F460283
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 532 | 260 | 531 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300026088|Ga0207641_10383355|Ga0207641_103833551 |
| Length | 123 |
| Sequence | MNLQLTGHHVDITPAIRKYVVTKLERIERHFDHVIDVNVVMTVEKLDQKIEANVHLAGKEIHCECHEVDMYAAIDGLIDKLDRQVVKHKEKFKSNTRHSPGTIRQLPALGAKSAGSGFSSQVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 204 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 213 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 214 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 215 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 218 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 242 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 243 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 244 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 245 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 246 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 247 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 248 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 249 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 250 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 259 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 260 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.87 |
| Metatranscriptomes | 0.94 |
| Isolates | 0.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.76 |
| Nodule | 0 |
| Rhizoplane | 1.69 |
| Rhizosphere | 93.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10004064 | 3300005327 | Bacteria | 11996 |
| 2 | Ga0070658_10440947 | 3300005327 | Bacteria | 1121 |
| 3 | Ga0070658_11897317 | 3300005327 | Bacteria | 515 |
| 4 | Ga0070676_10498886 | 3300005328 | Bacteria | 864 |
| 5 | Ga0070676_10519757 | 3300005328 | Bacteria | 848 |
| 6 | Ga0070676_11274005 | 3300005328 | Bacteria | 561 |
| 7 | Ga0070683_100012926 | 3300005329 | Bacteria | 7266 |
| 8 | Ga0070683_101077456 | 3300005329 | Bacteria | 772 |
| 9 | Ga0070690_101040006 | 3300005330 | Bacteria | 647 |
| 10 | Ga0070690_101342169 | 3300005330 | Bacteria | 574 |
| 11 | Ga0070670_101993366 | 3300005331 | Bacteria | 535 |
| 12 | Ga0070677_10039108 | 3300005333 | Bacteria | 1860 |
| 13 | Ga0068869_100261777 | 3300005334 | Bacteria | 1385 |
| 14 | Ga0070666_10744898 | 3300005335 | Bacteria | 720 |
| 15 | Ga0070680_100017626 | 3300005336 | Bacteria | 5633 |
| 16 | Ga0070680_100096304 | 3300005336 | Bacteria | 2454 |
| 17 | Ga0070680_100431467 | 3300005336 | Bacteria | 1125 |
| 18 | Ga0070682_100040696 | 3300005337 | Bacteria | 2860 |
| 19 | Ga0068868_100025276 | 3300005338 | Bacteria | 4515 |
| 20 | Ga0068868_100291409 | 3300005338 | Bacteria | 1384 |
| 21 | Ga0068868_100877802 | 3300005338 | Bacteria | 814 |
| 22 | Ga0068868_101837936 | 3300005338 | Bacteria | 573 |
| 23 | Ga0070660_100355743 | 3300005339 | Bacteria | 1206 |
| 24 | Ga0070660_100522465 | 3300005339 | Bacteria | 989 |
| 25 | Ga0070689_100193767 | 3300005340 | Bacteria | 1656 |
| 26 | Ga0070689_100721829 | 3300005340 | Bacteria | 872 |
| 27 | Ga0070687_100239719 | 3300005343 | Bacteria | 1121 |
| 28 | Ga0070687_100309199 | 3300005343 | Bacteria | 1006 |
| 29 | Ga0070661_100036646 | 3300005344 | Bacteria | 3565 |
| 30 | Ga0070661_100970726 | 3300005344 | Bacteria | 704 |
| 31 | Ga0070692_10124298 | 3300005345 | Bacteria | 1443 |
| 32 | Ga0070692_10797424 | 3300005345 | Bacteria | 645 |
| 33 | Ga0070692_11007303 | 3300005345 | Bacteria | 583 |
| 34 | Ga0070692_11064705 | 3300005345 | Bacteria | 569 |
| 35 | Ga0070669_100344351 | 3300005353 | Bacteria | 1209 |
| 36 | Ga0070675_100037600 | 3300005354 | Bacteria | 3944 |
| 37 | Ga0070675_100045961 | 3300005354 | Bacteria | 3575 |
| 38 | Ga0070675_100722622 | 3300005354 | Bacteria | 908 |
| 39 | Ga0070671_100559463 | 3300005355 | Bacteria | 987 |
| 40 | Ga0070671_100611987 | 3300005355 | Bacteria | 942 |
| 41 | Ga0070674_100260273 | 3300005356 | Bacteria | 1366 |
| 42 | Ga0070674_100378668 | 3300005356 | Bacteria | 1151 |
| 43 | Ga0070674_100409536 | 3300005356 | Bacteria | 1110 |
| 44 | Ga0070674_100495373 | 3300005356 | Bacteria | 1017 |
| 45 | Ga0070673_100079991 | 3300005364 | Bacteria | 2647 |
| 46 | Ga0070673_100146317 | 3300005364 | Bacteria | 1998 |
| 47 | Ga0070688_100069533 | 3300005365 | Bacteria | 2248 |
| 48 | Ga0070688_100124016 | 3300005365 | Bacteria | 1734 |
| 49 | Ga0070659_100433286 | 3300005366 | Bacteria | 1113 |
| 50 | Ga0070667_101425491 | 3300005367 | Bacteria | 650 |
| 51 | Ga0070709_10529888 | 3300005434 | Bacteria | 899 |
| 52 | Ga0070714_100095163 | 3300005435 | Bacteria | 2615 |
| 53 | Ga0070714_100353336 | 3300005435 | Bacteria | 1381 |
| 54 | Ga0070713_100604658 | 3300005436 | Bacteria | 1042 |
| 55 | Ga0070713_100651500 | 3300005436 | Bacteria | 1003 |
| 56 | Ga0070713_101545841 | 3300005436 | Bacteria | 644 |
| 57 | Ga0070710_10706671 | 3300005437 | Bacteria | 712 |
| 58 | Ga0070710_11102760 | 3300005437 | Bacteria | 583 |
| 59 | Ga0070701_10105202 | 3300005438 | Bacteria | 1569 |
| 60 | Ga0070701_10154080 | 3300005438 | Bacteria | 1326 |
| 61 | Ga0070711_100204511 | 3300005439 | Bacteria | 1526 |
| 62 | Ga0070705_100143439 | 3300005440 | Bacteria | 1575 |
| 63 | Ga0070705_101164941 | 3300005440 | Bacteria | 634 |
| 64 | Ga0070700_100080910 | 3300005441 | Bacteria | 2097 |
| 65 | Ga0070700_100910586 | 3300005441 | Bacteria | 717 |
| 66 | Ga0070694_101893563 | 3300005444 | Bacteria | 509 |
| 67 | Ga0070678_100262245 | 3300005456 | Bacteria | 1454 |
| 68 | Ga0070678_100655920 | 3300005456 | Bacteria | 942 |
| 69 | Ga0070662_100952363 | 3300005457 | Bacteria | 734 |
| 70 | Ga0070681_10018054 | 3300005458 | Bacteria | 7049 |
| 71 | Ga0070681_10526151 | 3300005458 | Bacteria | 1096 |
| 72 | Ga0070681_10854633 | 3300005458 | Bacteria | 828 |
| 73 | Ga0070681_11459983 | 3300005458 | Bacteria | 608 |
| 74 | Ga0068867_100085893 | 3300005459 | Bacteria | 2379 |
| 75 | Ga0068867_100692315 | 3300005459 | Bacteria | 898 |
| 76 | Ga0068867_101567209 | 3300005459 | Bacteria | 615 |
| 77 | Ga0068867_102276773 | 3300005459 | Bacteria | 515 |
| 78 | Ga0070685_10041658 | 3300005466 | Bacteria | 2618 |
| 79 | Ga0070685_10197822 | 3300005466 | Bacteria | 1305 |
| 80 | Ga0070706_102049065 | 3300005467 | Bacteria | 518 |
| 81 | Ga0070698_100131883 | 3300005471 | Bacteria | 2454 |
| 82 | Ga0070699_100052995 | 3300005518 | Bacteria | 3511 |
| 83 | Ga0070699_101038095 | 3300005518 | Bacteria | 752 |
| 84 | Ga0070679_100068758 | 3300005530 | Bacteria | 3533 |
| 85 | Ga0070679_100088421 | 3300005530 | Bacteria | 3085 |
| 86 | Ga0070679_100288919 | 3300005530 | Bacteria | 1591 |
| 87 | Ga0070679_100750450 | 3300005530 | Bacteria | 919 |
| 88 | Ga0070684_100127461 | 3300005535 | Bacteria | 2294 |
| 89 | Ga0070684_100474389 | 3300005535 | Bacteria | 1158 |
| 90 | Ga0070697_100358949 | 3300005536 | Bacteria | 1260 |
| 91 | Ga0070697_101846306 | 3300005536 | Bacteria | 541 |
| 92 | Ga0068853_100019107 | 3300005539 | Bacteria | 5678 |
| 93 | Ga0068853_100022090 | 3300005539 | Bacteria | 5310 |
| 94 | Ga0068853_101737457 | 3300005539 | Bacteria | 605 |
| 95 | Ga0070672_100051228 | 3300005543 | Bacteria | 3218 |
| 96 | Ga0070672_100210086 | 3300005543 | Bacteria | 1630 |
| 97 | Ga0070686_100687275 | 3300005544 | Bacteria | 815 |
| 98 | Ga0070695_101719974 | 3300005545 | Bacteria | 525 |
| 99 | Ga0070696_100043500 | 3300005546 | Bacteria | 3107 |
| 100 | Ga0070696_100393971 | 3300005546 | Bacteria | 1082 |
| 101 | Ga0070693_100055279 | 3300005547 | Bacteria | 2286 |
| 102 | Ga0070693_100173541 | 3300005547 | Bacteria | 1382 |
| 103 | Ga0070665_100313519 | 3300005548 | Bacteria | 1573 |
| 104 | Ga0070665_101697586 | 3300005548 | Bacteria | 639 |
| 105 | Ga0070704_100190839 | 3300005549 | Bacteria | 1647 |
| 106 | Ga0068855_100004693 | 3300005563 | Bacteria | 16702 |
| 107 | Ga0068855_100014349 | 3300005563 | Bacteria | 9539 |
| 108 | Ga0068855_100871823 | 3300005563 | Bacteria | 952 |
| 109 | Ga0070664_100112044 | 3300005564 | Bacteria | 2382 |
| 110 | Ga0070664_100795994 | 3300005564 | Bacteria | 884 |
| 111 | Ga0070664_102384259 | 3300005564 | Bacteria | 502 |
| 112 | Ga0068857_100013438 | 3300005577 | Bacteria | 7132 |
| 113 | Ga0068857_100025753 | 3300005577 | Bacteria | 5179 |
| 114 | Ga0068857_100505164 | 3300005577 | Bacteria | 1135 |
| 115 | Ga0068854_100006930 | 3300005578 | Bacteria | 7228 |
| 116 | Ga0068854_100590415 | 3300005578 | Bacteria | 947 |
| 117 | Ga0068856_100142967 | 3300005614 | Bacteria | 2400 |
| 118 | Ga0068856_100156552 | 3300005614 | Bacteria | 2288 |
| 119 | Ga0068856_100518030 | 3300005614 | Bacteria | 1214 |
| 120 | Ga0070702_100105946 | 3300005615 | Bacteria | 1734 |
| 121 | Ga0070702_100261937 | 3300005615 | Bacteria | 1178 |
| 122 | Ga0068852_100000254 | 3300005616 | Bacteria | 36057 |
| 123 | Ga0068852_100009086 | 3300005616 | Bacteria | 7359 |
| 124 | Ga0068852_100012864 | 3300005616 | Bacteria | 6378 |
| 125 | Ga0068852_100052417 | 3300005616 | Bacteria | 3506 |
| 126 | Ga0068852_100060465 | 3300005616 | Bacteria | 3288 |
| 127 | Ga0068852_101109983 | 3300005616 | Bacteria | 811 |
| 128 | Ga0068852_101209744 | 3300005616 | Bacteria | 777 |
