73 Ga0070681_11459983 3300005458 Bacteria 608
74 Ga0068867_100085893 3300005459 Bacteria 2379
75 Ga0068867_100692315 3300005459 Bacteria 898
76 Ga0068867_101567209 3300005459 Bacteria 615
77 Ga0068867_102276773 3300005459 Bacteria 515
78 Ga0070685_10041658 3300005466 Bacteria 2618
79 Ga0070685_10197822 3300005466 Bacteria 1305
80 Ga0070706_102049065 3300005467 Bacteria 518
81 Ga0070698_100131883 3300005471 Bacteria 2454
82 Ga0070699_100052995 3300005518 Bacteria 3511
83 Ga0070699_101038095 3300005518 Bacteria 752
84 Ga0070679_100068758 3300005530 Bacteria 3533
85 Ga0070679_100088421 3300005530 Bacteria 3085
86 Ga0070679_100288919 3300005530 Bacteria 1591
87 Ga0070679_100750450 3300005530 Bacteria 919
88 Ga0070684_100127461 3300005535 Bacteria 2294
89 Ga0070684_100474389 3300005535 Bacteria 1158
90 Ga0070697_100358949 3300005536 Bacteria 1260
91 Ga0070697_101846306 3300005536 Bacteria 541
92 Ga0068853_100019107 3300005539 Bacteria 5678
93 Ga0068853_100022090 3300005539 Bacteria 5310
94 Ga0068853_101737457 3300005539 Bacteria 605
95 Ga0070672_100051228 3300005543 Bacteria 3218
96 Ga0070672_100210086 3300005543 Bacteria 1630
97 Ga0070686_100687275 3300005544 Bacteria 815
98 Ga0070695_101719974 3300005545 Bacteria 525
99 Ga0070696_100043500 3300005546 Bacteria 3107
100 Ga0070696_100393971 3300005546 Bacteria 1082
101 Ga0070693_100055279 3300005547 Bacteria 2286
102 Ga0070693_100173541 3300005547 Bacteria 1382
103 Ga0070665_100313519 3300005548 Bacteria 1573
104 Ga0070665_101697586 3300005548 Bacteria 639
105 Ga0070704_100190839 3300005549 Bacteria 1647
106 Ga0068855_100004693 3300005563 Bacteria 16702
107 Ga0068855_100014349 3300005563 Bacteria 9539
108 Ga0068855_100871823 3300005563 Bacteria 952
109 Ga0070664_100112044 3300005564 Bacteria 2382
110 Ga0070664_100795994 3300005564 Bacteria 884
111 Ga0070664_102384259 3300005564 Bacteria 502
112 Ga0068857_100013438 3300005577 Bacteria 7132
113 Ga0068857_100025753 3300005577 Bacteria 5179
114 Ga0068857_100505164 3300005577 Bacteria 1135
115 Ga0068854_100006930 3300005578 Bacteria 7228
116 Ga0068854_100590415 3300005578 Bacteria 947
117 Ga0068856_100142967 3300005614 Bacteria 2400
118 Ga0068856_100156552 3300005614 Bacteria 2288
119 Ga0068856_100518030 3300005614 Bacteria 1214
120 Ga0070702_100105946 3300005615 Bacteria 1734
121 Ga0070702_100261937 3300005615 Bacteria 1178
122 Ga0068852_100000254 3300005616 Bacteria 36057
123 Ga0068852_100009086 3300005616 Bacteria 7359
124 Ga0068852_100012864 3300005616 Bacteria 6378
125 Ga0068852_100052417 3300005616 Bacteria 3506
126 Ga0068852_100060465 3300005616 Bacteria 3288
127 Ga0068852_101109983 3300005616 Bacteria 811
128 Ga0068852_101209744 3300005616 Bacteria 777
129 Ga0068852_101795580 3300005616 Bacteria 636
130 Ga0068859_100081573 3300005617 Bacteria 3277
131 Ga0068866_10392667 3300005718 Bacteria 893
132 Ga0068866_10397816 3300005718 Bacteria 888
133 Ga0068861_101684743 3300005719 Bacteria 627
134 Ga0068851_10002016 3300005834 Bacteria 8953
135 Ga0068851_10144977 3300005834 Bacteria 1294
136 Ga0068851_10443678 3300005834 Bacteria 770
137 Ga0068870_10417926 3300005840 Bacteria 877
138 Ga0068870_10529767 3300005840 Bacteria 790
139 Ga0068863_100299770 3300005841 Bacteria 1559
140 Ga0068858_100311795 3300005842 Bacteria 1502
141 Ga0068858_100629534 3300005842 Bacteria 1042
142 Ga0068858_101629613 3300005842 Bacteria 637
143 Ga0068858_101766355 3300005842 Bacteria 611
144 Ga0070717_10069659 3300006028 Bacteria 2930
145 Ga0075365_10955660 3300006038 Bacteria 604
146 Ga0075363_100956590 3300006048 Bacteria 526
147 Ga0075364_10048752 3300006051 Bacteria 2760
148 Ga0075432_10082442 3300006058 Bacteria 1168
149 Ga0075432_10369678 3300006058 Bacteria 612
150 Ga0075432_10377136 3300006058 Bacteria 607
151 Ga0075362_10362239 3300006177 Bacteria 727
152 Ga0075362_10451335 3300006177 Bacteria 653
153 Ga0075367_10796467 3300006178 Bacteria 602
154 Ga0075369_10071963 3300006186 Bacteria 1523
155 Ga0075366_10019840 3300006195 Bacteria 3895
156 Ga0075366_10021104 3300006195 Bacteria 3786
157 Ga0075366_10430853 3300006195 Bacteria 813
158 Ga0097621_100012830 3300006237 Bacteria 6224
159 Ga0097621_100605586 3300006237 Bacteria 1002
160 Ga0097621_100902496 3300006237 Bacteria 823
161 Ga0068871_100041820 3300006358 Bacteria 3676
162 Ga0068871_100232069 3300006358 Bacteria 1602
163 Ga0068871_100594736 3300006358 Bacteria 1006
164 Ga0068871_100898810 3300006358 Bacteria 821
165 Ga0075428_100011836 3300006844 Bacteria 9708
166 Ga0075431_101071846 3300006847 Bacteria 771
167 Ga0075433_10218148 3300006852 Bacteria 1695
168 Ga0075433_11580461 3300006852 Bacteria 566
169 Ga0075434_100059321 3300006871 Bacteria 3804
170 Ga0075434_101838901 3300006871 Bacteria 612
171 Ga0068865_100875388 3300006881 Bacteria 780
172 Ga0075436_100002584 3300006914 Bacteria 12445
173 Ga0075436_100790606 3300006914 Bacteria 706
174 Ga0097620_100081575 3300006931 Bacteria 3277
175 Ga0075435_100194025 3300007076 Bacteria 1719
176 Ga0105240_10035335 3300009093 Bacteria 6442
177 Ga0105240_10056757 3300009093 Bacteria 4897
178 Ga0105240_10063439 3300009093 Bacteria 4596
179 Ga0105240_10874831 3300009093 Bacteria 968
180 Ga0111539_10001826 3300009094 Bacteria 28335
181 Ga0105245_10316194 3300009098 Bacteria 1537
182 Ga0105245_10421741 3300009098 Bacteria 1337
183 Ga0105245_10522438 3300009098 Bacteria 1206
184 Ga0105245_10912224 3300009098 Bacteria 920
185 Ga0105245_11393342 3300009098 Bacteria 751
186 Ga0105243_10365631 3300009148 Bacteria 1329
187 Ga0105243_10452292 3300009148 Bacteria 1205
188 Ga0105243_11195692 3300009148 Bacteria 773
189 Ga0105243_11296390 3300009148 Bacteria 745
190 Ga0105243_11300737 3300009148 Bacteria 744
191 Ga0105241_10011678 3300009174 Bacteria 6447
192 Ga0105241_10023794 3300009174 Bacteria 4545
193 Ga0105241_10206681 3300009174 Bacteria 1643
194 Ga0105241_10299669 3300009174 Bacteria 1379
195 Ga0105242_10004748 3300009176 Bacteria 10522
196 Ga0105242_10401168 3300009176 Bacteria 1280
197 Ga0105242_10562595 3300009176 Bacteria 1095
198 Ga0105242_13269424 3300009176 Bacteria 504
199 Ga0105248_10045282 3300009177 Bacteria 4934
200 Ga0105248_10327004 3300009177 Bacteria 1727
201 Ga0105248_11303228 3300009177 Bacteria 822
202 Ga0105248_11317214 3300009177 Bacteria 817
203 Ga0105248_11786028 3300009177 Bacteria 697
204 Ga0105248_12540795 3300009177 Bacteria 584
205 Ga0105237_10229657 3300009545 Bacteria 1857
206 Ga0105237_10794417 3300009545 Bacteria 953
207 Ga0105237_11112653 3300009545 Bacteria 797
208 Ga0105237_11696419 3300009545 Bacteria 639
209 Ga0105238_10003397 3300009551 Bacteria 15895
210 Ga0105238_10022825 3300009551 Bacteria 6378
211 Ga0105238_10039577 3300009551 Bacteria 4780
212 Ga0105238_10292407 3300009551 Bacteria 1611
213 Ga0105238_10313222 3300009551 Bacteria 1555
214 Ga0105238_10655444 3300009551 Bacteria 1060
215 Ga0105238_11282119 3300009551 Bacteria 758
216 Ga0105238_11512570 3300009551 Bacteria 700
217 Ga0105249_10467964 3300009553 Bacteria 1301