| 129 | Ga0068852_101795580 | 3300005616 | Bacteria | 636 |
| 130 | Ga0068859_100081573 | 3300005617 | Bacteria | 3277 |
| 131 | Ga0068866_10392667 | 3300005718 | Bacteria | 893 |
| 132 | Ga0068866_10397816 | 3300005718 | Bacteria | 888 |
| 133 | Ga0068861_101684743 | 3300005719 | Bacteria | 627 |
| 134 | Ga0068851_10002016 | 3300005834 | Bacteria | 8953 |
| 135 | Ga0068851_10144977 | 3300005834 | Bacteria | 1294 |
| 136 | Ga0068851_10443678 | 3300005834 | Bacteria | 770 |
| 137 | Ga0068870_10417926 | 3300005840 | Bacteria | 877 |
| 138 | Ga0068870_10529767 | 3300005840 | Bacteria | 790 |
| 139 | Ga0068863_100299770 | 3300005841 | Bacteria | 1559 |
| 140 | Ga0068858_100311795 | 3300005842 | Bacteria | 1502 |
| 141 | Ga0068858_100629534 | 3300005842 | Bacteria | 1042 |
| 142 | Ga0068858_101629613 | 3300005842 | Bacteria | 637 |
| 143 | Ga0068858_101766355 | 3300005842 | Bacteria | 611 |
| 144 | Ga0070717_10069659 | 3300006028 | Bacteria | 2930 |
| 145 | Ga0075365_10955660 | 3300006038 | Bacteria | 604 |
| 146 | Ga0075363_100956590 | 3300006048 | Bacteria | 526 |
| 147 | Ga0075364_10048752 | 3300006051 | Bacteria | 2760 |
| 148 | Ga0075432_10082442 | 3300006058 | Bacteria | 1168 |
| 149 | Ga0075432_10369678 | 3300006058 | Bacteria | 612 |
| 150 | Ga0075432_10377136 | 3300006058 | Bacteria | 607 |
| 151 | Ga0075362_10362239 | 3300006177 | Bacteria | 727 |
| 152 | Ga0075362_10451335 | 3300006177 | Bacteria | 653 |
| 153 | Ga0075367_10796467 | 3300006178 | Bacteria | 602 |
| 154 | Ga0075369_10071963 | 3300006186 | Bacteria | 1523 |
| 155 | Ga0075366_10019840 | 3300006195 | Bacteria | 3895 |
| 156 | Ga0075366_10021104 | 3300006195 | Bacteria | 3786 |
| 157 | Ga0075366_10430853 | 3300006195 | Bacteria | 813 |
| 158 | Ga0097621_100012830 | 3300006237 | Bacteria | 6224 |
| 159 | Ga0097621_100605586 | 3300006237 | Bacteria | 1002 |
| 160 | Ga0097621_100902496 | 3300006237 | Bacteria | 823 |
| 161 | Ga0068871_100041820 | 3300006358 | Bacteria | 3676 |
| 162 | Ga0068871_100232069 | 3300006358 | Bacteria | 1602 |
| 163 | Ga0068871_100594736 | 3300006358 | Bacteria | 1006 |
| 164 | Ga0068871_100898810 | 3300006358 | Bacteria | 821 |
| 165 | Ga0075428_100011836 | 3300006844 | Bacteria | 9708 |
| 166 | Ga0075431_101071846 | 3300006847 | Bacteria | 771 |
| 167 | Ga0075433_10218148 | 3300006852 | Bacteria | 1695 |
| 168 | Ga0075433_11580461 | 3300006852 | Bacteria | 566 |
| 169 | Ga0075434_100059321 | 3300006871 | Bacteria | 3804 |
| 170 | Ga0075434_101838901 | 3300006871 | Bacteria | 612 |
| 171 | Ga0068865_100875388 | 3300006881 | Bacteria | 780 |
| 172 | Ga0075436_100002584 | 3300006914 | Bacteria | 12445 |
| 173 | Ga0075436_100790606 | 3300006914 | Bacteria | 706 |
| 174 | Ga0097620_100081575 | 3300006931 | Bacteria | 3277 |
| 175 | Ga0075435_100194025 | 3300007076 | Bacteria | 1719 |
| 176 | Ga0105240_10035335 | 3300009093 | Bacteria | 6442 |
| 177 | Ga0105240_10056757 | 3300009093 | Bacteria | 4897 |
| 178 | Ga0105240_10063439 | 3300009093 | Bacteria | 4596 |
| 179 | Ga0105240_10874831 | 3300009093 | Bacteria | 968 |
| 180 | Ga0111539_10001826 | 3300009094 | Bacteria | 28335 |
| 181 | Ga0105245_10316194 | 3300009098 | Bacteria | 1537 |
| 182 | Ga0105245_10421741 | 3300009098 | Bacteria | 1337 |
| 183 | Ga0105245_10522438 | 3300009098 | Bacteria | 1206 |
| 184 | Ga0105245_10912224 | 3300009098 | Bacteria | 920 |
| 185 | Ga0105245_11393342 | 3300009098 | Bacteria | 751 |
| 186 | Ga0105243_10365631 | 3300009148 | Bacteria | 1329 |
| 187 | Ga0105243_10452292 | 3300009148 | Bacteria | 1205 |
| 188 | Ga0105243_11195692 | 3300009148 | Bacteria | 773 |
| 189 | Ga0105243_11296390 | 3300009148 | Bacteria | 745 |
| 190 | Ga0105243_11300737 | 3300009148 | Bacteria | 744 |
| 191 | Ga0105241_10011678 | 3300009174 | Bacteria | 6447 |
| 192 | Ga0105241_10023794 | 3300009174 | Bacteria | 4545 |
| 193 | Ga0105241_10206681 | 3300009174 | Bacteria | 1643 |
| 194 | Ga0105241_10299669 | 3300009174 | Bacteria | 1379 |
| 195 | Ga0105242_10004748 | 3300009176 | Bacteria | 10522 |
| 196 | Ga0105242_10401168 | 3300009176 | Bacteria | 1280 |
| 197 | Ga0105242_10562595 | 3300009176 | Bacteria | 1095 |
| 198 | Ga0105242_13269424 | 3300009176 | Bacteria | 504 |
| 199 | Ga0105248_10045282 | 3300009177 | Bacteria | 4934 |
| 200 | Ga0105248_10327004 | 3300009177 | Bacteria | 1727 |
| 201 | Ga0105248_11303228 | 3300009177 | Bacteria | 822 |
| 202 | Ga0105248_11317214 | 3300009177 | Bacteria | 817 |
| 203 | Ga0105248_11786028 | 3300009177 | Bacteria | 697 |
| 204 | Ga0105248_12540795 | 3300009177 | Bacteria | 584 |
| 205 | Ga0105237_10229657 | 3300009545 | Bacteria | 1857 |
| 206 | Ga0105237_10794417 | 3300009545 | Bacteria | 953 |
| 207 | Ga0105237_11112653 | 3300009545 | Bacteria | 797 |
| 208 | Ga0105237_11696419 | 3300009545 | Bacteria | 639 |
| 209 | Ga0105238_10003397 | 3300009551 | Bacteria | 15895 |
| 210 | Ga0105238_10022825 | 3300009551 | Bacteria | 6378 |
| 211 | Ga0105238_10039577 | 3300009551 | Bacteria | 4780 |
| 212 | Ga0105238_10292407 | 3300009551 | Bacteria | 1611 |
| 213 | Ga0105238_10313222 | 3300009551 | Bacteria | 1555 |
| 214 | Ga0105238_10655444 | 3300009551 | Bacteria | 1060 |
| 215 | Ga0105238_11282119 | 3300009551 | Bacteria | 758 |
| 216 | Ga0105238_11512570 | 3300009551 | Bacteria | 700 |
| 217 | Ga0105249_10467964 | 3300009553 | Bacteria | 1301 |
| 218 | Ga0105249_11154889 | 3300009553 | Bacteria | 845 |
| 219 | Ga0105239_10279615 | 3300010375 | Bacteria | 1879 |
| 220 | Ga0105239_10853422 | 3300010375 | Bacteria | 1044 |
| 221 | Ga0105239_12442180 | 3300010375 | Bacteria | 609 |
| 222 | Ga0105239_12619759 | 3300010375 | Bacteria | 588 |
| 223 | Ga0157329_1012060 | 3300012491 | Bacteria | 702 |
| 224 | Ga0157373_10383110 | 3300013100 | Bacteria | 1006 |
| 225 | Ga0157371_10023455 | 3300013102 | Bacteria | 4512 |
| 226 | Ga0157371_10088807 | 3300013102 | Bacteria | 2189 |
| 227 | Ga0157370_10814645 | 3300013104 | Bacteria | 849 |
| 228 | Ga0157369_10002524 | 3300013105 | Bacteria | 21881 |
| 229 | Ga0157369_10077702 | 3300013105 | Bacteria | 3557 |
| 230 | Ga0157369_10370990 | 3300013105 | Bacteria | 1486 |
| 231 | Ga0157369_11800162 | 3300013105 | Bacteria | 622 |
| 232 | Ga0157374_11913233 | 3300013296 | Bacteria | 619 |
| 233 | Ga0157378_10615262 | 3300013297 | Bacteria | 1099 |
| 234 | Ga0157378_11178592 | 3300013297 | Bacteria | 805 |
| 235 | Ga0163162_10065955 | 3300013306 | Bacteria | 3669 |
| 236 | Ga0163162_10135416 | 3300013306 | Bacteria | 2574 |
| 237 | Ga0163162_11356620 | 3300013306 | Bacteria | 809 |
| 238 | Ga0163162_12894147 | 3300013306 | Bacteria | 552 |
| 239 | Ga0157372_10026804 | 3300013307 | Bacteria | 6273 |
| 240 | Ga0157372_10046255 | 3300013307 | Bacteria | 4831 |
| 241 | Ga0157372_10098767 | 3300013307 | Bacteria | 3331 |
| 242 | Ga0157372_10762777 | 3300013307 | Bacteria | 1125 |
| 243 | Ga0157372_12666676 | 3300013307 | Bacteria | 573 |
| 244 | Ga0157375_10139435 | 3300013308 | Bacteria | 2551 |
| 245 | Ga0157375_12334193 | 3300013308 | Bacteria | 638 |
| 246 | Ga0163163_10563540 | 3300014325 | Bacteria | 1202 |
| 247 | Ga0157380_10017395 | 3300014326 | Bacteria | 5320 |
| 248 | Ga0157380_10341719 | 3300014326 | Bacteria | 1397 |
| 249 | Ga0157380_11721487 | 3300014326 | Bacteria | 685 |
| 250 | Ga0157380_11849108 | 3300014326 | Bacteria | 664 |
| 251 | Ga0157380_11989570 | 3300014326 | Bacteria | 643 |
| 252 | Ga0157380_12205547 | 3300014326 | Bacteria | 615 |
| 253 | Ga0182008_10047237 | 3300014497 | Bacteria | 2139 |
| 254 | Ga0157377_10164309 | 3300014745 | Bacteria | 1383 |
| 255 | Ga0157377_10277736 | 3300014745 | Bacteria | 1097 |
| 256 | Ga0157379_10027667 | 3300014968 | Bacteria | 5048 |
| 257 | Ga0157379_11538894 | 3300014968 | Bacteria | 648 |
| 258 | Ga0157379_11652689 | 3300014968 | Bacteria | 626 |
| 259 | Ga0157376_10163539 | 3300014969 | Bacteria | 2020 |
| 260 | Ga0157376_11952083 | 3300014969 | Bacteria | 624 |
| 261 | Ga0157376_12887834 | 3300014969 | Bacteria | 520 |
| 262 | Ga0163161_10070314 | 3300017792 | Bacteria | 2559 |
| 263 | Ga0163161_10389773 | 3300017792 | Bacteria | 1115 |
| 264 | Ga0197907_10049381 | 3300020069 | Bacteria | 1700 |
| 265 | Ga0206356_10632517 | 3300020070 | Bacteria | 3643 |
| 266 | Ga0206352_10660858 | 3300020078 | Bacteria | 755 |
| 267 | Ga0206353_10160707 | 3300020082 | Bacteria | 2009 |
| 268 | Ga0213876_10044224 | 3300021384 | Bacteria | 2354 |
| 269 | Ga0224712_10089071 | 3300022467 | Bacteria | 1289 |
| 270 | Ga0207697_10111586 | 3300025315 | Bacteria | 1171 |
| 271 | Ga0207656_10001529 | 3300025321 | Bacteria | 7668 |
| 272 | Ga0207656_10236800 | 3300025321 | Bacteria | 891 |
| 273 | Ga0207682_10036379 | 3300025893 | Bacteria | 1992 |
| 274 | Ga0207642_10231403 | 3300025899 | Bacteria | 1038 |
| 275 | Ga0207688_10060868 | 3300025901 | Bacteria | 2128 |
| 276 | Ga0207699_10013459 | 3300025906 | Bacteria | 4189 |
| 277 | Ga0207699_10133860 | 3300025906 | Bacteria | 1621 |
| 278 | Ga0207645_10064415 | 3300025907 | Bacteria | 2342 |
| 279 | Ga0207645_10383085 | 3300025907 | Bacteria | 944 |
| 280 | Ga0207643_10099266 | 3300025908 | Bacteria | 1706 |
| 281 | Ga0207705_10039760 | 3300025909 | Bacteria | 3371 |
| 282 | Ga0207705_10170151 | 3300025909 | Bacteria | 1640 |
| 283 | Ga0207705_10181384 | 3300025909 | Bacteria | 1589 |
| 284 | Ga0207705_10691712 | 3300025909 | Bacteria | 793 |
| 285 | Ga0207705_10945429 | 3300025909 | Bacteria | 667 |
| 286 | Ga0207705_10997907 | 3300025909 | Bacteria | 647 |
| 287 | Ga0207654_10005423 | 3300025911 | Bacteria | 6451 |
| 288 | Ga0207654_10204345 | 3300025911 | Bacteria | 1302 |
| 289 | Ga0207654_10530228 | 3300025911 | Bacteria | 834 |
| 290 | Ga0207654_10766535 | 3300025911 | Bacteria | 696 |
| 291 | Ga0207707_10004510 | 3300025912 | Bacteria | 12245 |
| 292 | Ga0207707_10012172 | 3300025912 | Bacteria | 7478 |
| 293 | Ga0207707_10697395 | 3300025912 | Bacteria | 853 |
| 294 | Ga0207707_10988679 | 3300025912 | Bacteria | 691 |
| 295 | Ga0207695_10022239 | 3300025913 | Bacteria | 7209 |
| 296 | Ga0207695_10026267 | 3300025913 | Bacteria | 6500 |
| 297 | Ga0207695_10141166 | 3300025913 | Bacteria | 2357 |
| 298 | Ga0207695_10229975 | 3300025913 | Bacteria | 1759 |
| 299 | Ga0207695_11672402 | 3300025913 | Bacteria | 517 |
| 300 | Ga0207693_11295217 | 3300025915 | Bacteria | 545 |
| 301 | Ga0207660_10004556 | 3300025917 | Bacteria | 9038 |
| 302 | Ga0207660_10387460 | 3300025917 | Bacteria | 1124 |
| 303 | Ga0207660_11598150 | 3300025917 | Bacteria | 525 |
| 304 | Ga0207662_10341206 | 3300025918 | Bacteria | 1004 |
| 305 | Ga0207662_10345159 | 3300025918 | Bacteria | 998 |
| 306 | Ga0207662_10500627 | 3300025918 | Bacteria | 836 |
| 307 | Ga0207657_10098056 | 3300025919 | Bacteria | 2436 |
| 308 | Ga0207657_10105831 | 3300025919 | Bacteria | 2328 |
| 309 | Ga0207649_10005246 | 3300025920 | Bacteria | 7001 |
| 310 | Ga0207649_10662840 | 3300025920 | Bacteria | 807 |
| 311 | Ga0207652_10061303 | 3300025921 | Bacteria | 3248 |
| 312 | Ga0207652_10097132 | 3300025921 | Bacteria | 2596 |
| 313 | Ga0207652_10193426 | 3300025921 | Bacteria | 1830 |
| 314 | Ga0207652_10784452 | 3300025921 | Bacteria | 847 |
| 315 | Ga0207652_11007201 | 3300025921 | Bacteria | 732 |
| 316 | Ga0207681_10592723 | 3300025923 | Bacteria | 915 |
| 317 | Ga0207694_10079125 | 3300025924 | Bacteria | 2578 |
| 318 | Ga0207694_10086086 | 3300025924 | Bacteria | 2474 |
| 319 | Ga0207694_10130144 | 3300025924 | Bacteria | 2017 |
| 320 | Ga0207694_10307487 | 3300025924 | Bacteria | 1306 |
| 321 | Ga0207694_10345323 | 3300025924 | Bacteria | 1231 |
| 322 | Ga0207694_10724986 | 3300025924 | Bacteria | 839 |
| 323 | Ga0207659_10106035 | 3300025926 | Bacteria | 2127 |
| 324 | Ga0207659_10223281 | 3300025926 | Bacteria | 1516 |
| 325 | Ga0207659_10760082 | 3300025926 | Bacteria | 832 |
| 326 | Ga0207659_11244628 | 3300025926 | Bacteria | 639 |
| 327 | Ga0207687_10141398 | 3300025927 | Bacteria | 1826 |
| 328 | Ga0207700_10250582 | 3300025928 | Bacteria | 1513 |
| 329 | Ga0207700_10287154 | 3300025928 | Bacteria | 1417 |
| 330 | Ga0207700_11126224 | 3300025928 | Unclassified | 701 |
| 331 | Ga0207664_10091448 | 3300025929 | Bacteria | 2495 |
| 332 | Ga0207664_10338678 | 3300025929 | Bacteria | 1330 |
| 333 | Ga0207664_11528012 | 3300025929 | Bacteria | 589 |
| 334 | Ga0207644_11721909 | 3300025931 | Bacteria | 525 |
| 335 | Ga0207690_10475548 | 3300025932 | Bacteria | 1008 |
| 336 | Ga0207706_10283926 | 3300025933 | Bacteria | 1443 |
| 337 | Ga0207686_10004988 | 3300025934 | Bacteria | 7145 |
| 338 | Ga0207686_10231769 | 3300025934 | Bacteria | 1339 |
| 339 | Ga0207686_10276982 | 3300025934 | Bacteria | 1237 |
| 340 | Ga0207686_11314680 | 3300025934 | Bacteria | 594 |
| 341 | Ga0207686_11634682 | 3300025934 | Bacteria | 532 |
| 342 | Ga0207709_10144368 | 3300025935 | Bacteria | 1640 |
| 343 | Ga0207709_10266167 | 3300025935 | Bacteria | 1259 |
| 344 | Ga0207709_10628029 | 3300025935 | Bacteria | 853 |
| 345 | Ga0207670_10014182 | 3300025936 | Bacteria | 4722 |
| 346 | Ga0207670_10064119 | 3300025936 | Bacteria | 2517 |
| 347 | Ga0207669_10087677 | 3300025937 | Bacteria | 2016 |
| 348 | Ga0207691_10018917 | 3300025940 | Bacteria | 6525 |
| 349 | Ga0207691_10056959 | 3300025940 | Bacteria | 3559 |
| 350 | Ga0207691_11540320 | 3300025940 | Bacteria | 542 |
| 351 | Ga0207711_11214029 | 3300025941 | Bacteria | 696 |
| 352 | Ga0207711_11519926 | 3300025941 | Bacteria | 613 |
| 353 | Ga0207661_10907760 | 3300025944 | Bacteria | 811 |
| 354 | Ga0207679_10260394 | 3300025945 | Bacteria | 1479 |
| 355 | Ga0207667_10002090 | 3300025949 | Bacteria | 25032 |
| 356 | Ga0207667_10009605 | 3300025949 | Bacteria | 11381 |
| 357 | Ga0207667_10042923 | 3300025949 | Bacteria | 4802 |
| 358 | Ga0207667_10180054 | 3300025949 | Bacteria | 2171 |
| 359 | Ga0207651_10072026 | 3300025960 | Bacteria | 2452 |
| 360 | Ga0207651_10094883 | 3300025960 | Bacteria | 2195 |
| 361 | Ga0207712_11449941 | 3300025961 | Bacteria | 614 |
| 362 | Ga0207640_10066307 | 3300025981 | Bacteria | 2412 |
| 363 | Ga0207640_11126020 | 3300025981 | Bacteria | 695 |
| 364 | Ga0207640_11504722 | 3300025981 | Bacteria | 605 |
| 365 | Ga0207640_12015853 | 3300025981 | Bacteria | 523 |
| 366 | Ga0207658_10447077 | 3300025986 | Bacteria | 1144 |
| 367 | Ga0207677_10025133 | 3300026023 | Bacteria | 3711 |
| 368 | Ga0207677_10129855 | 3300026023 | Bacteria | 1911 |
| 369 | Ga0207703_10020762 | 3300026035 | Bacteria | 5139 |
| 370 | Ga0207703_12183990 | 3300026035 | Bacteria | 530 |
| 371 | Ga0207639_10021692 | 3300026041 | Bacteria | 4616 |
| 372 | Ga0207639_10117579 | 3300026041 | Bacteria | 2179 |
| 373 | Ga0207639_10353481 | 3300026041 | Bacteria | 1313 |
| 374 | Ga0207639_10439388 | 3300026041 | Bacteria | 1183 |
| 375 | Ga0207708_10058790 | 3300026075 | Bacteria | 2933 |
| 376 | Ga0207708_11089683 | 3300026075 | Bacteria | 696 |
| 377 | Ga0207702_10065510 | 3300026078 | Bacteria | 3112 |
| 378 | Ga0207702_10102183 | 3300026078 | Bacteria | 2533 |
| 379 | Ga0207702_10190514 | 3300026078 | Bacteria | 1894 |
| 380 | Ga0207641_10252317 | 3300026088 | Bacteria | 1648 |
| 381 | Ga0207641_10383355 | 3300026088 | Bacteria | 1347 |
| 382 | Ga0207641_10881878 | 3300026088 | Bacteria | 888 |
| 383 | Ga0207648_10018110 | 3300026089 | Bacteria | 6378 |
| 384 | Ga0207648_10085800 | 3300026089 | Bacteria | 2746 |
| 385 | Ga0207648_10277286 | 3300026089 | Bacteria | 1499 |
| 386 | Ga0207648_11050370 | 3300026089 | Bacteria | 763 |
| 387 | Ga0207648_11282696 | 3300026089 | Bacteria | 688 |
| 388 | Ga0207674_10005717 | 3300026116 | Bacteria | 14740 |
| 389 | Ga0207675_100165704 | 3300026118 | Bacteria | 2110 |
| 390 | Ga0207675_100333271 | 3300026118 | Bacteria | 1484 |
| 391 | Ga0207675_100479836 | 3300026118 | Bacteria | 1236 |
| 392 | Ga0207675_102036041 | 3300026118 | Bacteria | 591 |
| 393 | Ga0207683_10380383 | 3300026121 | Bacteria | 1298 |
| 394 | Ga0207683_10637211 | 3300026121 | Bacteria | 987 |
| 395 | Ga0207698_10005304 | 3300026142 | Bacteria | 7941 |
| 396 | Ga0207698_10038333 | 3300026142 | Bacteria | 3540 |
| 397 | Ga0207698_10054525 | 3300026142 | Bacteria | 3076 |
| 398 | Ga0207698_10120570 | 3300026142 | Bacteria | 2219 |
| 399 | Ga0207698_11582852 | 3300026142 | Bacteria | 671 |
| 400 | Ga0207698_11984628 | 3300026142 | Bacteria | 596 |
| 401 | Ga0207698_12219418 | 3300026142 | Bacteria | 562 |
| 402 | Ga0209974_10251462 | 3300027876 | Bacteria | 665 |
| 403 | Ga0207428_10143936 | 3300027907 | Bacteria | 1818 |
| 404 | Ga0207428_10166875 | 3300027907 | Bacteria | 1669 |
| 405 | Ga0268266_10125834 | 3300028379 | Bacteria | 2287 |
| 406 | Ga0268264_10131961 | 3300028381 | Bacteria | 2216 |
| 407 | Ga0265332_10129594 | 3300031238 | Bacteria | 1058 |
| 408 | Ga0265340_10170561 | 3300031247 | Bacteria | 986 |
| 409 | Ga0265331_10192213 | 3300031250 | Bacteria | 921 |
| 410 | Ga0307509_10459264 | 3300031507 | Bacteria | 966 |
| 411 | Ga0307408_100257524 | 3300031548 | Bacteria | 1442 |
| 412 | Ga0307408_100361392 | 3300031548 | Bacteria | 1235 |
| 413 | Ga0307408_100499636 | 3300031548 | Bacteria | 1064 |
| 414 | Ga0307405_10121518 | 3300031731 | Bacteria | 1788 |
| 415 | Ga0307405_10235718 | 3300031731 | Bacteria | 1352 |
| 416 | Ga0307405_11098042 | 3300031731 | Bacteria | 683 |
| 417 | Ga0307405_11197564 | 3300031731 | Bacteria | 657 |
| 418 | Ga0307413_10709002 | 3300031824 | Bacteria | 837 |
| 419 | Ga0307410_10814151 | 3300031852 | Bacteria | 795 |
| 420 | Ga0307410_11427218 | 3300031852 | Bacteria | 608 |
| 421 | Ga0307410_12043220 | 3300031852 | Bacteria | 512 |
| 422 | Ga0307406_10366554 | 3300031901 | Bacteria | 1131 |
| 423 | Ga0307412_10079185 | 3300031911 | Bacteria | 2266 |
| 424 | Ga0307412_10463975 | 3300031911 | Bacteria | 1046 |
| 425 | Ga0307412_10556420 | 3300031911 | Bacteria | 964 |
| 426 | Ga0307412_11416722 | 3300031911 | Bacteria | 629 |
| 427 | Ga0307409_100022877 | 3300031995 | Bacteria | 4317 |
| 428 | Ga0307409_100461735 | 3300031995 | Bacteria | 1228 |
| 429 | Ga0307416_100236042 | 3300032002 | Bacteria | 1767 |
| 430 | Ga0307416_100279764 | 3300032002 | Bacteria | 1644 |
| 431 | Ga0307416_100291293 | 3300032002 | Bacteria | 1616 |
| 432 | Ga0307416_100574914 | 3300032002 | Bacteria | 1203 |
| 433 | Ga0307416_100645272 | 3300032002 | Bacteria | 1143 |
| 434 | Ga0307416_101479350 | 3300032002 | Bacteria | 785 |
| 435 | Ga0307416_102340339 | 3300032002 | Bacteria | 634 |