218 Ga0105249_11154889 3300009553 Bacteria 845
219 Ga0105239_10279615 3300010375 Bacteria 1879
220 Ga0105239_10853422 3300010375 Bacteria 1044
221 Ga0105239_12442180 3300010375 Bacteria 609
222 Ga0105239_12619759 3300010375 Bacteria 588
223 Ga0157329_1012060 3300012491 Bacteria 702
224 Ga0157373_10383110 3300013100 Bacteria 1006
225 Ga0157371_10023455 3300013102 Bacteria 4512
226 Ga0157371_10088807 3300013102 Bacteria 2189
227 Ga0157370_10814645 3300013104 Bacteria 849
228 Ga0157369_10002524 3300013105 Bacteria 21881
229 Ga0157369_10077702 3300013105 Bacteria 3557
230 Ga0157369_10370990 3300013105 Bacteria 1486
231 Ga0157369_11800162 3300013105 Bacteria 622
232 Ga0157374_11913233 3300013296 Bacteria 619
233 Ga0157378_10615262 3300013297 Bacteria 1099
234 Ga0157378_11178592 3300013297 Bacteria 805
235 Ga0163162_10065955 3300013306 Bacteria 3669
236 Ga0163162_10135416 3300013306 Bacteria 2574
237 Ga0163162_11356620 3300013306 Bacteria 809
238 Ga0163162_12894147 3300013306 Bacteria 552
239 Ga0157372_10026804 3300013307 Bacteria 6273
240 Ga0157372_10046255 3300013307 Bacteria 4831
241 Ga0157372_10098767 3300013307 Bacteria 3331
242 Ga0157372_10762777 3300013307 Bacteria 1125
243 Ga0157372_12666676 3300013307 Bacteria 573
244 Ga0157375_10139435 3300013308 Bacteria 2551
245 Ga0157375_12334193 3300013308 Bacteria 638
246 Ga0163163_10563540 3300014325 Bacteria 1202
247 Ga0157380_10017395 3300014326 Bacteria 5320
248 Ga0157380_10341719 3300014326 Bacteria 1397
249 Ga0157380_11721487 3300014326 Bacteria 685
250 Ga0157380_11849108 3300014326 Bacteria 664
251 Ga0157380_11989570 3300014326 Bacteria 643
252 Ga0157380_12205547 3300014326 Bacteria 615
253 Ga0182008_10047237 3300014497 Bacteria 2139
254 Ga0157377_10164309 3300014745 Bacteria 1383
255 Ga0157377_10277736 3300014745 Bacteria 1097
256 Ga0157379_10027667 3300014968 Bacteria 5048
257 Ga0157379_11538894 3300014968 Bacteria 648
258 Ga0157379_11652689 3300014968 Bacteria 626
259 Ga0157376_10163539 3300014969 Bacteria 2020
260 Ga0157376_11952083 3300014969 Bacteria 624
261 Ga0157376_12887834 3300014969 Bacteria 520
262 Ga0163161_10070314 3300017792 Bacteria 2559
263 Ga0163161_10389773 3300017792 Bacteria 1115
264 Ga0197907_10049381 3300020069 Bacteria 1700
265 Ga0206356_10632517 3300020070 Bacteria 3643
266 Ga0206352_10660858 3300020078 Bacteria 755
267 Ga0206353_10160707 3300020082 Bacteria 2009
268 Ga0213876_10044224 3300021384 Bacteria 2354
269 Ga0224712_10089071 3300022467 Bacteria 1289
270 Ga0207697_10111586 3300025315 Bacteria 1171
271 Ga0207656_10001529 3300025321 Bacteria 7668
272 Ga0207656_10236800 3300025321 Bacteria 891
273 Ga0207682_10036379 3300025893 Bacteria 1992
274 Ga0207642_10231403 3300025899 Bacteria 1038
275 Ga0207688_10060868 3300025901 Bacteria 2128
276 Ga0207699_10013459 3300025906 Bacteria 4189
277 Ga0207699_10133860 3300025906 Bacteria 1621
278 Ga0207645_10064415 3300025907 Bacteria 2342
279 Ga0207645_10383085 3300025907 Bacteria 944
280 Ga0207643_10099266 3300025908 Bacteria 1706
281 Ga0207705_10039760 3300025909 Bacteria 3371
282 Ga0207705_10170151 3300025909 Bacteria 1640
283 Ga0207705_10181384 3300025909 Bacteria 1589
284 Ga0207705_10691712 3300025909 Bacteria 793
285 Ga0207705_10945429 3300025909 Bacteria 667
286 Ga0207705_10997907 3300025909 Bacteria 647
287 Ga0207654_10005423 3300025911 Bacteria 6451
288 Ga0207654_10204345 3300025911 Bacteria 1302
289 Ga0207654_10530228 3300025911 Bacteria 834
290 Ga0207654_10766535 3300025911 Bacteria 696
291 Ga0207707_10004510 3300025912 Bacteria 12245
292 Ga0207707_10012172 3300025912 Bacteria 7478
293 Ga0207707_10697395 3300025912 Bacteria 853
294 Ga0207707_10988679 3300025912 Bacteria 691
295 Ga0207695_10022239 3300025913 Bacteria 7209
296 Ga0207695_10026267 3300025913 Bacteria 6500
297 Ga0207695_10141166 3300025913 Bacteria 2357
298 Ga0207695_10229975 3300025913 Bacteria 1759
299 Ga0207695_11672402 3300025913 Bacteria 517
300 Ga0207693_11295217 3300025915 Bacteria 545
301 Ga0207660_10004556 3300025917 Bacteria 9038
302 Ga0207660_10387460 3300025917 Bacteria 1124
303 Ga0207660_11598150 3300025917 Bacteria 525
304 Ga0207662_10341206 3300025918 Bacteria 1004
305 Ga0207662_10345159 3300025918 Bacteria 998
306 Ga0207662_10500627 3300025918 Bacteria 836
307 Ga0207657_10098056 3300025919 Bacteria 2436
308 Ga0207657_10105831 3300025919 Bacteria 2328
309 Ga0207649_10005246 3300025920 Bacteria 7001
310 Ga0207649_10662840 3300025920 Bacteria 807
311 Ga0207652_10061303 3300025921 Bacteria 3248
312 Ga0207652_10097132 3300025921 Bacteria 2596
313 Ga0207652_10193426 3300025921 Bacteria 1830
314 Ga0207652_10784452 3300025921 Bacteria 847
315 Ga0207652_11007201 3300025921 Bacteria 732
316 Ga0207681_10592723 3300025923 Bacteria 915
317 Ga0207694_10079125 3300025924 Bacteria 2578
318 Ga0207694_10086086 3300025924 Bacteria 2474
319 Ga0207694_10130144 3300025924 Bacteria 2017
320 Ga0207694_10307487 3300025924 Bacteria 1306
321 Ga0207694_10345323 3300025924 Bacteria 1231
322 Ga0207694_10724986 3300025924 Bacteria 839
323 Ga0207659_10106035 3300025926 Bacteria 2127
324 Ga0207659_10223281 3300025926 Bacteria 1516
325 Ga0207659_10760082 3300025926 Bacteria 832
326 Ga0207659_11244628 3300025926 Bacteria 639
327 Ga0207687_10141398 3300025927 Bacteria 1826
328 Ga0207700_10250582 3300025928 Bacteria 1513
329 Ga0207700_10287154 3300025928 Bacteria 1417
330 Ga0207700_11126224 3300025928 Unclassified 701
331 Ga0207664_10091448 3300025929 Bacteria 2495
332 Ga0207664_10338678 3300025929 Bacteria 1330
333 Ga0207664_11528012 3300025929 Bacteria 589
334 Ga0207644_11721909 3300025931 Bacteria 525
335 Ga0207690_10475548 3300025932 Bacteria 1008
336 Ga0207706_10283926 3300025933 Bacteria 1443
337 Ga0207686_10004988 3300025934 Bacteria 7145
338 Ga0207686_10231769 3300025934 Bacteria 1339
339 Ga0207686_10276982 3300025934 Bacteria 1237
340 Ga0207686_11314680 3300025934 Bacteria 594
341 Ga0207686_11634682 3300025934 Bacteria 532
342 Ga0207709_10144368 3300025935 Bacteria 1640
343 Ga0207709_10266167 3300025935 Bacteria 1259
344 Ga0207709_10628029 3300025935 Bacteria 853
345 Ga0207670_10014182 3300025936 Bacteria 4722
346 Ga0207670_10064119 3300025936 Bacteria 2517
347 Ga0207669_10087677 3300025937 Bacteria 2016
348 Ga0207691_10018917 3300025940 Bacteria 6525
349 Ga0207691_10056959 3300025940 Bacteria 3559
350 Ga0207691_11540320 3300025940 Bacteria 542
351 Ga0207711_11214029 3300025941 Bacteria 696
352 Ga0207711_11519926 3300025941 Bacteria 613
353 Ga0207661_10907760 3300025944 Bacteria 811
354 Ga0207679_10260394 3300025945 Bacteria 1479
355 Ga0207667_10002090 3300025949 Bacteria 25032
356 Ga0207667_10009605 3300025949 Bacteria 11381
357 Ga0207667_10042923 3300025949 Bacteria 4802
358 Ga0207667_10180054 3300025949 Bacteria 2171
359 Ga0207651_10072026 3300025960 Bacteria 2452
360 Ga0207651_10094883 3300025960 Bacteria 2195
361 Ga0207712_11449941 3300025961 Bacteria 614
362 Ga0207640_10066307 3300025981 Bacteria 2412
363 Ga0207640_11126020 3300025981 Bacteria 695