| 436 | Ga0307414_10127559 | 3300032004 | Bacteria | 1969 |
| 437 | Ga0307411_10556711 | 3300032005 | Bacteria | 979 |
| 438 | Ga0307411_10567222 | 3300032005 | Bacteria | 971 |
| 439 | Ga0307411_10901140 | 3300032005 | Bacteria | 786 |
| 440 | Ga0307411_12107524 | 3300032005 | Bacteria | 528 |
| 441 | Ga0307415_100475356 | 3300032126 | Bacteria | 1087 |
| 442 | Ga0307415_101111480 | 3300032126 | Bacteria | 740 |
| 443 | Ga0307415_101174116 | 3300032126 | Bacteria | 722 |
| 444 | Ga0373958_0139674 | 3300034819 | Bacteria | 599 |
| 445 | Ga0373944_0354465 | 3300035089 | Bacteria | 559 |
| 446 | Ga0373931_0065454 | 3300035691 | Bacteria | 1970 |
| 447 | Ga0373931_0203394 | 3300035691 | Bacteria | 1184 |
| 448 | Ga0373931_0861773 | 3300035691 | Bacteria | 607 |
| 449 | Ga0373935_0048668 | 3300035692 | Bacteria | 2685 |
| 450 | Ga0373927_0286701 | 3300035695 | Bacteria | 1083 |
| 451 | Ga0373937_0049030 | 3300036401 | Bacteria | 3867 |
| 452 | Ga0373925_0515651 | 3300037068 | Bacteria | 982 |
| 453 | Ga0395900_0063575 | 3300037418 | Bacteria | 3794 |
| 454 | Ga0395900_0578879 | 3300037418 | Bacteria | 1065 |
| 455 | Ga0395898_0130221 | 3300037466 | Bacteria | 2410 |
| 456 | Ga0395898_1784719 | 3300037466 | Bacteria | 537 |
| 457 | Ga0395905_0031170 | 3300037471 | Bacteria | 5021 |
| 458 | Ga0395905_0293325 | 3300037471 | Bacteria | 1513 |
| 459 | Ga0395901_0043034 | 3300038443 | Bacteria | 4684 |
| 460 | Ga0395901_0412004 | 3300038443 | Bacteria | 1387 |
| 461 | Ga0436365_1596890 | 3300039437 | Bacteria | 4923 |
| 462 | Ga0439447_099941 | 3300041407 | Bacteria | 666 |
| 463 | Ga0439453_0059022 | 3300041408 | Bacteria | 791 |
| 464 | Ga0451789_0632955 | 3300041443 | Bacteria | 510 |
| 465 | Ga0451793_1922151 | 3300041452 | Bacteria | 1083 |
| 466 | Ga0451795_0081561 | 3300041456 | Bacteria | 673 |
| 467 | Ga0451800_1189066 | 3300041459 | Bacteria | 512 |
| 468 | Ga0451807_1253253 | 3300041486 | Bacteria | 765 |
| 469 | Ga0451835_0967853 | 3300041492 | Bacteria | 622 |
| 470 | Ga0451853_0166656 | 3300041512 | Bacteria | 2036 |
| 471 | Ga0439441_007124 | 3300042001 | Bacteria | 1791 |
| 472 | Ga0450923_036574 | 3300042125 | Bacteria | 1019 |
| 473 | Ga0439446_0251782 | 3300042156 | Bacteria | 609 |
| 474 | Ga0439435_0170362 | 3300042436 | Bacteria | 707 |
| 475 | Ga0451577_0376517 | 3300042876 | Bacteria | 1288 |
| 476 | Ga0466972_0211306 | 3300044658 | Bacteria | 908 |
| 477 | Ga0453683_0253939 | 3300044673 | Bacteria | 1121 |
| 478 | Ga0466966_0147805 | 3300044684 | Bacteria | 1434 |
| 479 | Ga0466961_0032363 | 3300044693 | Bacteria | 3360 |
| 480 | Ga0466963_0944117 | 3300044694 | Bacteria | 607 |
| 481 | Ga0453684_1707413 | 3300044712 | Bacteria | 643 |
| 482 | Ga0466971_0321607 | 3300044719 | Bacteria | 745 |
| 483 | Ga0466957_0014006 | 3300044842 | Bacteria | 4664 |
| 484 | Ga0466957_0718109 | 3300044842 | Bacteria | 706 |
| 485 | Ga0466959_0464468 | 3300045049 | Bacteria | 857 |
| 486 | Ga0451576_0452060 | 3300045051 | Bacteria | 1349 |
| 487 | Ga0451576_0790020 | 3300045051 | Bacteria | 997 |
| 488 | Ga0466958_0049225 | 3300045836 | Bacteria | 2549 |
| 489 | Ga0466967_1184361 | 3300045976 | Bacteria | 761 |
| 490 | Ga0495663_0253830 | 3300046525 | Bacteria | 625 |
| 491 | Ga0495621_0008698 | 3300046539 | Bacteria | 3053 |
| 492 | Ga0495621_0041524 | 3300046539 | Bacteria | 1616 |
| 493 | Ga0495621_0067402 | 3300046539 | Bacteria | 1311 |
| 494 | Ga0495635_1000095 | 3300046663 | Bacteria | 532 |
| 495 | Ga0495646_0608555 | 3300046680 | Bacteria | 555 |
| 496 | Ga0495658_0191631 | 3300046683 | Bacteria | 1271 |
| 497 | Ga0495589_0168476 | 3300046794 | Bacteria | 1042 |
| 498 | Ga0496104_0029274 | 3300048907 | Bacteria | 5108 |
| 499 | Ga0496109_0103498 | 3300048912 | Bacteria | 2643 |
| 500 | Ga0496110_0019539 | 3300048913 | Bacteria | 5704 |
| 501 | Ga0496111_0582813 | 3300048914 | Bacteria | 820 |
| 502 | Ga0501039_0547834 | 3300049575 | Bacteria | 908 |
| 503 | Ga0501042_1354590 | 3300049578 | Bacteria | 519 |
| 504 | Ga0501199_067193 | 3300049650 | Bacteria | 509 |
| 505 | Ga0501217_067366 | 3300049661 | Bacteria | 968 |
| 506 | Ga0501249_092341 | 3300049679 | Bacteria | 719 |
| 507 | Ga0501261_062421 | 3300049690 | Bacteria | 636 |
| 508 | Ga0501269_018763 | 3300049766 | Bacteria | 858 |
| 509 | nmdc:mga03683_117006_c1 | 3300050489 | Bacteria | 1182 |
| 510 | nmdc:mga03n38_882147_c1 | 3300050490 | Bacteria | 525 |
| 511 | nmdc:mga00v17_48221_c1 | 3300050491 | Bacteria | 2581 |
| 512 | nmdc:mga0k408_165272_c1 | 3300050493 | Bacteria | 1319 |
| 513 | nmdc:mga0k408_23222_c1 | 3300050493 | Bacteria | 3497 |
| 514 | nmdc:mga0k408_281452_c1 | 3300050493 | Bacteria | 993 |
| 515 | nmdc:mga0k408_745634_c1 | 3300050493 | Bacteria | 572 |
| 516 | nmdc:mga07m45_323760_c1 | 3300050496 | Bacteria | 896 |
| 517 | nmdc:mga05p37_496227_c1 | 3300050507 | Bacteria | 1402 |
| 518 | nmdc:mga09592_455373_c1 | 3300050508 | Bacteria | 1103 |
| 519 | nmdc:mga08y16_295931_c1 | 3300050511 | Bacteria | 1669 |
| 520 | nmdc:mga0n895_1538283_c1 | 3300050512 | Bacteria | 631 |
| 521 | nmdc:mga0n895_317164_c1 | 3300050512 | Bacteria | 1580 |
| 522 | nmdc:mga0rr50_179914_c1 | 3300050513 | Bacteria | 1728 |
| 523 | nmdc:mga0rr50_375493_c1 | 3300050513 | Bacteria | 1198 |
| 524 | nmdc:mga0rr50_573347_c1 | 3300050513 | Bacteria | 961 |
| 525 | nmdc:mga0rr50_955338_c1 | 3300050513 | Bacteria | 730 |
| 526 | nmdc:mga08x19_1030383_c1 | 3300050514 | Bacteria | 584 |
| 527 | nmdc:mga08x19_3628_c1 | 3300050514 | Bacteria | 9188 |
| 528 | nmdc:mga0a205_201645_c1 | 3300050515 | Bacteria | 1880 |
| 529 | nmdc:mga0sz30_89787_c1 | 3300050516 | Bacteria | 1336 |
| 530 | Ga0500641_0323433 | 3300053096 | Bacteria | 627 |
| 531 | Ga0466962_0070638 | 3300061719 | Bacteria | 1668 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2574179768 | 2574429213 | 103 |
| 2 | 3300005434 | Ga0070709_10529888 | Ga0070709_105298881 | 105 |
| 3 | 3300005436 | Ga0070713_101545841 | Ga0070713_1015458411 | 105 |
| 4 | 3300005616 | Ga0068852_100012864 | Ga0068852_1000128643 | 105 |
| 5 | 3300025906 | Ga0207699_10133860 | Ga0207699_101338601 | 105 |
| 6 | 3300025928 | Ga0207700_10287154 | Ga0207700_102871542 | 105 |
| 7 | 3300025931 | Ga0207644_11721909 | Ga0207644_117219092 | 105 |
| 8 | 3300026142 | Ga0207698_10038333 | Ga0207698_100383332 | 105 |
| 9 | 3300031911 | Ga0307412_10079185 | Ga0307412_100791852 | 105 |
| 10 | 3300031995 | Ga0307409_100022877 | Ga0307409_1000228771 | 105 |
| 11 | 3300032002 | Ga0307416_100236042 | Ga0307416_1002360422 | 105 |
| 12 | 3300032004 | Ga0307414_10127559 | Ga0307414_101275592 | 105 |
| 13 | 3300032126 | Ga0307415_101111480 | Ga0307415_1011114802 | 105 |
| 14 | 3300005327 | Ga0070658_10440947 | Ga0070658_104409472 | 106 |
| 15 | 3300005327 | Ga0070658_11897317 | Ga0070658_118973171 | 106 |
| 16 | 3300005328 | Ga0070676_10519757 | Ga0070676_105197572 | 106 |
| 17 | 3300005328 | Ga0070676_11274005 | Ga0070676_112740051 | 106 |
| 18 | 3300005329 | Ga0070683_100012926 | Ga0070683_1000129262 | 106 |
| 19 | 3300005330 | Ga0070690_101040006 | Ga0070690_1010400062 | 106 |
| 20 | 3300005333 | Ga0070677_10039108 | Ga0070677_100391082 | 106 |
| 21 | 3300005335 | Ga0070666_10744898 | Ga0070666_107448982 | 106 |
| 22 | 3300005336 | Ga0070680_100096304 | Ga0070680_1000963043 | 106 |
| 23 | 3300005336 | Ga0070680_100431467 | Ga0070680_1004314672 | 106 |
| 24 | 3300005338 | Ga0068868_100291409 | Ga0068868_1002914091 | 106 |
| 25 | 3300005338 | Ga0068868_100877802 | Ga0068868_1008778022 | 106 |
| 26 | 3300005339 | Ga0070660_100355743 | Ga0070660_1003557432 | 106 |
| 27 | 3300005339 | Ga0070660_100522465 | Ga0070660_1005224652 | 106 |
| 28 | 3300005340 | Ga0070689_100193767 | Ga0070689_1001937673 | 106 |
| 29 | 3300005343 | Ga0070687_100239719 | Ga0070687_1002397192 | 106 |
| 30 | 3300005343 | Ga0070687_100309199 | Ga0070687_1003091992 | 106 |
| 31 | 3300005344 | Ga0070661_100970726 | Ga0070661_1009707262 | 106 |
| 32 | 3300005345 | Ga0070692_10124298 | Ga0070692_101242983 | 106 |
| 33 | 3300005345 | Ga0070692_11007303 | Ga0070692_110073031 | 106 |
| 34 | 3300005345 | Ga0070692_11064705 | Ga0070692_110647051 | 106 |
| 35 | 3300005353 | Ga0070669_100344351 | Ga0070669_1003443512 | 106 |
| 36 | 3300005354 | Ga0070675_100045961 | Ga0070675_1000459612 | 106 |
| 37 | 3300005355 | Ga0070671_100611987 | Ga0070671_1006119872 | 106 |
| 38 | 3300005356 | Ga0070674_100495373 | Ga0070674_1004953732 | 106 |
| 39 | 3300005364 | Ga0070673_100079991 | Ga0070673_1000799914 | 106 |
| 40 | 3300005364 | Ga0070673_100146317 | Ga0070673_1001463173 | 106 |
| 41 | 3300005365 | Ga0070688_100124016 | Ga0070688_1001240161 | 106 |
| 42 | 3300005367 | Ga0070667_101425491 | Ga0070667_1014254911 | 106 |
| 43 | 3300005435 | Ga0070714_100095163 | Ga0070714_1000951632 | 106 |
| 44 | 3300005435 | Ga0070714_100353336 | Ga0070714_1003533362 | 106 |
| 45 | 3300005436 | Ga0070713_100604658 | Ga0070713_1006046581 | 106 |
| 46 | 3300005436 | Ga0070713_100651500 | Ga0070713_1006515002 | 106 |
| 47 | 3300005437 | Ga0070710_10706671 | Ga0070710_107066712 | 106 |
| 48 | 3300005438 | Ga0070701_10105202 | Ga0070701_101052023 | 106 |
| 49 | 3300005438 | Ga0070701_10154080 | Ga0070701_101540802 | 106 |
| 50 | 3300005439 | Ga0070711_100204511 | Ga0070711_1002045113 | 106 |
| 51 | 3300005441 | Ga0070700_100080910 | Ga0070700_1000809102 | 106 |
| 52 | 3300005441 | Ga0070700_100910586 | Ga0070700_1009105862 | 106 |
| 53 | 3300005456 | Ga0070678_100262245 | Ga0070678_1002622452 | 106 |
| 54 | 3300005456 | Ga0070678_100655920 | Ga0070678_1006559201 | 106 |
| 55 | 3300005457 | Ga0070662_100952363 | Ga0070662_1009523631 | 106 |
| 56 | 3300005458 | Ga0070681_10018054 | Ga0070681_100180543 | 106 |
| 57 | 3300005458 | Ga0070681_10526151 | Ga0070681_105261512 | 106 |
| 58 | 3300005459 | Ga0068867_100085893 | Ga0068867_1000858933 | 106 |
| 59 | 3300005459 | Ga0068867_100692315 | Ga0068867_1006923151 | 106 |
| 60 | 3300005466 | Ga0070685_10197822 | Ga0070685_101978222 | 106 |
| 61 | 3300005530 | Ga0070679_100068758 | Ga0070679_1000687582 | 106 |
| 62 | 3300005530 | Ga0070679_100088421 | Ga0070679_1000884213 | 106 |
| 63 | 3300005530 | Ga0070679_100288919 | Ga0070679_1002889192 | 106 |
| 64 | 3300005535 | Ga0070684_100127461 | Ga0070684_1001274613 | 106 |
| 65 | 3300005539 | Ga0068853_100019107 | Ga0068853_1000191078 | 106 |
| 66 | 3300005539 | Ga0068853_100022090 | Ga0068853_1000220903 | 106 |
| 67 | 3300005539 | Ga0068853_101737457 | Ga0068853_1017374572 | 106 |
| 68 | 3300005543 | Ga0070672_100210086 | Ga0070672_1002100863 | 106 |
| 69 | 3300005546 | Ga0070696_100393971 | Ga0070696_1003939712 | 106 |
| 70 | 3300005547 | Ga0070693_100055279 | Ga0070693_1000552793 | 106 |
| 71 | 3300005547 | Ga0070693_100173541 | Ga0070693_1001735412 | 106 |
| 72 | 3300005563 | Ga0068855_100004693 | Ga0068855_10000469311 | 106 |
| 73 | 3300005563 | Ga0068855_100014349 | Ga0068855_10001434913 | 106 |
| 74 | 3300005563 | Ga0068855_100871823 | Ga0068855_1008718232 | 106 |
| 75 | 3300005564 | Ga0070664_100795994 | Ga0070664_1007959942 | 106 |
| 76 | 3300005564 | Ga0070664_102384259 | Ga0070664_1023842591 | 106 |
| 77 | 3300005614 | Ga0068856_100156552 | Ga0068856_1001565522 | 106 |
| 78 | 3300005614 | Ga0068856_100518030 | Ga0068856_1005180302 | 106 |
| 79 | 3300005615 | Ga0070702_100261937 | Ga0070702_1002619372 | 106 |
| 80 | 3300005616 | Ga0068852_100009086 | Ga0068852_1000090865 | 106 |
| 81 | 3300005616 | Ga0068852_100060465 | Ga0068852_1000604652 | 106 |
| 82 | 3300005616 | Ga0068852_101209744 | Ga0068852_1012097442 | 106 |
| 83 | 3300005616 | Ga0068852_101795580 | Ga0068852_1017955802 | 106 |
| 84 | 3300005617 | Ga0068859_100081573 | Ga0068859_1000815734 | 106 |
| 85 | 3300005718 | Ga0068866_10392667 | Ga0068866_103926672 | 106 |
| 86 | 3300005718 | Ga0068866_10397816 | Ga0068866_103978161 | 106 |
| 87 | 3300005834 | Ga0068851_10144977 | Ga0068851_101449771 | 106 |
| 88 | 3300005840 | Ga0068870_10529767 | Ga0068870_105297672 | 106 |
| 89 | 3300005841 | Ga0068863_100299770 | Ga0068863_1002997703 | 106 |
| 90 | 3300005842 | Ga0068858_100629534 | Ga0068858_1006295343 | 106 |
| 91 | 3300005842 | Ga0068858_101629613 | Ga0068858_1016296131 | 106 |
| 92 | 3300006028 | Ga0070717_10069659 | Ga0070717_100696592 | 106 |
| 93 | 3300006058 | Ga0075432_10369678 | Ga0075432_103696782 | 106 |
| 94 | 3300006195 | Ga0075366_10021104 | Ga0075366_100211043 | 106 |
| 95 | 3300006237 | Ga0097621_100605586 | Ga0097621_1006055862 | 106 |
| 96 | 3300006358 | Ga0068871_100232069 | Ga0068871_1002320693 | 106 |
| 97 | 3300006358 | Ga0068871_100594736 | Ga0068871_1005947362 | 106 |
| 98 | 3300006358 | Ga0068871_100898810 | Ga0068871_1008988101 | 106 |
| 99 | 3300006844 | Ga0075428_100011836 | Ga0075428_1000118368 | 106 |
| 100 | 3300006847 | Ga0075431_101071846 | Ga0075431_1010718462 | 106 |
| 101 | 3300006871 | Ga0075434_101838901 | Ga0075434_1018389012 | 106 |
| 102 | 3300006881 | Ga0068865_100875388 | Ga0068865_1008753882 | 106 |
| 103 | 3300006914 | Ga0075436_100790606 | Ga0075436_1007906062 | 106 |
| 104 | 3300006931 | Ga0097620_100081575 | Ga0097620_1000815752 | 106 |
| 105 | 3300009093 | Ga0105240_10056757 | Ga0105240_100567574 | 106 |
| 106 | 3300009093 | Ga0105240_10063439 | Ga0105240_100634393 | 106 |
| 107 | 3300009093 | Ga0105240_10874831 | Ga0105240_108748312 | 106 |
| 108 | 3300009094 | Ga0111539_10001826 | Ga0111539_100018263 | 106 |
| 109 | 3300009098 | Ga0105245_10316194 | Ga0105245_103161942 | 106 |
| 110 | 3300009098 | Ga0105245_10522438 | Ga0105245_105224382 | 106 |
| 111 | 3300009098 | Ga0105245_10912224 | Ga0105245_109122242 | 106 |
| 112 | 3300009098 | Ga0105245_11393342 | Ga0105245_113933422 | 106 |
| 113 | 3300009148 | Ga0105243_11296390 | Ga0105243_112963902 | 106 |
| 114 | 3300009174 | Ga0105241_10023794 | Ga0105241_100237947 | 106 |
| 115 | 3300009174 | Ga0105241_10206681 | Ga0105241_102066813 | 106 |
| 116 | 3300009174 | Ga0105241_10299669 | Ga0105241_102996692 | 106 |
| 117 | 3300009176 | Ga0105242_10401168 | Ga0105242_104011682 | 106 |
| 118 | 3300009176 | Ga0105242_10562595 | Ga0105242_105625952 | 106 |
| 119 | 3300009177 | Ga0105248_10327004 | Ga0105248_103270042 | 106 |
| 120 | 3300009177 | Ga0105248_11317214 | Ga0105248_113172141 | 106 |
| 121 | 3300009177 | Ga0105248_11786028 | Ga0105248_117860282 | 106 |
| 122 | 3300009177 | Ga0105248_12540795 | Ga0105248_125407951 | 106 |
| 123 | 3300009545 | Ga0105237_10794417 | Ga0105237_107944172 | 106 |
| 124 | 3300009545 | Ga0105237_11112653 | Ga0105237_111126532 | 106 |
| 125 | 3300009551 | Ga0105238_10022825 | Ga0105238_100228257 | 106 |
| 126 | 3300009551 | Ga0105238_10039577 | Ga0105238_100395777 | 106 |
| 127 | 3300009551 | Ga0105238_10292407 | Ga0105238_102924072 | 106 |
| 128 | 3300009551 | Ga0105238_11282119 | Ga0105238_112821192 | 106 |
| 129 | 3300009551 | Ga0105238_11512570 | Ga0105238_115125702 | 106 |
| 130 | 3300010375 | Ga0105239_10279615 | Ga0105239_102796152 | 106 |
| 131 | 3300010375 | Ga0105239_10853422 | Ga0105239_108534222 | 106 |
| 132 | 3300010375 | Ga0105239_12442180 | Ga0105239_124421802 | 106 |
| 133 | 3300012491 | Ga0157329_1012060 | Ga0157329_10120602 | 106 |
| 134 | 3300013100 | Ga0157373_10383110 | Ga0157373_103831102 | 106 |
| 135 | 3300013102 | Ga0157371_10088807 | Ga0157371_100888073 | 106 |
| 136 | 3300013104 | Ga0157370_10814645 | Ga0157370_108146452 | 106 |
| 137 | 3300013105 | Ga0157369_10002524 | Ga0157369_1000252423 | 106 |
| 138 | 3300013105 | Ga0157369_10077702 | Ga0157369_100777022 | 106 |
| 139 | 3300013296 | Ga0157374_11913233 | Ga0157374_119132331 | 106 |
| 140 | 3300013297 | Ga0157378_10615262 | Ga0157378_106152622 | 106 |
| 141 | 3300013297 | Ga0157378_11178592 | Ga0157378_111785922 | 106 |
| 142 | 3300013306 | Ga0163162_11356620 | Ga0163162_113566202 | 106 |
| 143 | 3300013306 | Ga0163162_12894147 | Ga0163162_128941471 | 106 |
| 144 | 3300013307 | Ga0157372_10026804 | Ga0157372_100268042 | 106 |
| 145 | 3300013307 | Ga0157372_10046255 | Ga0157372_100462552 | 106 |
| 146 | 3300013307 | Ga0157372_10762777 | Ga0157372_107627772 | 106 |
| 147 | 3300013307 | Ga0157372_12666676 | Ga0157372_126666762 | 106 |
| 148 | 3300013308 | Ga0157375_12334193 | Ga0157375_123341932 | 106 |
| 149 | 3300014325 | Ga0163163_10563540 | Ga0163163_105635402 | 106 |
| 150 | 3300014326 | Ga0157380_11721487 | Ga0157380_117214871 | 106 |
| 151 | 3300014326 | Ga0157380_11849108 | Ga0157380_118491082 | 106 |
| 152 | 3300014326 | Ga0157380_12205547 | Ga0157380_122055472 | 106 |
| 153 | 3300014968 | Ga0157379_11538894 | Ga0157379_115388942 | 106 |
| 154 | 3300014968 | Ga0157379_11652689 | Ga0157379_116526891 | 106 |
| 155 | 3300014969 | Ga0157376_11952083 | Ga0157376_119520831 | 106 |
| 156 | 3300014969 | Ga0157376_12887834 | Ga0157376_128878341 | 106 |
| 157 | 3300025893 | Ga0207682_10036379 | Ga0207682_100363793 | 106 |
| 158 | 3300025899 | Ga0207642_10231403 | Ga0207642_102314033 | 106 |
| 159 | 3300025906 | Ga0207699_10013459 | Ga0207699_100134596 | 106 |
| 160 | 3300025907 | Ga0207645_10064415 | Ga0207645_100644153 | 106 |
| 161 | 3300025907 | Ga0207645_10383085 | Ga0207645_103830852 | 106 |
| 162 | 3300025909 | Ga0207705_10170151 | Ga0207705_101701512 | 106 |
| 163 | 3300025909 | Ga0207705_10181384 | Ga0207705_101813842 | 106 |
| 164 | 3300025909 | Ga0207705_10691712 | Ga0207705_106917121 | 106 |
| 165 | 3300025909 | Ga0207705_10997907 | Ga0207705_109979072 | 106 |
| 166 | 3300025911 | Ga0207654_10204345 | Ga0207654_102043452 | 106 |
| 167 | 3300025911 | Ga0207654_10530228 | Ga0207654_105302282 | 106 |
| 168 | 3300025911 | Ga0207654_10766535 | Ga0207654_107665352 | 106 |
| 169 | 3300025912 | Ga0207707_10012172 | Ga0207707_100121724 | 106 |
| 170 | 3300025912 | Ga0207707_10988679 | Ga0207707_109886791 | 106 |
| 171 | 3300025913 | Ga0207695_10022239 | Ga0207695_100222397 | 106 |
| 172 | 3300025913 | Ga0207695_10141166 | Ga0207695_101411662 | 106 |
| 173 | 3300025913 | Ga0207695_10229975 | Ga0207695_102299753 | 106 |
| 174 | 3300025913 | Ga0207695_11672402 | Ga0207695_116724021 | 106 |
| 175 | 3300025915 | Ga0207693_11295217 | Ga0207693_112952172 | 106 |
| 176 | 3300025917 | Ga0207660_10387460 | Ga0207660_103874602 | 106 |
| 177 | 3300025917 | Ga0207660_11598150 | Ga0207660_115981502 | 106 |
| 178 | 3300025918 | Ga0207662_10341206 | Ga0207662_103412061 | 106 |
| 179 | 3300025918 | Ga0207662_10345159 | Ga0207662_103451592 | 106 |