364 Ga0207640_11504722 3300025981 Bacteria 605
365 Ga0207640_12015853 3300025981 Bacteria 523
366 Ga0207658_10447077 3300025986 Bacteria 1144
367 Ga0207677_10025133 3300026023 Bacteria 3711
368 Ga0207677_10129855 3300026023 Bacteria 1911
369 Ga0207703_10020762 3300026035 Bacteria 5139
370 Ga0207703_12183990 3300026035 Bacteria 530
371 Ga0207639_10021692 3300026041 Bacteria 4616
372 Ga0207639_10117579 3300026041 Bacteria 2179
373 Ga0207639_10353481 3300026041 Bacteria 1313
374 Ga0207639_10439388 3300026041 Bacteria 1183
375 Ga0207708_10058790 3300026075 Bacteria 2933
376 Ga0207708_11089683 3300026075 Bacteria 696
377 Ga0207702_10065510 3300026078 Bacteria 3112
378 Ga0207702_10102183 3300026078 Bacteria 2533
379 Ga0207702_10190514 3300026078 Bacteria 1894
380 Ga0207641_10252317 3300026088 Bacteria 1648
381 Ga0207641_10383355 3300026088 Bacteria 1347
382 Ga0207641_10881878 3300026088 Bacteria 888
383 Ga0207648_10018110 3300026089 Bacteria 6378
384 Ga0207648_10085800 3300026089 Bacteria 2746
385 Ga0207648_10277286 3300026089 Bacteria 1499
386 Ga0207648_11050370 3300026089 Bacteria 763
387 Ga0207648_11282696 3300026089 Bacteria 688
388 Ga0207674_10005717 3300026116 Bacteria 14740
389 Ga0207675_100165704 3300026118 Bacteria 2110
390 Ga0207675_100333271 3300026118 Bacteria 1484
391 Ga0207675_100479836 3300026118 Bacteria 1236
392 Ga0207675_102036041 3300026118 Bacteria 591
393 Ga0207683_10380383 3300026121 Bacteria 1298
394 Ga0207683_10637211 3300026121 Bacteria 987
395 Ga0207698_10005304 3300026142 Bacteria 7941
396 Ga0207698_10038333 3300026142 Bacteria 3540
397 Ga0207698_10054525 3300026142 Bacteria 3076
398 Ga0207698_10120570 3300026142 Bacteria 2219
399 Ga0207698_11582852 3300026142 Bacteria 671
400 Ga0207698_11984628 3300026142 Bacteria 596
401 Ga0207698_12219418 3300026142 Bacteria 562
402 Ga0209974_10251462 3300027876 Bacteria 665
403 Ga0207428_10143936 3300027907 Bacteria 1818
404 Ga0207428_10166875 3300027907 Bacteria 1669
405 Ga0268266_10125834 3300028379 Bacteria 2287
406 Ga0268264_10131961 3300028381 Bacteria 2216
407 Ga0265332_10129594 3300031238 Bacteria 1058
408 Ga0265340_10170561 3300031247 Bacteria 986
409 Ga0265331_10192213 3300031250 Bacteria 921
410 Ga0307509_10459264 3300031507 Bacteria 966
411 Ga0307408_100257524 3300031548 Bacteria 1442
412 Ga0307408_100361392 3300031548 Bacteria 1235
413 Ga0307408_100499636 3300031548 Bacteria 1064
414 Ga0307405_10121518 3300031731 Bacteria 1788
415 Ga0307405_10235718 3300031731 Bacteria 1352
416 Ga0307405_11098042 3300031731 Bacteria 683
417 Ga0307405_11197564 3300031731 Bacteria 657
418 Ga0307413_10709002 3300031824 Bacteria 837
419 Ga0307410_10814151 3300031852 Bacteria 795
420 Ga0307410_11427218 3300031852 Bacteria 608
421 Ga0307410_12043220 3300031852 Bacteria 512
422 Ga0307406_10366554 3300031901 Bacteria 1131
423 Ga0307412_10079185 3300031911 Bacteria 2266
424 Ga0307412_10463975 3300031911 Bacteria 1046
425 Ga0307412_10556420 3300031911 Bacteria 964
426 Ga0307412_11416722 3300031911 Bacteria 629
427 Ga0307409_100022877 3300031995 Bacteria 4317
428 Ga0307409_100461735 3300031995 Bacteria 1228
429 Ga0307416_100236042 3300032002 Bacteria 1767
430 Ga0307416_100279764 3300032002 Bacteria 1644
431 Ga0307416_100291293 3300032002 Bacteria 1616
432 Ga0307416_100574914 3300032002 Bacteria 1203
433 Ga0307416_100645272 3300032002 Bacteria 1143
434 Ga0307416_101479350 3300032002 Bacteria 785
435 Ga0307416_102340339 3300032002 Bacteria 634
436 Ga0307414_10127559 3300032004 Bacteria 1969
437 Ga0307411_10556711 3300032005 Bacteria 979
438 Ga0307411_10567222 3300032005 Bacteria 971
439 Ga0307411_10901140 3300032005 Bacteria 786
440 Ga0307411_12107524 3300032005 Bacteria 528
441 Ga0307415_100475356 3300032126 Bacteria 1087
442 Ga0307415_101111480 3300032126 Bacteria 740
443 Ga0307415_101174116 3300032126 Bacteria 722
444 Ga0373958_0139674 3300034819 Bacteria 599
445 Ga0373944_0354465 3300035089 Bacteria 559
446 Ga0373931_0065454 3300035691 Bacteria 1970
447 Ga0373931_0203394 3300035691 Bacteria 1184
448 Ga0373931_0861773 3300035691 Bacteria 607
449 Ga0373935_0048668 3300035692 Bacteria 2685
450 Ga0373927_0286701 3300035695 Bacteria 1083
451 Ga0373937_0049030 3300036401 Bacteria 3867
452 Ga0373925_0515651 3300037068 Bacteria 982
453 Ga0395900_0063575 3300037418 Bacteria 3794
454 Ga0395900_0578879 3300037418 Bacteria 1065
455 Ga0395898_0130221 3300037466 Bacteria 2410
456 Ga0395898_1784719 3300037466 Bacteria 537
457 Ga0395905_0031170 3300037471 Bacteria 5021
458 Ga0395905_0293325 3300037471 Bacteria 1513
459 Ga0395901_0043034 3300038443 Bacteria 4684
460 Ga0395901_0412004 3300038443 Bacteria 1387
461 Ga0436365_1596890 3300039437 Bacteria 4923
462 Ga0439447_099941 3300041407 Bacteria 666
463 Ga0439453_0059022 3300041408 Bacteria 791
464 Ga0451789_0632955 3300041443 Bacteria 510
465 Ga0451793_1922151 3300041452 Bacteria 1083
466 Ga0451795_0081561 3300041456 Bacteria 673
467 Ga0451800_1189066 3300041459 Bacteria 512
468 Ga0451807_1253253 3300041486 Bacteria 765
469 Ga0451835_0967853 3300041492 Bacteria 622
470 Ga0451853_0166656 3300041512 Bacteria 2036
471 Ga0439441_007124 3300042001 Bacteria 1791
472 Ga0450923_036574 3300042125 Bacteria 1019
473 Ga0439446_0251782 3300042156 Bacteria 609
474 Ga0439435_0170362 3300042436 Bacteria 707
475 Ga0451577_0376517 3300042876 Bacteria 1288
476 Ga0466972_0211306 3300044658 Bacteria 908
477 Ga0453683_0253939 3300044673 Bacteria 1121
478 Ga0466966_0147805 3300044684 Bacteria 1434
479 Ga0466961_0032363 3300044693 Bacteria 3360
480 Ga0466963_0944117 3300044694 Bacteria 607
481 Ga0453684_1707413 3300044712 Bacteria 643
482 Ga0466971_0321607 3300044719 Bacteria 745
483 Ga0466957_0014006 3300044842 Bacteria 4664
484 Ga0466957_0718109 3300044842 Bacteria 706
485 Ga0466959_0464468 3300045049 Bacteria 857
486 Ga0451576_0452060 3300045051 Bacteria 1349
487 Ga0451576_0790020 3300045051 Bacteria 997
488 Ga0466958_0049225 3300045836 Bacteria 2549
489 Ga0466967_1184361 3300045976 Bacteria 761
490 Ga0495663_0253830 3300046525 Bacteria 625
491 Ga0495621_0008698 3300046539 Bacteria 3053
492 Ga0495621_0041524 3300046539 Bacteria 1616
493 Ga0495621_0067402 3300046539 Bacteria 1311
494 Ga0495635_1000095 3300046663 Bacteria 532
495 Ga0495646_0608555 3300046680 Bacteria 555
496 Ga0495658_0191631 3300046683 Bacteria 1271
497 Ga0495589_0168476 3300046794 Bacteria 1042
498 Ga0496104_0029274 3300048907 Bacteria 5108
499 Ga0496109_0103498 3300048912 Bacteria 2643
500 Ga0496110_0019539 3300048913 Bacteria 5704
501 Ga0496111_0582813 3300048914 Bacteria 820
502 Ga0501039_0547834 3300049575 Bacteria 908
503 Ga0501042_1354590 3300049578 Bacteria 519
504 Ga0501199_067193 3300049650 Bacteria 509
505 Ga0501217_067366 3300049661 Bacteria 968
506 Ga0501249_092341 3300049679 Bacteria 719
507 Ga0501261_062421 3300049690 Bacteria 636
508 Ga0501269_018763 3300049766 Bacteria 858
509 nmdc:mga03683_117006_c1 3300050489 Bacteria 1182
510 nmdc:mga03n38_882147_c1 3300050490 Bacteria 525