| 180 | 3300025919 | Ga0207657_10098056 | Ga0207657_100980562 | 106 |
| 181 | 3300025919 | Ga0207657_10105831 | Ga0207657_101058314 | 106 |
| 182 | 3300025920 | Ga0207649_10662840 | Ga0207649_106628402 | 106 |
| 183 | 3300025921 | Ga0207652_10061303 | Ga0207652_100613032 | 106 |
| 184 | 3300025921 | Ga0207652_10097132 | Ga0207652_100971323 | 106 |
| 185 | 3300025921 | Ga0207652_10193426 | Ga0207652_101934262 | 106 |
| 186 | 3300025921 | Ga0207652_11007201 | Ga0207652_110072012 | 106 |
| 187 | 3300025924 | Ga0207694_10079125 | Ga0207694_100791251 | 106 |
| 188 | 3300025924 | Ga0207694_10086086 | Ga0207694_100860861 | 106 |
| 189 | 3300025924 | Ga0207694_10130144 | Ga0207694_101301442 | 106 |
| 190 | 3300025924 | Ga0207694_10724986 | Ga0207694_107249862 | 106 |
| 191 | 3300025926 | Ga0207659_10106035 | Ga0207659_101060352 | 106 |
| 192 | 3300025926 | Ga0207659_10760082 | Ga0207659_107600822 | 106 |
| 193 | 3300025928 | Ga0207700_10250582 | Ga0207700_102505821 | 106 |
| 194 | 3300025929 | Ga0207664_10091448 | Ga0207664_100914483 | 106 |
| 195 | 3300025929 | Ga0207664_10338678 | Ga0207664_103386782 | 106 |
| 196 | 3300025929 | Ga0207664_11528012 | Ga0207664_115280121 | 106 |
| 197 | 3300025933 | Ga0207706_10283926 | Ga0207706_102839262 | 106 |
| 198 | 3300025934 | Ga0207686_10231769 | Ga0207686_102317691 | 106 |
| 199 | 3300025934 | Ga0207686_10276982 | Ga0207686_102769822 | 106 |
| 200 | 3300025936 | Ga0207670_10064119 | Ga0207670_100641192 | 106 |
| 201 | 3300025940 | Ga0207691_10056959 | Ga0207691_100569593 | 106 |
| 202 | 3300025940 | Ga0207691_11540320 | Ga0207691_115403201 | 106 |
| 203 | 3300025941 | Ga0207711_11519926 | Ga0207711_115199261 | 106 |
| 204 | 3300025949 | Ga0207667_10009605 | Ga0207667_1000960511 | 106 |
| 205 | 3300025949 | Ga0207667_10042923 | Ga0207667_100429234 | 106 |
| 206 | 3300025949 | Ga0207667_10180054 | Ga0207667_101800542 | 106 |
| 207 | 3300025960 | Ga0207651_10072026 | Ga0207651_100720262 | 106 |
| 208 | 3300025960 | Ga0207651_10094883 | Ga0207651_100948834 | 106 |
| 209 | 3300025981 | Ga0207640_12015853 | Ga0207640_120158531 | 106 |
| 210 | 3300025986 | Ga0207658_10447077 | Ga0207658_104470772 | 106 |
| 211 | 3300026023 | Ga0207677_10129855 | Ga0207677_101298552 | 106 |
| 212 | 3300026035 | Ga0207703_12183990 | Ga0207703_121839902 | 106 |
| 213 | 3300026041 | Ga0207639_10021692 | Ga0207639_100216928 | 106 |
| 214 | 3300026041 | Ga0207639_10117579 | Ga0207639_101175792 | 106 |
| 215 | 3300026041 | Ga0207639_10353481 | Ga0207639_103534812 | 106 |
| 216 | 3300026041 | Ga0207639_10439388 | Ga0207639_104393882 | 106 |
| 217 | 3300026075 | Ga0207708_10058790 | Ga0207708_100587902 | 106 |
| 218 | 3300026078 | Ga0207702_10065510 | Ga0207702_100655103 | 106 |
| 219 | 3300026078 | Ga0207702_10102183 | Ga0207702_101021834 | 106 |
| 220 | 3300026088 | Ga0207641_10252317 | Ga0207641_102523173 | 106 |
| 221 | 3300026088 | Ga0207641_10881878 | Ga0207641_108818782 | 106 |
| 222 | 3300026089 | Ga0207648_10018110 | Ga0207648_100181108 | 106 |
| 223 | 3300026089 | Ga0207648_11050370 | Ga0207648_110503702 | 106 |
| 224 | 3300026118 | Ga0207675_100165704 | Ga0207675_1001657043 | 106 |
| 225 | 3300026118 | Ga0207675_100333271 | Ga0207675_1003332712 | 106 |
| 226 | 3300026121 | Ga0207683_10637211 | Ga0207683_106372112 | 106 |
| 227 | 3300026142 | Ga0207698_10054525 | Ga0207698_100545252 | 106 |
| 228 | 3300026142 | Ga0207698_10120570 | Ga0207698_101205703 | 106 |
| 229 | 3300026142 | Ga0207698_11582852 | Ga0207698_115828522 | 106 |
| 230 | 3300026142 | Ga0207698_12219418 | Ga0207698_122194181 | 106 |
| 231 | 3300027907 | Ga0207428_10166875 | Ga0207428_101668752 | 106 |
| 232 | 3300028381 | Ga0268264_10131961 | Ga0268264_101319612 | 106 |
| 233 | 3300031548 | Ga0307408_100257524 | Ga0307408_1002575242 | 106 |
| 234 | 3300031548 | Ga0307408_100361392 | Ga0307408_1003613922 | 106 |
| 235 | 3300031548 | Ga0307408_100499636 | Ga0307408_1004996362 | 106 |
| 236 | 3300031731 | Ga0307405_10121518 | Ga0307405_101215181 | 106 |
| 237 | 3300031731 | Ga0307405_10235718 | Ga0307405_102357183 | 106 |
| 238 | 3300031731 | Ga0307405_11098042 | Ga0307405_110980422 | 106 |
| 239 | 3300031731 | Ga0307405_11197564 | Ga0307405_111975642 | 106 |
| 240 | 3300031824 | Ga0307413_10709002 | Ga0307413_107090022 | 106 |
| 241 | 3300031852 | Ga0307410_10814151 | Ga0307410_108141512 | 106 |
| 242 | 3300031852 | Ga0307410_11427218 | Ga0307410_114272182 | 106 |
| 243 | 3300031852 | Ga0307410_12043220 | Ga0307410_120432202 | 106 |
| 244 | 3300031901 | Ga0307406_10366554 | Ga0307406_103665543 | 106 |
| 245 | 3300031911 | Ga0307412_10463975 | Ga0307412_104639753 | 106 |
| 246 | 3300031911 | Ga0307412_10556420 | Ga0307412_105564202 | 106 |
| 247 | 3300031995 | Ga0307409_100461735 | Ga0307409_1004617352 | 106 |
| 248 | 3300032002 | Ga0307416_100279764 | Ga0307416_1002797643 | 106 |
| 249 | 3300032002 | Ga0307416_100291293 | Ga0307416_1002912933 | 106 |
| 250 | 3300032002 | Ga0307416_100574914 | Ga0307416_1005749142 | 106 |
| 251 | 3300032002 | Ga0307416_102340339 | Ga0307416_1023403391 | 106 |
| 252 | 3300032005 | Ga0307411_10556711 | Ga0307411_105567112 | 106 |
| 253 | 3300032005 | Ga0307411_10567222 | Ga0307411_105672222 | 106 |
| 254 | 3300032005 | Ga0307411_10901140 | Ga0307411_109011402 | 106 |
| 255 | 3300032005 | Ga0307411_12107524 | Ga0307411_121075241 | 106 |
| 256 | 3300032126 | Ga0307415_100475356 | Ga0307415_1004753562 | 106 |
| 257 | 3300032126 | Ga0307415_101174116 | Ga0307415_1011741162 | 106 |
| 258 | 3300035691 | Ga0373931_0203394 | Ga0373931_0203394_677_997 | 106 |
| 259 | 3300035691 | Ga0373931_0861773 | Ga0373931_0861773_168_488 | 106 |
| 260 | 3300037418 | Ga0395900_0063575 | Ga0395900_0063575_1808_2128 | 106 |
| 261 | 3300037418 | Ga0395900_0578879 | Ga0395900_0578879_443_763 | 106 |
| 262 | 3300037466 | Ga0395898_1784719 | Ga0395898_1784719_85_405 | 106 |
| 263 | 3300037471 | Ga0395905_0031170 | Ga0395905_0031170_3036_3356 | 106 |
| 264 | 3300037471 | Ga0395905_0293325 | Ga0395905_0293325_1118_1438 | 106 |
| 265 | 3300038443 | Ga0395901_0043034 | Ga0395901_0043034_2434_2754 | 106 |
| 266 | 3300041407 | Ga0439447_099941 | Ga0439447_099941_110_430 | 106 |
| 267 | 3300041408 | Ga0439453_0059022 | Ga0439453_0059022_449_769 | 106 |
| 268 | 3300041443 | Ga0451789_0632955 | Ga0451789_0632955_163_483 | 106 |
| 269 | 3300041452 | Ga0451793_1922151 | Ga0451793_1922151_14_334 | 106 |
| 270 | 3300041456 | Ga0451795_0081561 | Ga0451795_0081561_306_626 | 106 |
| 271 | 3300041486 | Ga0451807_1253253 | Ga0451807_1253253_214_534 | 106 |
| 272 | 3300041492 | Ga0451835_0967853 | Ga0451835_0967853_229_549 | 106 |
| 273 | 3300041512 | Ga0451853_0166656 | Ga0451853_0166656_785_1105 | 106 |
| 274 | 3300042001 | Ga0439441_007124 | Ga0439441_007124_481_801 | 106 |
| 275 | 3300042156 | Ga0439446_0251782 | Ga0439446_0251782_190_510 | 106 |
| 276 | 3300042436 | Ga0439435_0170362 | Ga0439435_0170362_63_383 | 106 |
| 277 | 3300044684 | Ga0466966_0147805 | Ga0466966_0147805_307_627 | 106 |
| 278 | 3300044693 | Ga0466961_0032363 | Ga0466961_0032363_175_495 | 106 |
| 279 | 3300044719 | Ga0466971_0321607 | Ga0466971_0321607_47_367 | 106 |
| 280 | 3300044842 | Ga0466957_0014006 | Ga0466957_0014006_830_1150 | 106 |
| 281 | 3300045049 | Ga0466959_0464468 | Ga0466959_0464468_294_614 | 106 |
| 282 | 3300045051 | Ga0451576_0790020 | Ga0451576_0790020_417_737 | 106 |
| 283 | 3300045836 | Ga0466958_0049225 | Ga0466958_0049225_1653_1973 | 106 |
| 284 | 3300045976 | Ga0466967_1184361 | Ga0466967_1184361_92_412 | 106 |
| 285 | 3300046525 | Ga0495663_0253830 | Ga0495663_0253830_255_575 | 106 |
| 286 | 3300046539 | Ga0495621_0067402 | Ga0495621_0067402_135_455 | 106 |
| 287 | 3300046663 | Ga0495635_1000095 | Ga0495635_1000095_66_386 | 106 |
| 288 | 3300046680 | Ga0495646_0608555 | Ga0495646_0608555_34_354 | 106 |
| 289 | 3300046683 | Ga0495658_0191631 | Ga0495658_0191631_657_995 | 106 |
| 290 | 3300049575 | Ga0501039_0547834 | Ga0501039_0547834_329_649 | 106 |
| 291 | 3300049578 | Ga0501042_1354590 | Ga0501042_1354590_167_487 | 106 |
| 292 | 3300049661 | Ga0501217_067366 | Ga0501217_067366_25_345 | 106 |
| 293 | 3300049679 | Ga0501249_092341 | Ga0501249_092341_156_476 | 106 |
| 294 | 3300049690 | Ga0501261_062421 | Ga0501261_062421_47_367 | 106 |
| 295 | 3300049766 | Ga0501269_018763 | Ga0501269_018763_375_695 | 106 |
| 296 | 3300050493 | nmdc:mga0k408_165272_c1 | nmdc:mga0k408_165272_c1_636_956 | 106 |
| 297 | 3300050493 | nmdc:mga0k408_281452_c1 | nmdc:mga0k408_281452_c1_137_457 | 106 |
| 298 | 3300050496 | nmdc:mga07m45_323760_c1 | nmdc:mga07m45_323760_c1_493_813 | 106 |
| 299 | 3300050508 | nmdc:mga09592_455373_c1 | nmdc:mga09592_455373_c1_345_665 | 106 |
| 300 | 3300050511 | nmdc:mga08y16_295931_c1 | nmdc:mga08y16_295931_c1_233_553 | 106 |
| 301 | 3300050512 | nmdc:mga0n895_1538283_c1 | nmdc:mga0n895_1538283_c1_80_400 | 106 |
| 302 | 3300050513 | nmdc:mga0rr50_573347_c1 | nmdc:mga0rr50_573347_c1_122_442 | 106 |
| 303 | 3300050514 | nmdc:mga08x19_1030383_c1 | nmdc:mga08x19_1030383_c1_245_565 | 106 |
| 304 | 3300061719 | Ga0466962_0070638 | Ga0466962_0070638_478_798 | 106 |
| 305 | 3300005328 | Ga0070676_10498886 | Ga0070676_104988861 | 107 |
| 306 | 3300005329 | Ga0070683_101077456 | Ga0070683_1010774562 | 107 |
| 307 | 3300005330 | Ga0070690_101342169 | Ga0070690_1013421691 | 107 |
| 308 | 3300005331 | Ga0070670_101993366 | Ga0070670_1019933661 | 107 |
| 309 | 3300005334 | Ga0068869_100261777 | Ga0068869_1002617772 | 107 |
| 310 | 3300005338 | Ga0068868_100025276 | Ga0068868_1000252762 | 107 |
| 311 | 3300005340 | Ga0070689_100721829 | Ga0070689_1007218292 | 107 |
| 312 | 3300005354 | Ga0070675_100037600 | Ga0070675_1000376003 | 107 |
| 313 | 3300005354 | Ga0070675_100722622 | Ga0070675_1007226222 | 107 |
| 314 | 3300005355 | Ga0070671_100559463 | Ga0070671_1005594632 | 107 |
| 315 | 3300005356 | Ga0070674_100260273 | Ga0070674_1002602733 | 107 |
| 316 | 3300005365 | Ga0070688_100069533 | Ga0070688_1000695332 | 107 |
| 317 | 3300005437 | Ga0070710_11102760 | Ga0070710_111027602 | 107 |
| 318 | 3300005440 | Ga0070705_100143439 | Ga0070705_1001434392 | 107 |
| 319 | 3300005440 | Ga0070705_101164941 | Ga0070705_1011649412 | 107 |
| 320 | 3300005459 | Ga0068867_102276773 | Ga0068867_1022767731 | 107 |
| 321 | 3300005466 | Ga0070685_10041658 | Ga0070685_100416583 | 107 |
| 322 | 3300005467 | Ga0070706_102049065 | Ga0070706_1020490651 | 107 |
| 323 | 3300005471 | Ga0070698_100131883 | Ga0070698_1001318833 | 107 |
| 324 | 3300005518 | Ga0070699_100052995 | Ga0070699_1000529954 | 107 |
| 325 | 3300005518 | Ga0070699_101038095 | Ga0070699_1010380951 | 107 |
| 326 | 3300005535 | Ga0070684_100474389 | Ga0070684_1004743892 | 107 |
| 327 | 3300005536 | Ga0070697_100358949 | Ga0070697_1003589492 | 107 |
| 328 | 3300005536 | Ga0070697_101846306 | Ga0070697_1018463061 | 107 |
| 329 | 3300005543 | Ga0070672_100051228 | Ga0070672_1000512281 | 107 |
| 330 | 3300005546 | Ga0070696_100043500 | Ga0070696_1000435005 | 107 |
| 331 | 3300005549 | Ga0070704_100190839 | Ga0070704_1001908393 | 107 |
| 332 | 3300005577 | Ga0068857_100013438 | Ga0068857_1000134388 | 107 |
| 333 | 3300005578 | Ga0068854_100590415 | Ga0068854_1005904152 | 107 |
| 334 | 3300005616 | Ga0068852_100000254 | Ga0068852_10000025434 | 107 |
| 335 | 3300005834 | Ga0068851_10002016 | Ga0068851_100020163 | 107 |
| 336 | 3300005840 | Ga0068870_10417926 | Ga0068870_104179262 | 107 |
| 337 | 3300005842 | Ga0068858_100311795 | Ga0068858_1003117951 | 107 |
| 338 | 3300005842 | Ga0068858_101766355 | Ga0068858_1017663552 | 107 |
| 339 | 3300006058 | Ga0075432_10377136 | Ga0075432_103771362 | 107 |
| 340 | 3300006237 | Ga0097621_100012830 | Ga0097621_1000128304 | 107 |
| 341 | 3300006358 | Ga0068871_100041820 | Ga0068871_1000418204 | 107 |
| 342 | 3300006852 | Ga0075433_11580461 | Ga0075433_115804612 | 107 |
| 343 | 3300006871 | Ga0075434_100059321 | Ga0075434_1000593213 | 107 |
| 344 | 3300006914 | Ga0075436_100002584 | Ga0075436_1000025843 | 107 |
| 345 | 3300007076 | Ga0075435_100194025 | Ga0075435_1001940253 | 107 |
| 346 | 3300009093 | Ga0105240_10035335 | Ga0105240_100353357 | 107 |
| 347 | 3300009148 | Ga0105243_10365631 | Ga0105243_103656312 | 107 |
| 348 | 3300009176 | Ga0105242_10004748 | Ga0105242_100047489 | 107 |
| 349 | 3300009177 | Ga0105248_10045282 | Ga0105248_100452822 | 107 |
| 350 | 3300009545 | Ga0105237_11696419 | Ga0105237_116964191 | 107 |
| 351 | 3300009551 | Ga0105238_10655444 | Ga0105238_106554442 | 107 |
| 352 | 3300009553 | Ga0105249_11154889 | Ga0105249_111548891 | 107 |
| 353 | 3300013105 | Ga0157369_11800162 | Ga0157369_118001622 | 107 |
| 354 | 3300013306 | Ga0163162_10135416 | Ga0163162_101354162 | 107 |
| 355 | 3300013308 | Ga0157375_10139435 | Ga0157375_101394354 | 107 |
| 356 | 3300014745 | Ga0157377_10164309 | Ga0157377_101643092 | 107 |
| 357 | 3300014968 | Ga0157379_10027667 | Ga0157379_100276671 | 107 |
| 358 | 3300017792 | Ga0163161_10389773 | Ga0163161_103897733 | 107 |
| 359 | 3300021384 | Ga0213876_10044224 | Ga0213876_100442242 | 107 |
| 360 | 3300025315 | Ga0207697_10111586 | Ga0207697_101115862 | 107 |
| 361 | 3300025321 | Ga0207656_10001529 | Ga0207656_100015297 | 107 |
| 362 | 3300025901 | Ga0207688_10060868 | Ga0207688_100608683 | 107 |
| 363 | 3300025908 | Ga0207643_10099266 | Ga0207643_100992663 | 107 |
| 364 | 3300025909 | Ga0207705_10945429 | Ga0207705_109454291 | 107 |
| 365 | 3300025913 | Ga0207695_10026267 | Ga0207695_100262676 | 107 |
| 366 | 3300025923 | Ga0207681_10592723 | Ga0207681_105927232 | 107 |
| 367 | 3300025924 | Ga0207694_10345323 | Ga0207694_103453232 | 107 |
| 368 | 3300025926 | Ga0207659_10223281 | Ga0207659_102232812 | 107 |
| 369 | 3300025927 | Ga0207687_10141398 | Ga0207687_101413982 | 107 |
| 370 | 3300025934 | Ga0207686_10004988 | Ga0207686_100049886 | 107 |
| 371 | 3300025935 | Ga0207709_10144368 | Ga0207709_101443682 | 107 |
| 372 | 3300025936 | Ga0207670_10014182 | Ga0207670_100141822 | 107 |
| 373 | 3300025937 | Ga0207669_10087677 | Ga0207669_100876772 | 107 |
| 374 | 3300025940 | Ga0207691_10018917 | Ga0207691_100189172 | 107 |
| 375 | 3300025944 | Ga0207661_10907760 | Ga0207661_109077602 | 107 |
| 376 | 3300025981 | Ga0207640_11504722 | Ga0207640_115047222 | 107 |
| 377 | 3300026023 | Ga0207677_10025133 | Ga0207677_100251334 | 107 |
| 378 | 3300026035 | Ga0207703_10020762 | Ga0207703_100207622 | 107 |
| 379 | 3300026075 | Ga0207708_11089683 | Ga0207708_110896832 | 107 |
| 380 | 3300026089 | Ga0207648_10085800 | Ga0207648_100858002 | 107 |
| 381 | 3300026116 | Ga0207674_10005717 | Ga0207674_1000571717 | 107 |
| 382 | 3300026118 | Ga0207675_100479836 | Ga0207675_1004798363 | 107 |
| 383 | 3300026121 | Ga0207683_10380383 | Ga0207683_103803832 | 107 |
| 384 | 3300026142 | Ga0207698_10005304 | Ga0207698_100053042 | 107 |
| 385 | 3300027876 | Ga0209974_10251462 | Ga0209974_102514622 | 107 |
| 386 | 3300031247 | Ga0265340_10170561 | Ga0265340_101705612 | 107 |
| 387 | 3300031250 | Ga0265331_10192213 | Ga0265331_101922132 | 107 |
| 388 | 3300031911 | Ga0307412_11416722 | Ga0307412_114167222 | 107 |
| 389 | 3300032002 | Ga0307416_100645272 | Ga0307416_1006452722 | 107 |
| 390 | 3300032002 | Ga0307416_101479350 | Ga0307416_1014793502 | 107 |
| 391 | 3300035089 | Ga0373944_0354465 | Ga0373944_0354465_149_472 | 107 |
| 392 | 3300035691 | Ga0373931_0065454 | Ga0373931_0065454_1502_1825 | 107 |
| 393 | 3300035692 | Ga0373935_0048668 | Ga0373935_0048668_1467_1790 | 107 |
| 394 | 3300035695 | Ga0373927_0286701 | Ga0373927_0286701_19_342 | 107 |
| 395 | 3300036401 | Ga0373937_0049030 | Ga0373937_0049030_2064_2387 | 107 |
| 396 | 3300037068 | Ga0373925_0515651 | Ga0373925_0515651_400_723 | 107 |
| 397 | 3300039437 | Ga0436365_1596890 | Ga0436365_1596890_3179_3502 | 107 |
| 398 | 3300041459 | Ga0451800_1189066 | Ga0451800_1189066_80_403 | 107 |
| 399 | 3300042125 | Ga0450923_036574 | Ga0450923_036574_631_954 | 107 |
| 400 | 3300044673 | Ga0453683_0253939 | Ga0453683_0253939_467_790 | 107 |
| 401 | 3300044694 | Ga0466963_0944117 | Ga0466963_0944117_50_373 | 107 |
| 402 | 3300045051 | Ga0451576_0452060 | Ga0451576_0452060_370_693 | 107 |
| 403 | 3300046539 | Ga0495621_0008698 | Ga0495621_0008698_1122_1445 | 107 |
| 404 | 3300046539 | Ga0495621_0041524 | Ga0495621_0041524_179_502 | 107 |
| 405 | 3300048907 | Ga0496104_0029274 | Ga0496104_0029274_1084_1407 | 107 |
| 406 | 3300048912 | Ga0496109_0103498 | Ga0496109_0103498_2106_2429 | 107 |
| 407 | 3300048913 | Ga0496110_0019539 | Ga0496110_0019539_2484_2807 | 107 |
| 408 | 3300048914 | Ga0496111_0582813 | Ga0496111_0582813_215_538 | 107 |
| 409 | 3300049650 | Ga0501199_067193 | Ga0501199_067193_152_475 | 107 |
| 410 | 3300050507 | nmdc:mga05p37_496227_c1 | nmdc:mga05p37_496227_c1_391_714 | 107 |
| 411 | 3300050512 | nmdc:mga0n895_317164_c1 | nmdc:mga0n895_317164_c1_1235_1558 | 107 |
| 412 | 3300050513 | nmdc:mga0rr50_179914_c1 | nmdc:mga0rr50_179914_c1_860_1183 | 107 |
| 413 | 3300050513 | nmdc:mga0rr50_375493_c1 | nmdc:mga0rr50_375493_c1_553_876 | 107 |
| 414 | 3300050513 | nmdc:mga0rr50_955338_c1 | nmdc:mga0rr50_955338_c1_356_679 | 107 |
| 415 | 3300050514 | nmdc:mga08x19_3628_c1 | nmdc:mga08x19_3628_c1_3225_3548 | 107 |
| 416 | 3300005345 | Ga0070692_10797424 | Ga0070692_107974242 | 108 |
| 417 | 3300005356 | Ga0070674_100378668 | Ga0070674_1003786682 | 108 |
| 418 | 3300005356 | Ga0070674_100409536 | Ga0070674_1004095362 | 108 |
| 419 | 3300005444 | Ga0070694_101893563 | Ga0070694_1018935631 | 108 |
| 420 | 3300005458 | Ga0070681_10854633 | Ga0070681_108546332 | 108 |
| 421 | 3300005459 | Ga0068867_101567209 | Ga0068867_1015672091 | 108 |
| 422 | 3300005544 | Ga0070686_100687275 | Ga0070686_1006872752 | 108 |
| 423 | 3300005545 | Ga0070695_101719974 | Ga0070695_1017199741 | 108 |
| 424 | 3300005548 | Ga0070665_100313519 | Ga0070665_1003135193 | 108 |
| 425 | 3300005548 | Ga0070665_101697586 | Ga0070665_1016975861 | 108 |
| 426 | 3300005615 | Ga0070702_100105946 | Ga0070702_1001059462 | 108 |
| 427 | 3300005719 | Ga0068861_101684743 | Ga0068861_1016847432 | 108 |
| 428 | 3300006038 | Ga0075365_10955660 | Ga0075365_109556602 | 108 |
| 429 | 3300006048 | Ga0075363_100956590 | Ga0075363_1009565901 | 108 |
| 430 | 3300006051 | Ga0075364_10048752 | Ga0075364_100487523 | 108 |
| 431 | 3300006058 | Ga0075432_10082442 | Ga0075432_100824422 | 108 |