511 nmdc:mga00v17_48221_c1 3300050491 Bacteria 2581
512 nmdc:mga0k408_165272_c1 3300050493 Bacteria 1319
513 nmdc:mga0k408_23222_c1 3300050493 Bacteria 3497
514 nmdc:mga0k408_281452_c1 3300050493 Bacteria 993
515 nmdc:mga0k408_745634_c1 3300050493 Bacteria 572
516 nmdc:mga07m45_323760_c1 3300050496 Bacteria 896
517 nmdc:mga05p37_496227_c1 3300050507 Bacteria 1402
518 nmdc:mga09592_455373_c1 3300050508 Bacteria 1103
519 nmdc:mga08y16_295931_c1 3300050511 Bacteria 1669
520 nmdc:mga0n895_1538283_c1 3300050512 Bacteria 631
521 nmdc:mga0n895_317164_c1 3300050512 Bacteria 1580
522 nmdc:mga0rr50_179914_c1 3300050513 Bacteria 1728
523 nmdc:mga0rr50_375493_c1 3300050513 Bacteria 1198
524 nmdc:mga0rr50_573347_c1 3300050513 Bacteria 961
525 nmdc:mga0rr50_955338_c1 3300050513 Bacteria 730
526 nmdc:mga08x19_1030383_c1 3300050514 Bacteria 584
527 nmdc:mga08x19_3628_c1 3300050514 Bacteria 9188
528 nmdc:mga0a205_201645_c1 3300050515 Bacteria 1880
529 nmdc:mga0sz30_89787_c1 3300050516 Bacteria 1336
530 Ga0500641_0323433 3300053096 Bacteria 627
531 Ga0466962_0070638 3300061719 Bacteria 1668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2574179768 2574429213 103
2 3300005434 Ga0070709_10529888 Ga0070709_105298881 105
3 3300005436 Ga0070713_101545841 Ga0070713_1015458411 105
4 3300005616 Ga0068852_100012864 Ga0068852_1000128643 105
5 3300025906 Ga0207699_10133860 Ga0207699_101338601 105
6 3300025928 Ga0207700_10287154 Ga0207700_102871542 105
7 3300025931 Ga0207644_11721909 Ga0207644_117219092 105
8 3300026142 Ga0207698_10038333 Ga0207698_100383332 105
9 3300031911 Ga0307412_10079185 Ga0307412_100791852 105
10 3300031995 Ga0307409_100022877 Ga0307409_1000228771 105
11 3300032002 Ga0307416_100236042 Ga0307416_1002360422 105
12 3300032004 Ga0307414_10127559 Ga0307414_101275592 105
13 3300032126 Ga0307415_101111480 Ga0307415_1011114802 105
14 3300005327 Ga0070658_10440947 Ga0070658_104409472 106
15 3300005327 Ga0070658_11897317 Ga0070658_118973171 106
16 3300005328 Ga0070676_10519757 Ga0070676_105197572 106
17 3300005328 Ga0070676_11274005 Ga0070676_112740051 106
18 3300005329 Ga0070683_100012926 Ga0070683_1000129262 106
19 3300005330 Ga0070690_101040006 Ga0070690_1010400062 106
20 3300005333 Ga0070677_10039108 Ga0070677_100391082 106
21 3300005335 Ga0070666_10744898 Ga0070666_107448982 106
22 3300005336 Ga0070680_100096304 Ga0070680_1000963043 106
23 3300005336 Ga0070680_100431467 Ga0070680_1004314672 106
24 3300005338 Ga0068868_100291409 Ga0068868_1002914091 106
25 3300005338 Ga0068868_100877802 Ga0068868_1008778022 106
26 3300005339 Ga0070660_100355743 Ga0070660_1003557432 106
27 3300005339 Ga0070660_100522465 Ga0070660_1005224652 106
28 3300005340 Ga0070689_100193767 Ga0070689_1001937673 106
29 3300005343 Ga0070687_100239719 Ga0070687_1002397192 106
30 3300005343 Ga0070687_100309199 Ga0070687_1003091992 106
31 3300005344 Ga0070661_100970726 Ga0070661_1009707262 106
32 3300005345 Ga0070692_10124298 Ga0070692_101242983 106
33 3300005345 Ga0070692_11007303 Ga0070692_110073031 106
34 3300005345 Ga0070692_11064705 Ga0070692_110647051 106
35 3300005353 Ga0070669_100344351 Ga0070669_1003443512 106
36 3300005354 Ga0070675_100045961 Ga0070675_1000459612 106
37 3300005355 Ga0070671_100611987 Ga0070671_1006119872 106
38 3300005356 Ga0070674_100495373 Ga0070674_1004953732 106
39 3300005364 Ga0070673_100079991 Ga0070673_1000799914 106
40 3300005364 Ga0070673_100146317 Ga0070673_1001463173 106
41 3300005365 Ga0070688_100124016 Ga0070688_1001240161 106
42 3300005367 Ga0070667_101425491 Ga0070667_1014254911 106
43 3300005435 Ga0070714_100095163 Ga0070714_1000951632 106
44 3300005435 Ga0070714_100353336 Ga0070714_1003533362 106
45 3300005436 Ga0070713_100604658 Ga0070713_1006046581 106
46 3300005436 Ga0070713_100651500 Ga0070713_1006515002 106
47 3300005437 Ga0070710_10706671 Ga0070710_107066712 106
48 3300005438 Ga0070701_10105202 Ga0070701_101052023 106
49 3300005438 Ga0070701_10154080 Ga0070701_101540802 106
50 3300005439 Ga0070711_100204511 Ga0070711_1002045113 106
51 3300005441 Ga0070700_100080910 Ga0070700_1000809102 106
52 3300005441 Ga0070700_100910586 Ga0070700_1009105862 106
53 3300005456 Ga0070678_100262245 Ga0070678_1002622452 106
54 3300005456 Ga0070678_100655920 Ga0070678_1006559201 106
55 3300005457 Ga0070662_100952363 Ga0070662_1009523631 106
56 3300005458 Ga0070681_10018054 Ga0070681_100180543 106
57 3300005458 Ga0070681_10526151 Ga0070681_105261512 106
58 3300005459 Ga0068867_100085893 Ga0068867_1000858933 106
59 3300005459 Ga0068867_100692315 Ga0068867_1006923151 106
60 3300005466 Ga0070685_10197822 Ga0070685_101978222 106
61 3300005530 Ga0070679_100068758 Ga0070679_1000687582 106
62 3300005530 Ga0070679_100088421 Ga0070679_1000884213 106
63 3300005530 Ga0070679_100288919 Ga0070679_1002889192 106
64 3300005535 Ga0070684_100127461 Ga0070684_1001274613 106
65 3300005539 Ga0068853_100019107 Ga0068853_1000191078 106
66 3300005539 Ga0068853_100022090 Ga0068853_1000220903 106
67 3300005539 Ga0068853_101737457 Ga0068853_1017374572 106
68 3300005543 Ga0070672_100210086 Ga0070672_1002100863 106
69 3300005546 Ga0070696_100393971 Ga0070696_1003939712 106
70 3300005547 Ga0070693_100055279 Ga0070693_1000552793 106
71 3300005547 Ga0070693_100173541 Ga0070693_1001735412 106
72 3300005563 Ga0068855_100004693 Ga0068855_10000469311 106
73 3300005563 Ga0068855_100014349 Ga0068855_10001434913 106
74 3300005563 Ga0068855_100871823 Ga0068855_1008718232 106
75 3300005564 Ga0070664_100795994 Ga0070664_1007959942 106
76 3300005564 Ga0070664_102384259 Ga0070664_1023842591 106
77 3300005614 Ga0068856_100156552 Ga0068856_1001565522 106
78 3300005614 Ga0068856_100518030 Ga0068856_1005180302 106
79 3300005615 Ga0070702_100261937 Ga0070702_1002619372 106
80 3300005616 Ga0068852_100009086 Ga0068852_1000090865 106
81 3300005616 Ga0068852_100060465 Ga0068852_1000604652 106
82 3300005616 Ga0068852_101209744 Ga0068852_1012097442 106
83 3300005616 Ga0068852_101795580 Ga0068852_1017955802 106
84 3300005617 Ga0068859_100081573 Ga0068859_1000815734 106
85 3300005718 Ga0068866_10392667 Ga0068866_103926672 106
86 3300005718 Ga0068866_10397816 Ga0068866_103978161 106
87 3300005834 Ga0068851_10144977 Ga0068851_101449771 106
88 3300005840 Ga0068870_10529767 Ga0068870_105297672 106
89 3300005841 Ga0068863_100299770 Ga0068863_1002997703 106
90 3300005842 Ga0068858_100629534 Ga0068858_1006295343 106
91 3300005842 Ga0068858_101629613 Ga0068858_1016296131 106
92 3300006028 Ga0070717_10069659 Ga0070717_100696592 106
93 3300006058 Ga0075432_10369678 Ga0075432_103696782 106
94 3300006195 Ga0075366_10021104 Ga0075366_100211043 106
95 3300006237 Ga0097621_100605586 Ga0097621_1006055862 106
96 3300006358 Ga0068871_100232069 Ga0068871_1002320693 106
97 3300006358 Ga0068871_100594736 Ga0068871_1005947362 106
98 3300006358 Ga0068871_100898810 Ga0068871_1008988101 106
99 3300006844 Ga0075428_100011836 Ga0075428_1000118368 106
100 3300006847 Ga0075431_101071846 Ga0075431_1010718462 106
101 3300006871 Ga0075434_101838901 Ga0075434_1018389012 106
102 3300006881 Ga0068865_100875388 Ga0068865_1008753882 106
103 3300006914 Ga0075436_100790606 Ga0075436_1007906062 106
104 3300006931 Ga0097620_100081575 Ga0097620_1000815752 106
105 3300009093 Ga0105240_10056757 Ga0105240_100567574 106
106 3300009093 Ga0105240_10063439 Ga0105240_100634393 106
107 3300009093 Ga0105240_10874831 Ga0105240_108748312 106
108 3300009094 Ga0111539_10001826 Ga0111539_100018263 106
109 3300009098 Ga0105245_10316194 Ga0105245_103161942 106
110 3300009098 Ga0105245_10522438 Ga0105245_105224382 106
111 3300009098 Ga0105245_10912224 Ga0105245_109122242 106
112 3300009098 Ga0105245_11393342 Ga0105245_113933422 106
113 3300009148 Ga0105243_11296390 Ga0105243_112963902 106
114 3300009174 Ga0105241_10023794 Ga0105241_100237947 106
115 3300009174 Ga0105241_10206681 Ga0105241_102066813 106
116 3300009174 Ga0105241_10299669 Ga0105241_102996692 106
117 3300009176 Ga0105242_10401168 Ga0105242_104011682 106
118 3300009176 Ga0105242_10562595 Ga0105242_105625952 106
119 3300009177 Ga0105248_10327004 Ga0105248_103270042 106
120 3300009177 Ga0105248_11317214 Ga0105248_113172141 106
121 3300009177 Ga0105248_11786028 Ga0105248_117860282 106
122 3300009177 Ga0105248_12540795 Ga0105248_125407951 106
123 3300009545 Ga0105237_10794417 Ga0105237_107944172 106
124 3300009545 Ga0105237_11112653 Ga0105237_111126532 106
125 3300009551 Ga0105238_10022825 Ga0105238_100228257 106
126 3300009551 Ga0105238_10039577 Ga0105238_100395777 106
127 3300009551 Ga0105238_10292407 Ga0105238_102924072 106
128 3300009551 Ga0105238_11282119 Ga0105238_112821192 106
129 3300009551 Ga0105238_11512570 Ga0105238_115125702 106
130 3300010375 Ga0105239_10279615 Ga0105239_102796152 106
131 3300010375 Ga0105239_10853422 Ga0105239_108534222 106
132 3300010375 Ga0105239_12442180 Ga0105239_124421802 106
133 3300012491 Ga0157329_1012060 Ga0157329_10120602 106
134 3300013100 Ga0157373_10383110 Ga0157373_103831102 106
135 3300013102 Ga0157371_10088807 Ga0157371_100888073 106
136 3300013104 Ga0157370_10814645 Ga0157370_108146452 106
137 3300013105 Ga0157369_10002524 Ga0157369_1000252423 106
138 3300013105 Ga0157369_10077702 Ga0157369_100777022 106
139 3300013296 Ga0157374_11913233 Ga0157374_119132331 106
140 3300013297 Ga0157378_10615262 Ga0157378_106152622 106
141 3300013297 Ga0157378_11178592 Ga0157378_111785922 106
142 3300013306 Ga0163162_11356620 Ga0163162_113566202 106
143 3300013306 Ga0163162_12894147 Ga0163162_128941471 106
144 3300013307 Ga0157372_10026804 Ga0157372_100268042 106
145 3300013307 Ga0157372_10046255 Ga0157372_100462552 106
146 3300013307 Ga0157372_10762777 Ga0157372_107627772 106
147 3300013307 Ga0157372_12666676 Ga0157372_126666762 106
148 3300013308 Ga0157375_12334193 Ga0157375_123341932 106
149 3300014325 Ga0163163_10563540 Ga0163163_105635402 106
150 3300014326 Ga0157380_11721487 Ga0157380_117214871 106
151 3300014326 Ga0157380_11849108 Ga0157380_118491082 106
152 3300014326 Ga0157380_12205547 Ga0157380_122055472 106
153 3300014968 Ga0157379_11538894 Ga0157379_115388942 106
154 3300014968 Ga0157379_11652689 Ga0157379_116526891 106
155 3300014969 Ga0157376_11952083 Ga0157376_119520831 106
156 3300014969 Ga0157376_12887834 Ga0157376_128878341 106
157 3300025893 Ga0207682_10036379 Ga0207682_100363793 106
158 3300025899 Ga0207642_10231403 Ga0207642_102314033 106
159 3300025906 Ga0207699_10013459 Ga0207699_100134596 106
160 3300025907 Ga0207645_10064415 Ga0207645_100644153 106
161 3300025907 Ga0207645_10383085 Ga0207645_103830852 106
162 3300025909 Ga0207705_10170151 Ga0207705_101701512 106
163 3300025909 Ga0207705_10181384 Ga0207705_101813842 106
164 3300025909 Ga0207705_10691712 Ga0207705_106917121 106
165 3300025909 Ga0207705_10997907 Ga0207705_109979072 106
166 3300025911 Ga0207654_10204345 Ga0207654_102043452 106
167 3300025911 Ga0207654_10530228 Ga0207654_105302282 106
168 3300025911 Ga0207654_10766535 Ga0207654_107665352 106
169 3300025912 Ga0207707_10012172 Ga0207707_100121724 106
170 3300025912 Ga0207707_10988679 Ga0207707_109886791 106
171 3300025913 Ga0207695_10022239 Ga0207695_100222397 106
172 3300025913 Ga0207695_10141166 Ga0207695_101411662 106
173 3300025913 Ga0207695_10229975 Ga0207695_102299753 106
174 3300025913 Ga0207695_11672402 Ga0207695_116724021 106
175 3300025915 Ga0207693_11295217 Ga0207693_112952172 106
176 3300025917 Ga0207660_10387460 Ga0207660_103874602 106
177 3300025917 Ga0207660_11598150 Ga0207660_115981502 106
178 3300025918 Ga0207662_10341206 Ga0207662_103412061 106
179 3300025918 Ga0207662_10345159 Ga0207662_103451592 106
180 3300025919 Ga0207657_10098056 Ga0207657_100980562 106
181 3300025919 Ga0207657_10105831 Ga0207657_101058314 106
182 3300025920 Ga0207649_10662840 Ga0207649_106628402 106
183 3300025921 Ga0207652_10061303 Ga0207652_100613032 106
184 3300025921 Ga0207652_10097132 Ga0207652_100971323 106
185 3300025921 Ga0207652_10193426 Ga0207652_101934262 106
186 3300025921 Ga0207652_11007201 Ga0207652_110072012 106
187 3300025924 Ga0207694_10079125 Ga0207694_100791251 106
188 3300025924 Ga0207694_10086086 Ga0207694_100860861 106
189 3300025924 Ga0207694_10130144 Ga0207694_101301442 106
190 3300025924 Ga0207694_10724986 Ga0207694_107249862 106
191 3300025926 Ga0207659_10106035 Ga0207659_101060352 106
192 3300025926 Ga0207659_10760082 Ga0207659_107600822 106
193 3300025928 Ga0207700_10250582 Ga0207700_102505821 106
194 3300025929 Ga0207664_10091448 Ga0207664_100914483 106
195 3300025929 Ga0207664_10338678 Ga0207664_103386782 106
196 3300025929 Ga0207664_11528012 Ga0207664_115280121 106
197 3300025933 Ga0207706_10283926 Ga0207706_102839262 106
198 3300025934 Ga0207686_10231769 Ga0207686_102317691 106
199 3300025934 Ga0207686_10276982 Ga0207686_102769822 106
200 3300025936 Ga0207670_10064119 Ga0207670_100641192 106
201 3300025940 Ga0207691_10056959 Ga0207691_100569593 106
202 3300025940 Ga0207691_11540320 Ga0207691_115403201 106
203 3300025941 Ga0207711_11519926 Ga0207711_115199261 106
204 3300025949 Ga0207667_10009605 Ga0207667_1000960511 106
205 3300025949 Ga0207667_10042923 Ga0207667_100429234 106
206 3300025949 Ga0207667_10180054 Ga0207667_101800542 106
207 3300025960 Ga0207651_10072026 Ga0207651_100720262 106
208 3300025960 Ga0207651_10094883 Ga0207651_100948834 106
209 3300025981 Ga0207640_12015853 Ga0207640_120158531 106
210 3300025986 Ga0207658_10447077 Ga0207658_104470772 106
211 3300026023 Ga0207677_10129855 Ga0207677_101298552 106
212 3300026035 Ga0207703_12183990 Ga0207703_121839902 106
213 3300026041 Ga0207639_10021692 Ga0207639_100216928 106
214 3300026041 Ga0207639_10117579 Ga0207639_101175792 106
215 3300026041 Ga0207639_10353481 Ga0207639_103534812 106
216 3300026041 Ga0207639_10439388 Ga0207639_104393882 106
217 3300026075 Ga0207708_10058790 Ga0207708_100587902 106
218 3300026078 Ga0207702_10065510 Ga0207702_100655103 106
219 3300026078 Ga0207702_10102183 Ga0207702_101021834 106
220 3300026088 Ga0207641_10252317 Ga0207641_102523173 106
221 3300026088 Ga0207641_10881878 Ga0207641_108818782 106
222 3300026089 Ga0207648_10018110 Ga0207648_100181108 106
223 3300026089 Ga0207648_11050370 Ga0207648_110503702 106
224 3300026118 Ga0207675_100165704 Ga0207675_1001657043 106
225 3300026118 Ga0207675_100333271 Ga0207675_1003332712 106
226 3300026121 Ga0207683_10637211 Ga0207683_106372112 106
227 3300026142 Ga0207698_10054525 Ga0207698_100545252 106
228 3300026142 Ga0207698_10120570 Ga0207698_101205703 106
229 3300026142 Ga0207698_11582852 Ga0207698_115828522 106
230 3300026142 Ga0207698_12219418 Ga0207698_122194181 106
231 3300027907 Ga0207428_10166875 Ga0207428_101668752 106
232 3300028381 Ga0268264_10131961 Ga0268264_101319612 106
233 3300031548 Ga0307408_100257524 Ga0307408_1002575242 106
234 3300031548 Ga0307408_100361392 Ga0307408_1003613922 106
235 3300031548 Ga0307408_100499636 Ga0307408_1004996362 106
236 3300031731 Ga0307405_10121518 Ga0307405_101215181 106
237 3300031731 Ga0307405_10235718 Ga0307405_102357183 106
238 3300031731 Ga0307405_11098042 Ga0307405_110980422 106
239 3300031731 Ga0307405_11197564 Ga0307405_111975642 106
240 3300031824 Ga0307413_10709002 Ga0307413_107090022 106
241 3300031852 Ga0307410_10814151 Ga0307410_108141512 106
242 3300031852 Ga0307410_11427218 Ga0307410_114272182 106
243 3300031852 Ga0307410_12043220 Ga0307410_120432202 106
244 3300031901 Ga0307406_10366554 Ga0307406_103665543 106
245 3300031911 Ga0307412_10463975 Ga0307412_104639753 106
246 3300031911 Ga0307412_10556420 Ga0307412_105564202 106
247 3300031995 Ga0307409_100461735 Ga0307409_1004617352 106
248 3300032002 Ga0307416_100279764 Ga0307416_1002797643 106
249 3300032002 Ga0307416_100291293 Ga0307416_1002912933 106
250 3300032002 Ga0307416_100574914 Ga0307416_1005749142 106
251 3300032002 Ga0307416_102340339 Ga0307416_1023403391 106
252 3300032005 Ga0307411_10556711 Ga0307411_105567112 106
253 3300032005 Ga0307411_10567222 Ga0307411_105672222 106
254 3300032005 Ga0307411_10901140 Ga0307411_109011402 106
255 3300032005 Ga0307411_12107524 Ga0307411_121075241 106
256 3300032126 Ga0307415_100475356 Ga0307415_1004753562 106
257 3300032126 Ga0307415_101174116 Ga0307415_1011741162 106
258 3300035691 Ga0373931_0203394 Ga0373931_0203394_677_997 106
259 3300035691 Ga0373931_0861773 Ga0373931_0861773_168_488 106
260 3300037418 Ga0395900_0063575 Ga0395900_0063575_1808_2128 106
261 3300037418 Ga0395900_0578879 Ga0395900_0578879_443_763 106
262 3300037466 Ga0395898_1784719 Ga0395898_1784719_85_405 106
263 3300037471 Ga0395905_0031170 Ga0395905_0031170_3036_3356 106
264 3300037471 Ga0395905_0293325 Ga0395905_0293325_1118_1438 106
265 3300038443 Ga0395901_0043034 Ga0395901_0043034_2434_2754 106
266 3300041407 Ga0439447_099941 Ga0439447_099941_110_430 106
267 3300041408 Ga0439453_0059022 Ga0439453_0059022_449_769 106
268 3300041443 Ga0451789_0632955 Ga0451789_0632955_163_483 106
269 3300041452 Ga0451793_1922151 Ga0451793_1922151_14_334 106
270 3300041456 Ga0451795_0081561 Ga0451795_0081561_306_626 106
271 3300041486 Ga0451807_1253253 Ga0451807_1253253_214_534 106
272 3300041492 Ga0451835_0967853 Ga0451835_0967853_229_549 106
273 3300041512 Ga0451853_0166656 Ga0451853_0166656_785_1105 106
274 3300042001 Ga0439441_007124 Ga0439441_007124_481_801 106
275 3300042156 Ga0439446_0251782 Ga0439446_0251782_190_510 106
276 3300042436 Ga0439435_0170362 Ga0439435_0170362_63_383 106
277 3300044684 Ga0466966_0147805 Ga0466966_0147805_307_627 106
278 3300044693 Ga0466961_0032363 Ga0466961_0032363_175_495 106
279 3300044719 Ga0466971_0321607 Ga0466971_0321607_47_367 106
280 3300044842 Ga0466957_0014006 Ga0466957_0014006_830_1150 106
281 3300045049 Ga0466959_0464468 Ga0466959_0464468_294_614 106
282 3300045051 Ga0451576_0790020 Ga0451576_0790020_417_737 106
283 3300045836 Ga0466958_0049225 Ga0466958_0049225_1653_1973 106
284 3300045976 Ga0466967_1184361 Ga0466967_1184361_92_412 106
285 3300046525 Ga0495663_0253830 Ga0495663_0253830_255_575 106
286 3300046539 Ga0495621_0067402 Ga0495621_0067402_135_455 106
287 3300046663 Ga0495635_1000095 Ga0495635_1000095_66_386 106
288 3300046680 Ga0495646_0608555 Ga0495646_0608555_34_354 106
289 3300046683 Ga0495658_0191631 Ga0495658_0191631_657_995 106
290 3300049575 Ga0501039_0547834 Ga0501039_0547834_329_649 106
291 3300049578 Ga0501042_1354590 Ga0501042_1354590_167_487 106
292 3300049661 Ga0501217_067366 Ga0501217_067366_25_345 106
293 3300049679 Ga0501249_092341 Ga0501249_092341_156_476 106
294 3300049690 Ga0501261_062421 Ga0501261_062421_47_367 106
295 3300049766 Ga0501269_018763 Ga0501269_018763_375_695 106
296 3300050493 nmdc:mga0k408_165272_c1 nmdc:mga0k408_165272_c1_636_956 106
297 3300050493 nmdc:mga0k408_281452_c1 nmdc:mga0k408_281452_c1_137_457 106
298 3300050496 nmdc:mga07m45_323760_c1 nmdc:mga07m45_323760_c1_493_813 106
299 3300050508 nmdc:mga09592_455373_c1 nmdc:mga09592_455373_c1_345_665 106
300 3300050511 nmdc:mga08y16_295931_c1 nmdc:mga08y16_295931_c1_233_553 106
301 3300050512 nmdc:mga0n895_1538283_c1 nmdc:mga0n895_1538283_c1_80_400 106
302 3300050513 nmdc:mga0rr50_573347_c1 nmdc:mga0rr50_573347_c1_122_442 106
303 3300050514 nmdc:mga08x19_1030383_c1 nmdc:mga08x19_1030383_c1_245_565 106
304 3300061719 Ga0466962_0070638 Ga0466962_0070638_478_798 106
305 3300005328 Ga0070676_10498886 Ga0070676_104988861 107
306 3300005329 Ga0070683_101077456 Ga0070683_1010774562 107
307 3300005330 Ga0070690_101342169 Ga0070690_1013421691 107
308 3300005331 Ga0070670_101993366 Ga0070670_1019933661 107
309 3300005334 Ga0068869_100261777 Ga0068869_1002617772 107
310 3300005338 Ga0068868_100025276 Ga0068868_1000252762 107
311 3300005340 Ga0070689_100721829 Ga0070689_1007218292 107
312 3300005354 Ga0070675_100037600 Ga0070675_1000376003 107
313 3300005354 Ga0070675_100722622 Ga0070675_1007226222 107
314 3300005355 Ga0070671_100559463 Ga0070671_1005594632 107
315 3300005356 Ga0070674_100260273 Ga0070674_1002602733 107
316 3300005365 Ga0070688_100069533 Ga0070688_1000695332 107
317 3300005437 Ga0070710_11102760 Ga0070710_111027602 107
318 3300005440 Ga0070705_100143439 Ga0070705_1001434392 107
319 3300005440 Ga0070705_101164941 Ga0070705_1011649412 107
320 3300005459 Ga0068867_102276773 Ga0068867_1022767731 107
321 3300005466 Ga0070685_10041658 Ga0070685_100416583 107
322 3300005467 Ga0070706_102049065 Ga0070706_1020490651 107
323 3300005471 Ga0070698_100131883 Ga0070698_1001318833 107
324 3300005518 Ga0070699_100052995 Ga0070699_1000529954 107
325 3300005518 Ga0070699_101038095 Ga0070699_1010380951 107
326 3300005535 Ga0070684_100474389 Ga0070684_1004743892 107
327 3300005536 Ga0070697_100358949 Ga0070697_1003589492 107
328 3300005536 Ga0070697_101846306 Ga0070697_1018463061 107
329 3300005543 Ga0070672_100051228 Ga0070672_1000512281 107
330 3300005546 Ga0070696_100043500 Ga0070696_1000435005 107
331 3300005549 Ga0070704_100190839 Ga0070704_1001908393 107
332 3300005577 Ga0068857_100013438 Ga0068857_1000134388 107
333 3300005578 Ga0068854_100590415 Ga0068854_1005904152 107
334 3300005616 Ga0068852_100000254 Ga0068852_10000025434 107
335 3300005834 Ga0068851_10002016 Ga0068851_100020163 107
336 3300005840 Ga0068870_10417926 Ga0068870_104179262 107
337 3300005842 Ga0068858_100311795 Ga0068858_1003117951 107
338 3300005842 Ga0068858_101766355 Ga0068858_1017663552 107
339 3300006058 Ga0075432_10377136 Ga0075432_103771362 107
340 3300006237 Ga0097621_100012830 Ga0097621_1000128304 107
341 3300006358 Ga0068871_100041820 Ga0068871_1000418204 107
342 3300006852 Ga0075433_11580461 Ga0075433_115804612 107
343 3300006871 Ga0075434_100059321 Ga0075434_1000593213 107
344 3300006914 Ga0075436_100002584 Ga0075436_1000025843 107
345 3300007076 Ga0075435_100194025 Ga0075435_1001940253 107
346 3300009093 Ga0105240_10035335 Ga0105240_100353357 107
347 3300009148 Ga0105243_10365631 Ga0105243_103656312 107
348 3300009176 Ga0105242_10004748 Ga0105242_100047489 107
349 3300009177 Ga0105248_10045282 Ga0105248_100452822 107
350 3300009545 Ga0105237_11696419 Ga0105237_116964191 107
351 3300009551 Ga0105238_10655444 Ga0105238_106554442 107
352 3300009553 Ga0105249_11154889 Ga0105249_111548891 107
353 3300013105 Ga0157369_11800162 Ga0157369_118001622 107
354 3300013306 Ga0163162_10135416 Ga0163162_101354162 107
355 3300013308 Ga0157375_10139435 Ga0157375_101394354 107
356 3300014745 Ga0157377_10164309 Ga0157377_101643092 107
357 3300014968 Ga0157379_10027667 Ga0157379_100276671 107
358 3300017792 Ga0163161_10389773 Ga0163161_103897733 107
359 3300021384 Ga0213876_10044224 Ga0213876_100442242 107
360 3300025315 Ga0207697_10111586 Ga0207697_101115862 107
361 3300025321 Ga0207656_10001529 Ga0207656_100015297 107
362 3300025901 Ga0207688_10060868 Ga0207688_100608683 107
363 3300025908 Ga0207643_10099266 Ga0207643_100992663 107
364 3300025909 Ga0207705_10945429 Ga0207705_109454291 107
365 3300025913 Ga0207695_10026267 Ga0207695_100262676 107
366 3300025923 Ga0207681_10592723 Ga0207681_105927232 107
367 3300025924 Ga0207694_10345323 Ga0207694_103453232 107
368 3300025926 Ga0207659_10223281 Ga0207659_102232812 107
369 3300025927 Ga0207687_10141398 Ga0207687_101413982 107
370 3300025934 Ga0207686_10004988 Ga0207686_100049886 107
371 3300025935 Ga0207709_10144368 Ga0207709_101443682 107
372 3300025936 Ga0207670_10014182 Ga0207670_100141822 107
373 3300025937 Ga0207669_10087677 Ga0207669_100876772 107
374 3300025940 Ga0207691_10018917 Ga0207691_100189172 107
375 3300025944 Ga0207661_10907760 Ga0207661_109077602 107
376 3300025981 Ga0207640_11504722 Ga0207640_115047222 107
377 3300026023 Ga0207677_10025133 Ga0207677_100251334 107
378 3300026035 Ga0207703_10020762 Ga0207703_100207622 107
379 3300026075 Ga0207708_11089683 Ga0207708_110896832 107
380 3300026089 Ga0207648_10085800 Ga0207648_100858002 107
381 3300026116 Ga0207674_10005717 Ga0207674_1000571717 107
382 3300026118 Ga0207675_100479836 Ga0207675_1004798363 107
383 3300026121 Ga0207683_10380383 Ga0207683_103803832 107
384 3300026142 Ga0207698_10005304 Ga0207698_100053042 107
385 3300027876 Ga0209974_10251462 Ga0209974_102514622 107
386 3300031247 Ga0265340_10170561 Ga0265340_101705612 107
387 3300031250 Ga0265331_10192213 Ga0265331_101922132 107
388 3300031911 Ga0307412_11416722 Ga0307412_114167222 107
389 3300032002 Ga0307416_100645272 Ga0307416_1006452722 107
390 3300032002 Ga0307416_101479350 Ga0307416_1014793502 107
391 3300035089 Ga0373944_0354465 Ga0373944_0354465_149_472 107
392 3300035691 Ga0373931_0065454 Ga0373931_0065454_1502_1825 107
393 3300035692 Ga0373935_0048668 Ga0373935_0048668_1467_1790 107
394 3300035695 Ga0373927_0286701 Ga0373927_0286701_19_342 107
395 3300036401 Ga0373937_0049030 Ga0373937_0049030_2064_2387 107
396 3300037068 Ga0373925_0515651 Ga0373925_0515651_400_723 107
397 3300039437 Ga0436365_1596890 Ga0436365_1596890_3179_3502 107
398 3300041459 Ga0451800_1189066 Ga0451800_1189066_80_403 107
399 3300042125 Ga0450923_036574 Ga0450923_036574_631_954 107
400 3300044673 Ga0453683_0253939 Ga0453683_0253939_467_790 107
401 3300044694 Ga0466963_0944117 Ga0466963_0944117_50_373 107
402 3300045051 Ga0451576_0452060 Ga0451576_0452060_370_693 107
403 3300046539 Ga0495621_0008698 Ga0495621_0008698_1122_1445 107
404 3300046539 Ga0495621_0041524 Ga0495621_0041524_179_502 107
405 3300048907 Ga0496104_0029274 Ga0496104_0029274_1084_1407 107
406 3300048912 Ga0496109_0103498 Ga0496109_0103498_2106_2429 107
407 3300048913 Ga0496110_0019539 Ga0496110_0019539_2484_2807 107
408 3300048914 Ga0496111_0582813 Ga0496111_0582813_215_538 107
409 3300049650 Ga0501199_067193 Ga0501199_067193_152_475 107
410 3300050507 nmdc:mga05p37_496227_c1 nmdc:mga05p37_496227_c1_391_714 107
411 3300050512 nmdc:mga0n895_317164_c1 nmdc:mga0n895_317164_c1_1235_1558 107
412 3300050513 nmdc:mga0rr50_179914_c1 nmdc:mga0rr50_179914_c1_860_1183 107
413 3300050513 nmdc:mga0rr50_375493_c1 nmdc:mga0rr50_375493_c1_553_876 107
414 3300050513 nmdc:mga0rr50_955338_c1 nmdc:mga0rr50_955338_c1_356_679 107
415 3300050514 nmdc:mga08x19_3628_c1 nmdc:mga08x19_3628_c1_3225_3548 107
416 3300005345 Ga0070692_10797424 Ga0070692_107974242 108
417 3300005356 Ga0070674_100378668 Ga0070674_1003786682 108
418 3300005356 Ga0070674_100409536 Ga0070674_1004095362 108
419 3300005444 Ga0070694_101893563 Ga0070694_1018935631 108
420 3300005458 Ga0070681_10854633 Ga0070681_108546332 108
421 3300005459 Ga0068867_101567209 Ga0068867_1015672091 108
422 3300005544 Ga0070686_100687275 Ga0070686_1006872752 108
423 3300005545 Ga0070695_101719974 Ga0070695_1017199741 108
424 3300005548 Ga0070665_100313519 Ga0070665_1003135193 108
425 3300005548 Ga0070665_101697586 Ga0070665_1016975861 108
426 3300005615 Ga0070702_100105946 Ga0070702_1001059462 108
427 3300005719 Ga0068861_101684743 Ga0068861_1016847432 108
428 3300006038 Ga0075365_10955660 Ga0075365_109556602 108
429 3300006048 Ga0075363_100956590 Ga0075363_1009565901 108
430 3300006051 Ga0075364_10048752 Ga0075364_100487523 108
431 3300006058 Ga0075432_10082442 Ga0075432_100824422 108
432 3300006177 Ga0075362_10451335 Ga0075362_104513352 108
433 3300006178 Ga0075367_10796467 Ga0075367_107964671 108
434 3300006186 Ga0075369_10071963 Ga0075369_100719632 108
435 3300006195 Ga0075366_10019840 Ga0075366_100198402 108
436 3300006195 Ga0075366_10430853 Ga0075366_104308532 108
437 3300006237 Ga0097621_100902496 Ga0097621_1009024961 108
438 3300006852 Ga0075433_10218148 Ga0075433_102181483 108
439 3300009098 Ga0105245_10421741 Ga0105245_104217411 108
440 3300009148 Ga0105243_10452292 Ga0105243_104522922 108
441 3300009148 Ga0105243_11195692 Ga0105243_111956922 108
442 3300009148 Ga0105243_11300737 Ga0105243_113007372 108
443 3300009176 Ga0105242_13269424 Ga0105242_132694242 108
444 3300009177 Ga0105248_11303228 Ga0105248_113032282 108
445 3300009551 Ga0105238_10313222 Ga0105238_103132222 108
446 3300009553 Ga0105249_10467964 Ga0105249_104679641 108
447 3300010375 Ga0105239_12619759 Ga0105239_126197592 108
448 3300013306 Ga0163162_10065955 Ga0163162_100659552 108
449 3300014326 Ga0157380_10017395 Ga0157380_100173956 108
450 3300014326 Ga0157380_10341719 Ga0157380_103417192 108
451 3300014326 Ga0157380_11989570 Ga0157380_119895702 108
452 3300014969 Ga0157376_10163539 Ga0157376_101635392 108
453 3300017792 Ga0163161_10070314 Ga0163161_100703144 108
454 3300025912 Ga0207707_10697395 Ga0207707_106973952 108
455 3300025918 Ga0207662_10500627 Ga0207662_105006272 108
456 3300025924 Ga0207694_10307487 Ga0207694_103074872 108
457 3300025926 Ga0207659_11244628 Ga0207659_112446281 108
458 3300025934 Ga0207686_11314680 Ga0207686_113146802 108
459 3300025934 Ga0207686_11634682 Ga0207686_116346821 108
460 3300025935 Ga0207709_10266167 Ga0207709_102661672 108
461 3300025935 Ga0207709_10628029 Ga0207709_106280292 108
462 3300025941 Ga0207711_11214029 Ga0207711_112140292 108
463 3300025961 Ga0207712_11449941 Ga0207712_114499412 108
464 3300025981 Ga0207640_11126020 Ga0207640_111260202 108
465 3300026089 Ga0207648_10277286 Ga0207648_102772863 108
466 3300026089 Ga0207648_11282696 Ga0207648_112826962 108
467 3300026118 Ga0207675_102036041 Ga0207675_1020360412 108
468 3300026142 Ga0207698_11984628 Ga0207698_119846282 108
469 3300027907 Ga0207428_10143936 Ga0207428_101439362 108
470 3300028379 Ga0268266_10125834 Ga0268266_101258342 108
471 3300031238 Ga0265332_10129594 Ga0265332_101295942 108
472 3300034819 Ga0373958_0139674 Ga0373958_0139674_101_430 108
473 3300042876 Ga0451577_0376517 Ga0451577_0376517_887_1213 108
474 3300044712 Ga0453684_1707413 Ga0453684_1707413_62_388 108
475 3300046794 Ga0495589_0168476 Ga0495589_0168476_508_837 108
476 3300050490 nmdc:mga03n38_882147_c1 nmdc:mga03n38_882147_c1_48_377 108
477 3300050491 nmdc:mga00v17_48221_c1 nmdc:mga00v17_48221_c1_1536_1865 108
478 3300050493 nmdc:mga0k408_23222_c1 nmdc:mga0k408_23222_c1_102_431 108
479 3300050493 nmdc:mga0k408_745634_c1 nmdc:mga0k408_745634_c1_66_395 108
480 3300050515 nmdc:mga0a205_201645_c1 nmdc:mga0a205_201645_c1_595_921 108
481 3300050516 nmdc:mga0sz30_89787_c1 nmdc:mga0sz30_89787_c1_372_701 108
482 3300053096 Ga0500641_0323433 Ga0500641_0323433_76_405 108
483 3300014745 Ga0157377_10277736 Ga0157377_102777361 110
484 3300005338 Ga0068868_101837936 Ga0068868_1018379362 112
485 3300005366 Ga0070659_100433286 Ga0070659_1004332861 112
486 3300005564 Ga0070664_100112044 Ga0070664_1001120441 112
487 3300005577 Ga0068857_100505164 Ga0068857_1005051642 112
488 3300005614 Ga0068856_100142967 Ga0068856_1001429673 112
489 3300005834 Ga0068851_10443678 Ga0068851_104436781 112
490 3300025321 Ga0207656_10236800 Ga0207656_102368002 112
491 3300025928 Ga0207700_11126224 Ga0207700_111262242 112
492 3300025932 Ga0207690_10475548 Ga0207690_104755481 112
493 3300025945 Ga0207679_10260394 Ga0207679_102603941 112
494 3300026078 Ga0207702_10190514 Ga0207702_101905142 112
495 3300005458 Ga0070681_11459983 Ga0070681_114599831 114
496 3300005530 Ga0070679_100750450 Ga0070679_1007504502 114
497 3300005616 Ga0068852_101109983 Ga0068852_1011099831 114
498 3300006177 Ga0075362_10362239 Ga0075362_103622392 114
499 3300025921 Ga0207652_10784452 Ga0207652_107844522 114
500 3300026088 Ga0207641_10383355 Ga0207641_103833551 114
501 3300031507 Ga0307509_10459264 Ga0307509_104592642 114
502 3300050489 nmdc:mga03683_117006_c1 nmdc:mga03683_117006_c1_655_1005 114
503 3300005327 Ga0070658_10004064 Ga0070658_100040644 115
504 3300005336 Ga0070680_100017626 Ga0070680_1000176261 115
505 3300005337 Ga0070682_100040696 Ga0070682_1000406964 115
506 3300005344 Ga0070661_100036646 Ga0070661_1000366464 115
507 3300005577 Ga0068857_100025753 Ga0068857_1000257533 115
508 3300005578 Ga0068854_100006930 Ga0068854_1000069306 115
509 3300005616 Ga0068852_100052417 Ga0068852_1000524174 115
510 3300009174 Ga0105241_10011678 Ga0105241_100116788 115
511 3300009545 Ga0105237_10229657 Ga0105237_102296572 115
512 3300009551 Ga0105238_10003397 Ga0105238_1000339715 115
513 3300013102 Ga0157371_10023455 Ga0157371_100234555 115
514 3300013105 Ga0157369_10370990 Ga0157369_103709902 115
515 3300013307 Ga0157372_10098767 Ga0157372_100987672 115
516 3300014497 Ga0182008_10047237 Ga0182008_100472372 115
517 3300020069 Ga0197907_10049381 Ga0197907_100493813 115
518 3300020070 Ga0206356_10632517 Ga0206356_106325171 115
519 3300020078 Ga0206352_10660858 Ga0206352_106608582 115
520 3300020082 Ga0206353_10160707 Ga0206353_101607072 115
521 3300022467 Ga0224712_10089071 Ga0224712_100890712 115
522 3300025909 Ga0207705_10039760 Ga0207705_100397604 115
523 3300025911 Ga0207654_10005423 Ga0207654_100054232 115
524 3300025912 Ga0207707_10004510 Ga0207707_100045106 115
525 3300025917 Ga0207660_10004556 Ga0207660_1000455612 115
526 3300025920 Ga0207649_10005246 Ga0207649_100052464 115
527 3300025949 Ga0207667_10002090 Ga0207667_1000209017 115
528 3300025981 Ga0207640_10066307 Ga0207640_100663073 115
529 3300037466 Ga0395898_0130221 Ga0395898_0130221_1612_1959 115
530 3300038443 Ga0395901_0412004 Ga0395901_0412004_456_803 115
531 3300044658 Ga0466972_0211306 Ga0466972_0211306_440_796 115
532 3300044842 Ga0466957_0718109 Ga0466957_0718109_157_513 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02482

Ribosomal_S30AE

Sigma 54 modulation protein / S30EA ribosomal protein

3

93

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.9676 1 91
5zep-assembly1.cif.gz_x m. smegmatis hibernating state 70s ribosome structure 0.9521 1 89
6h4n-assembly1.cif.gz_x structure of a hibernating 100s ribosome reveals an inactive conformation of the ribosomal protein s1 - 70s hibernating e. coli ribosome 0.9513 1 95
4hei-assembly1.cif.gz_A 2a x-ray structure of hpf from vibrio cholerae 0.9474 1 91
4v8h-assembly2.cif.gz_CX crystal structure of hpf bound to the 70s ribosome. 0.947 1 95
ID Description Score Start End Superfamily
af_I1KB15_71_175_3.30.160.100 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9571 2 95 3.30.160.100
af_O05886_21_120_3.30.160.100 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9462 4 93 3.30.160.100
3v26X00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9436 1 95 3.30.160.100
3v26X00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9342 1 95 3.30.160.100
3tqmD00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like 0.9247 2 90 3.30.160.100
ID Description Score Start End GO Terms
AF-A0A368WJ10-F1-model_v4 deleted 0.991 1 96
AF-A0A6I8MAB8-F1-model_v4 Sigma 54 modulation protein/30S ribosomal protein S30EA 0.987 1 90 GO:0022627
GO:0043024
GO:0045900
AF-X1KU52-F1-model_v4 Sigma 54 modulation/S30EA ribosomal protein C-terminal domain-containing protein 0.9856 1 91 GO:0022627
GO:0043024
GO:0045900
AF-W7QDR6-F1-model_v4 Ribosome hibernation promoting factor (Hibernation factor HPF) 0.9854 1 67 GO:0022627
GO:0043024
GO:0045900
AF-A0A2E6KPT6-F1-model_v4 Ribosome hibernation promoting factor (Hibernation factor HPF) 0.9847 1 95 GO:0022627
GO:0043024
GO:0045900

Feature Viewer

pLDDT pTM Quality
84.65 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map