| 432 | 3300006177 | Ga0075362_10451335 | Ga0075362_104513352 | 108 |
| 433 | 3300006178 | Ga0075367_10796467 | Ga0075367_107964671 | 108 |
| 434 | 3300006186 | Ga0075369_10071963 | Ga0075369_100719632 | 108 |
| 435 | 3300006195 | Ga0075366_10019840 | Ga0075366_100198402 | 108 |
| 436 | 3300006195 | Ga0075366_10430853 | Ga0075366_104308532 | 108 |
| 437 | 3300006237 | Ga0097621_100902496 | Ga0097621_1009024961 | 108 |
| 438 | 3300006852 | Ga0075433_10218148 | Ga0075433_102181483 | 108 |
| 439 | 3300009098 | Ga0105245_10421741 | Ga0105245_104217411 | 108 |
| 440 | 3300009148 | Ga0105243_10452292 | Ga0105243_104522922 | 108 |
| 441 | 3300009148 | Ga0105243_11195692 | Ga0105243_111956922 | 108 |
| 442 | 3300009148 | Ga0105243_11300737 | Ga0105243_113007372 | 108 |
| 443 | 3300009176 | Ga0105242_13269424 | Ga0105242_132694242 | 108 |
| 444 | 3300009177 | Ga0105248_11303228 | Ga0105248_113032282 | 108 |
| 445 | 3300009551 | Ga0105238_10313222 | Ga0105238_103132222 | 108 |
| 446 | 3300009553 | Ga0105249_10467964 | Ga0105249_104679641 | 108 |
| 447 | 3300010375 | Ga0105239_12619759 | Ga0105239_126197592 | 108 |
| 448 | 3300013306 | Ga0163162_10065955 | Ga0163162_100659552 | 108 |
| 449 | 3300014326 | Ga0157380_10017395 | Ga0157380_100173956 | 108 |
| 450 | 3300014326 | Ga0157380_10341719 | Ga0157380_103417192 | 108 |
| 451 | 3300014326 | Ga0157380_11989570 | Ga0157380_119895702 | 108 |
| 452 | 3300014969 | Ga0157376_10163539 | Ga0157376_101635392 | 108 |
| 453 | 3300017792 | Ga0163161_10070314 | Ga0163161_100703144 | 108 |
| 454 | 3300025912 | Ga0207707_10697395 | Ga0207707_106973952 | 108 |
| 455 | 3300025918 | Ga0207662_10500627 | Ga0207662_105006272 | 108 |
| 456 | 3300025924 | Ga0207694_10307487 | Ga0207694_103074872 | 108 |
| 457 | 3300025926 | Ga0207659_11244628 | Ga0207659_112446281 | 108 |
| 458 | 3300025934 | Ga0207686_11314680 | Ga0207686_113146802 | 108 |
| 459 | 3300025934 | Ga0207686_11634682 | Ga0207686_116346821 | 108 |
| 460 | 3300025935 | Ga0207709_10266167 | Ga0207709_102661672 | 108 |
| 461 | 3300025935 | Ga0207709_10628029 | Ga0207709_106280292 | 108 |
| 462 | 3300025941 | Ga0207711_11214029 | Ga0207711_112140292 | 108 |
| 463 | 3300025961 | Ga0207712_11449941 | Ga0207712_114499412 | 108 |
| 464 | 3300025981 | Ga0207640_11126020 | Ga0207640_111260202 | 108 |
| 465 | 3300026089 | Ga0207648_10277286 | Ga0207648_102772863 | 108 |
| 466 | 3300026089 | Ga0207648_11282696 | Ga0207648_112826962 | 108 |
| 467 | 3300026118 | Ga0207675_102036041 | Ga0207675_1020360412 | 108 |
| 468 | 3300026142 | Ga0207698_11984628 | Ga0207698_119846282 | 108 |
| 469 | 3300027907 | Ga0207428_10143936 | Ga0207428_101439362 | 108 |
| 470 | 3300028379 | Ga0268266_10125834 | Ga0268266_101258342 | 108 |
| 471 | 3300031238 | Ga0265332_10129594 | Ga0265332_101295942 | 108 |
| 472 | 3300034819 | Ga0373958_0139674 | Ga0373958_0139674_101_430 | 108 |
| 473 | 3300042876 | Ga0451577_0376517 | Ga0451577_0376517_887_1213 | 108 |
| 474 | 3300044712 | Ga0453684_1707413 | Ga0453684_1707413_62_388 | 108 |
| 475 | 3300046794 | Ga0495589_0168476 | Ga0495589_0168476_508_837 | 108 |
| 476 | 3300050490 | nmdc:mga03n38_882147_c1 | nmdc:mga03n38_882147_c1_48_377 | 108 |
| 477 | 3300050491 | nmdc:mga00v17_48221_c1 | nmdc:mga00v17_48221_c1_1536_1865 | 108 |
| 478 | 3300050493 | nmdc:mga0k408_23222_c1 | nmdc:mga0k408_23222_c1_102_431 | 108 |
| 479 | 3300050493 | nmdc:mga0k408_745634_c1 | nmdc:mga0k408_745634_c1_66_395 | 108 |
| 480 | 3300050515 | nmdc:mga0a205_201645_c1 | nmdc:mga0a205_201645_c1_595_921 | 108 |
| 481 | 3300050516 | nmdc:mga0sz30_89787_c1 | nmdc:mga0sz30_89787_c1_372_701 | 108 |
| 482 | 3300053096 | Ga0500641_0323433 | Ga0500641_0323433_76_405 | 108 |
| 483 | 3300014745 | Ga0157377_10277736 | Ga0157377_102777361 | 110 |
| 484 | 3300005338 | Ga0068868_101837936 | Ga0068868_1018379362 | 112 |
| 485 | 3300005366 | Ga0070659_100433286 | Ga0070659_1004332861 | 112 |
| 486 | 3300005564 | Ga0070664_100112044 | Ga0070664_1001120441 | 112 |
| 487 | 3300005577 | Ga0068857_100505164 | Ga0068857_1005051642 | 112 |
| 488 | 3300005614 | Ga0068856_100142967 | Ga0068856_1001429673 | 112 |
| 489 | 3300005834 | Ga0068851_10443678 | Ga0068851_104436781 | 112 |
| 490 | 3300025321 | Ga0207656_10236800 | Ga0207656_102368002 | 112 |
| 491 | 3300025928 | Ga0207700_11126224 | Ga0207700_111262242 | 112 |
| 492 | 3300025932 | Ga0207690_10475548 | Ga0207690_104755481 | 112 |
| 493 | 3300025945 | Ga0207679_10260394 | Ga0207679_102603941 | 112 |
| 494 | 3300026078 | Ga0207702_10190514 | Ga0207702_101905142 | 112 |
| 495 | 3300005458 | Ga0070681_11459983 | Ga0070681_114599831 | 114 |
| 496 | 3300005530 | Ga0070679_100750450 | Ga0070679_1007504502 | 114 |
| 497 | 3300005616 | Ga0068852_101109983 | Ga0068852_1011099831 | 114 |
| 498 | 3300006177 | Ga0075362_10362239 | Ga0075362_103622392 | 114 |
| 499 | 3300025921 | Ga0207652_10784452 | Ga0207652_107844522 | 114 |
| 500 | 3300026088 | Ga0207641_10383355 | Ga0207641_103833551 | 114 |
| 501 | 3300031507 | Ga0307509_10459264 | Ga0307509_104592642 | 114 |
| 502 | 3300050489 | nmdc:mga03683_117006_c1 | nmdc:mga03683_117006_c1_655_1005 | 114 |
| 503 | 3300005327 | Ga0070658_10004064 | Ga0070658_100040644 | 115 |
| 504 | 3300005336 | Ga0070680_100017626 | Ga0070680_1000176261 | 115 |
| 505 | 3300005337 | Ga0070682_100040696 | Ga0070682_1000406964 | 115 |
| 506 | 3300005344 | Ga0070661_100036646 | Ga0070661_1000366464 | 115 |
| 507 | 3300005577 | Ga0068857_100025753 | Ga0068857_1000257533 | 115 |
| 508 | 3300005578 | Ga0068854_100006930 | Ga0068854_1000069306 | 115 |
| 509 | 3300005616 | Ga0068852_100052417 | Ga0068852_1000524174 | 115 |
| 510 | 3300009174 | Ga0105241_10011678 | Ga0105241_100116788 | 115 |
| 511 | 3300009545 | Ga0105237_10229657 | Ga0105237_102296572 | 115 |
| 512 | 3300009551 | Ga0105238_10003397 | Ga0105238_1000339715 | 115 |
| 513 | 3300013102 | Ga0157371_10023455 | Ga0157371_100234555 | 115 |
| 514 | 3300013105 | Ga0157369_10370990 | Ga0157369_103709902 | 115 |
| 515 | 3300013307 | Ga0157372_10098767 | Ga0157372_100987672 | 115 |
| 516 | 3300014497 | Ga0182008_10047237 | Ga0182008_100472372 | 115 |
| 517 | 3300020069 | Ga0197907_10049381 | Ga0197907_100493813 | 115 |
| 518 | 3300020070 | Ga0206356_10632517 | Ga0206356_106325171 | 115 |
| 519 | 3300020078 | Ga0206352_10660858 | Ga0206352_106608582 | 115 |
| 520 | 3300020082 | Ga0206353_10160707 | Ga0206353_101607072 | 115 |
| 521 | 3300022467 | Ga0224712_10089071 | Ga0224712_100890712 | 115 |
| 522 | 3300025909 | Ga0207705_10039760 | Ga0207705_100397604 | 115 |
| 523 | 3300025911 | Ga0207654_10005423 | Ga0207654_100054232 | 115 |
| 524 | 3300025912 | Ga0207707_10004510 | Ga0207707_100045106 | 115 |
| 525 | 3300025917 | Ga0207660_10004556 | Ga0207660_1000455612 | 115 |
| 526 | 3300025920 | Ga0207649_10005246 | Ga0207649_100052464 | 115 |
| 527 | 3300025949 | Ga0207667_10002090 | Ga0207667_1000209017 | 115 |
| 528 | 3300025981 | Ga0207640_10066307 | Ga0207640_100663073 | 115 |
| 529 | 3300037466 | Ga0395898_0130221 | Ga0395898_0130221_1612_1959 | 115 |
| 530 | 3300038443 | Ga0395901_0412004 | Ga0395901_0412004_456_803 | 115 |
| 531 | 3300044658 | Ga0466972_0211306 | Ga0466972_0211306_440_796 | 115 |
| 532 | 3300044842 | Ga0466957_0718109 | Ga0466957_0718109_157_513 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hei-assembly1.cif.gz_A | 2a x-ray structure of hpf from vibrio cholerae | 0.9676 | 1 | 91 |
| 5zep-assembly1.cif.gz_x | m. smegmatis hibernating state 70s ribosome structure | 0.9521 | 1 | 89 |
| 6h4n-assembly1.cif.gz_x | structure of a hibernating 100s ribosome reveals an inactive conformation of the ribosomal protein s1 - 70s hibernating e. coli ribosome | 0.9513 | 1 | 95 |
| 4hei-assembly1.cif.gz_A | 2a x-ray structure of hpf from vibrio cholerae | 0.9474 | 1 | 91 |
| 4v8h-assembly2.cif.gz_CX | crystal structure of hpf bound to the 70s ribosome. | 0.947 | 1 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KB15_71_175_3.30.160.100 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9571 | 2 | 95 | 3.30.160.100 |
| af_O05886_21_120_3.30.160.100 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9462 | 4 | 93 | 3.30.160.100 |
| 3v26X00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9436 | 1 | 95 | 3.30.160.100 |
| 3v26X00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9342 | 1 | 95 | 3.30.160.100 |
| 3tqmD00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9247 | 2 | 90 | 3.30.160.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A368WJ10-F1-model_v4 | deleted | 0.991 | 1 | 96 |
|
| AF-A0A6I8MAB8-F1-model_v4 | Sigma 54 modulation protein/30S ribosomal protein S30EA | 0.987 | 1 | 90 |
GO:0022627
GO:0043024 GO:0045900 |
| AF-X1KU52-F1-model_v4 | Sigma 54 modulation/S30EA ribosomal protein C-terminal domain-containing protein | 0.9856 | 1 | 91 |
GO:0022627
GO:0043024 GO:0045900 |
| AF-W7QDR6-F1-model_v4 | Ribosome hibernation promoting factor (Hibernation factor HPF) | 0.9854 | 1 | 67 |
GO:0022627
GO:0043024 GO:0045900 |
| AF-A0A2E6KPT6-F1-model_v4 | Ribosome hibernation promoting factor (Hibernation factor HPF) | 0.9847 | 1 | 95 |
GO:0022627
GO:0043024 GO:0045900 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar