F460190

General Info

Members Datasets Scaffolds Average Seq Length
531 259 1062 248

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0154904|Ga0501034_0154904_688_1515
Length 275
Sequence VRGRRQAGAVSTSPALQITKSPTAGITMRLKLKIWRQAGPDSAGRLVDYVADDVSPDMSFLEMLDVVNENLLRKGEEAIAFDSDCREGICGMCSLVVNGIPHGPDRGTTVCQLHMRRFKDGDTITIEPWRARAFPVVKDLVVDRSAFDRIVAAGGYVSINCGGAPDGNAIPIPKEIAELAMDSAQCIACGACVAACKNASAHLFMGAKISQLSLLPQGQVERHRRVLSMIEQADAEGFGSCSNEAECEAVCPKEIPISNIARMTREYVKAILAAK

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
186 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
187 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.08
Rhizosphere 94.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0154904 3300049571 Bacteria 2266
2 JGI24751J29686_10011144 3300002459 Bacteria 1854
3 Ga0065715_10098936 3300005293 Bacteria 3473
4 Ga0065715_10345576 3300005293 Bacteria 960
5 Ga0070658_10023619 3300005327 Bacteria 4933
6 Ga0070676_10006255 3300005328 Bacteria 6360
7 Ga0070676_10064781 3300005328 Bacteria 2180
8 Ga0070676_10136513 3300005328 Bacteria 1556
9 Ga0070690_100052481 3300005330 Bacteria 2606
10 Ga0070670_100112669 3300005331 Bacteria 2345
11 Ga0070670_100136809 3300005331 Bacteria 2117
12 Ga0070677_10062896 3300005333 Bacteria 1537
13 Ga0068869_100482244 3300005334 Bacteria 1033
14 Ga0070666_10036007 3300005335 Bacteria 3282
15 Ga0070666_10200820 3300005335 Bacteria 1403
16 Ga0070680_100189108 3300005336 Bacteria 1735
17 Ga0068868_100036623 3300005338 Bacteria 3800
18 Ga0068868_100777555 3300005338 Bacteria 862
19 Ga0070689_100142097 3300005340 Bacteria 1931
20 Ga0070689_100246615 3300005340 Bacteria 1473
21 Ga0070691_10001817 3300005341 Bacteria 9302
22 Ga0070692_10054100 3300005345 Bacteria 2095
23 Ga0070692_10288215 3300005345 Bacteria 998
24 Ga0070668_100091013 3300005347 Bacteria 2404
25 Ga0070669_100020427 3300005353 Bacteria 4730
26 Ga0070669_100158574 3300005353 Bacteria 1756
27 Ga0070669_100192244 3300005353 Bacteria 1601
28 Ga0070675_100000055 3300005354 Bacteria 68147
29 Ga0070675_100194031 3300005354 Bacteria 1761
30 Ga0070675_100807327 3300005354 Bacteria 858
31 Ga0070671_100104194 3300005355 Bacteria 2381
32 Ga0070671_100220534 3300005355 Bacteria 1609
33 Ga0070671_100263844 3300005355 Bacteria 1464
34 Ga0070671_100519871 3300005355 Bacteria 1025
35 Ga0070674_100008789 3300005356 Bacteria 6027
36 Ga0070674_100013152 3300005356 Bacteria 5106
37 Ga0070674_100236649 3300005356 Bacteria 1427
38 Ga0070674_100429616 3300005356 Bacteria 1086
39 Ga0070673_100138876 3300005364 Bacteria 2048
40 Ga0070673_100198822 3300005364 Bacteria 1726
41 Ga0070688_100080837 3300005365 Bacteria 2103
42 Ga0070659_100153437 3300005366 Bacteria 1880
43 Ga0070709_10065043 3300005434 Bacteria 2334
44 Ga0070714_100010088 3300005435 Bacteria 7453
45 Ga0070713_100138788 3300005436 Bacteria 2151
46 Ga0070701_10018366 3300005438 Bacteria 3285
47 Ga0070711_100449097 3300005439 Bacteria 1055
48 Ga0070705_100006979 3300005440 Bacteria 5554
49 Ga0070705_100111121 3300005440 Bacteria 1751
50 Ga0070705_100477987 3300005440 Bacteria 941
51 Ga0070700_100008749 3300005441 Bacteria 5525
52 Ga0070700_100114318 3300005441 Bacteria 1799
53 Ga0070694_100013957 3300005444 Bacteria 5023
54 Ga0070694_100206932 3300005444 Bacteria 1465
55 Ga0070708_100101940 3300005445 Bacteria 2629
56 Ga0070662_100184250 3300005457 Bacteria 1648
57 Ga0070681_10004061 3300005458 Bacteria 13821
58 Ga0070681_10075207 3300005458 Bacteria 3337
59 Ga0070681_10246622 3300005458 Bacteria 1699
60 Ga0070681_10284906 3300005458 Bacteria 1563
61 Ga0068867_100013036 3300005459 Bacteria 5883
62 Ga0068867_100487205 3300005459 Bacteria 1058
63 Ga0070706_100440109 3300005467 Bacteria 1213
64 Ga0070707_100208133 3300005468 Bacteria 1907
65 Ga0070698_100114994 3300005471 Bacteria 2655
66 Ga0070698_100575881 3300005471 Bacteria 1066
67 Ga0070699_100297815 3300005518 Bacteria 1447
68 Ga0070699_100306118 3300005518 Bacteria 1426
69 Ga0070699_100507559 3300005518 Bacteria 1096
70 Ga0070679_100032819 3300005530 Bacteria 5139
71 Ga0070679_100154007 3300005530 Bacteria 2274
72 Ga0070672_100174961 3300005543 Bacteria 1787
73 Ga0070686_100000926 3300005544 Bacteria 16872
74 Ga0070686_100025575 3300005544 Bacteria 3553
75 Ga0070695_100039144 3300005545 Bacteria 2995
76 Ga0070696_100009094 3300005546 Bacteria 6654
77 Ga0070696_100136601 3300005546 Bacteria 1788
78 Ga0070665_100007145 3300005548 Bacteria 11355
79 Ga0070665_100030260 3300005548 Bacteria 5449
80 Ga0070665_100426596 3300005548 Bacteria 1335
81 Ga0070704_100036172 3300005549 Bacteria 3362
82 Ga0068855_100329568 3300005563 Bacteria 1685
83 Ga0068854_100011885 3300005578 Bacteria 5687
84 Ga0068854_100036116 3300005578 Bacteria 3463
85 Ga0068854_100097722 3300005578 Bacteria 2196
86 Ga0068856_100104691 3300005614 Bacteria 2824
87 Ga0070702_100008320 3300005615 Bacteria 5017
88 Ga0070702_100287894 3300005615 Bacteria 1131
89 Ga0068852_100405379 3300005616 Bacteria 1342
90 Ga0068859_100042652 3300005617 Bacteria 4558
91 Ga0068859_100124386 3300005617 Bacteria 2647
92 Ga0068864_100022967 3300005618 Bacteria 5234
93 Ga0068864_100093617 3300005618 Bacteria 2654
94 Ga0068864_100268653 3300005618 Bacteria 1589
95 Ga0068866_10039630 3300005718 Bacteria 2327
96 Ga0068866_10309947 3300005718 Bacteria 989
97 Ga0068851_10127531 3300005834 Bacteria 1373
98 Ga0068863_100256964 3300005841 Bacteria 1688
99 Ga0068858_100000761 3300005842 Bacteria 33790
100 Ga0068858_100012172 3300005842 Bacteria 8110
101 Ga0068858_100093738 3300005842 Bacteria 2796
102 Ga0068860_100526005 3300005843 Bacteria 1183
103 Ga0068862_100011518 3300005844 Bacteria 7299
104 Ga0068862_100013148 3300005844 Bacteria 6846
105 Ga0068862_100064039 3300005844 Bacteria 3164
106 Ga0068862_100559551 3300005844 Bacteria 1093
107 Ga0081539_10006667 3300005985 Bacteria 10929
108 Ga0070716_100163231 3300006173 Bacteria 1446
109 Ga0070716_100278807 3300006173 Bacteria 1153
110 Ga0097621_100019394 3300006237 Bacteria 5218
111 Ga0097621_100113756 3300006237 Bacteria 2289
112 Ga0097621_100329518 3300006237 Bacteria 1354
113 Ga0068871_100002863 3300006358 Bacteria 11821
114 Ga0068871_100014197 3300006358 Bacteria 5930
115 Ga0068871_100028927 3300006358 Bacteria 4349
116 Ga0068871_100050250 3300006358 Bacteria 3373
117 Ga0068871_100542807 3300006358 Bacteria 1052
118 Ga0075428_100023790 3300006844 Bacteria 6778
119 Ga0075431_100096671 3300006847 Bacteria 3049
120 Ga0075431_100587193 3300006847 Bacteria 1099
121 Ga0075433_10083754 3300006852 Bacteria 2815
122 Ga0075433_10414204 3300006852 Bacteria 1188
123 Ga0075434_100007565 3300006871 Bacteria 10065
124 Ga0075434_100032315 3300006871 Bacteria 5161
125 Ga0075434_100042544 3300006871 Bacteria 4503
126 Ga0075434_100219087 3300006871 Bacteria 1923
127 Ga0075434_100898293 3300006871 Bacteria 901
128 Ga0075429_100285639 3300006880 Bacteria 1445
129 Ga0068865_100009647 3300006881 Bacteria 5987
130 Ga0068865_100049245 3300006881 Bacteria 2903
131 Ga0075436_100003532 3300006914 Bacteria 10721
132 Ga0075436_100014961 3300006914 Bacteria 5318
133 Ga0075436_100031703 3300006914 Bacteria 3641
134 Ga0075436_100057261 3300006914 Bacteria 2692
135 Ga0075436_100058897 3300006914 Bacteria 2653
136 Ga0097620_100042652 3300006931 Bacteria 4558
137 Ga0097620_100124390 3300006931 Bacteria 2647
138 Ga0075435_100000894 3300007076 Bacteria 18764
139 Ga0075435_100003390 3300007076 Bacteria 10807
140 Ga0075435_100007416 3300007076 Bacteria 7810
141 Ga0075435_100050091 3300007076 Bacteria 3360
142 Ga0075435_100060506 3300007076 Bacteria 3071
143 Ga0075435_100255007 3300007076 Bacteria 1494
144 Ga0075435_100318581 3300007076 Bacteria 1331
145 Ga0075435_100377511 3300007076 Bacteria 1217
146 Ga0105240_10060998 3300009093 Bacteria 4701
147 Ga0105240_10298819 3300009093 Bacteria 1842
148 Ga0105240_10463638 3300009093 Bacteria 1415
149 Ga0111539_10001440 3300009094 Bacteria 31737
150 Ga0111539_10004657 3300009094 Bacteria 17928
151 Ga0111539_10478565 3300009094 Bacteria 1450
152 Ga0111539_11057715 3300009094 Bacteria 943
153 Ga0105245_10035367 3300009098 Bacteria 4433
154 Ga0105245_10251108 3300009098 Bacteria 1718
155 Ga0105245_10269686 3300009098 Bacteria 1659
156 Ga0105245_10337853 3300009098 Bacteria 1488
157 Ga0105245_10375620 3300009098 Bacteria 1414
158 Ga0105245_10901617 3300009098 Bacteria 926
159 Ga0105247_10033321 3300009101 Bacteria 3133
160 Ga0114129_10005698 3300009147 Bacteria 17647
161 Ga0114129_10017539 3300009147 Bacteria 10193
162 Ga0114129_10018144 3300009147 Bacteria 10021
163 Ga0114129_10021621 3300009147 Bacteria 9131
164 Ga0114129_10080039 3300009147 Bacteria 4542
165 Ga0114129_10120934 3300009147 Bacteria 3604
166 Ga0114129_10380370 3300009147 Bacteria 1864
167 Ga0114129_10504499 3300009147 Bacteria 1580
168 Ga0114129_10521936 3300009147 Bacteria 1548
169 Ga0114129_10539314 3300009147 Bacteria 1519
170 Ga0114129_11184628 3300009147 Bacteria 952
171 Ga0105243_10014932 3300009148 Bacteria 5878
172 Ga0105243_10116206 3300009148 Bacteria 2247
173 Ga0105243_10141369 3300009148 Bacteria 2054
174 Ga0105243_10464179 3300009148 Bacteria 1191
175 Ga0105242_10016938 3300009176 Bacteria 5671
176 Ga0105242_10035935 3300009176 Bacteria 3973
177 Ga0105242_10056184 3300009176 Bacteria 3221
178 Ga0105242_10278006 3300009176 Bacteria 1519
179 Ga0105248_10010609 3300009177 Bacteria 10155
180 Ga0105248_10086656 3300009177 Bacteria 3523
181 Ga0105248_10144074 3300009177 Bacteria 2688
182 Ga0105248_10173430 3300009177 Bacteria 2431
183 Ga0105248_10225992 3300009177 Bacteria 2107
184 Ga0105248_10471220 3300009177 Bacteria 1416
185 Ga0105238_10055683 3300009551 Bacteria 3969
186 Ga0105238_10122850 3300009551 Bacteria 2576
187 Ga0105249_10480091 3300009553 Bacteria 1286
188 Ga0105249_10620165 3300009553 Bacteria 1137
189 Ga0157374_10174597 3300013296 Bacteria 2097
190 Ga0163162_10054054 3300013306 Bacteria 4038
191 Ga0163162_10995752 3300013306 Bacteria 947
192 Ga0157375_10121315 3300013308 Bacteria 2724
193 Ga0157375_10238222 3300013308 Bacteria 1979
194 Ga0157375_11129845 3300013308 Bacteria 918
195 Ga0163163_10003074 3300014325 Bacteria 14130
196 Ga0163163_10075540 3300014325 Bacteria 3363
197 Ga0163163_10160984 3300014325 Bacteria 2290
198 Ga0163163_10483625 3300014325 Bacteria 1299
199 Ga0163163_10661061 3300014325 Bacteria 1108
200 Ga0157380_10034411 3300014326 Bacteria 3908
201 Ga0157380_10283421 3300014326 Bacteria 1517
202 Ga0157379_10054969 3300014968 Bacteria 3557
203 Ga0157379_10177399 3300014968 Bacteria 1924
204 Ga0157379_10297347 3300014968 Bacteria 1471
205 Ga0157379_10307349 3300014968 Bacteria 1446
206 Ga0157379_10317828 3300014968 Bacteria 1421
207 Ga0157376_10006652 3300014969 Bacteria 8184
208 Ga0157376_10039331 3300014969 Bacteria 3856
209 Ga0157376_10192833 3300014969 Bacteria 1869
210 Ga0157376_10219183 3300014969 Bacteria 1761
211 Ga0157376_10473175 3300014969 Bacteria 1226
212 Ga0163161_10320298 3300017792 Bacteria 1226
213 Ga0207666_1006632 3300025271 Bacteria 1505
214 Ga0207642_10096783 3300025899 Bacteria 1472
215 Ga0207642_10101813 3300025899 Bacteria 1444
216 Ga0207642_10205402 3300025899 Bacteria 1091
217 Ga0207710_10005045 3300025900 Bacteria 5720
218 Ga0207680_10085159 3300025903 Bacteria 1996
219 Ga0207680_10104903 3300025903 Bacteria 1822
220 Ga0207685_10064368 3300025905 Bacteria 1464
221 Ga0207699_10026006 3300025906 Bacteria 3221
222 Ga0207645_10006009 3300025907 Bacteria 8732
223 Ga0207645_10006324 3300025907 Bacteria 8515
224 Ga0207645_10067745 3300025907 Bacteria 2282
225 Ga0207705_10046296 3300025909 Bacteria 3126
226 Ga0207654_10219741 3300025911 Bacteria 1260
227 Ga0207707_10009702 3300025912 Bacteria 8352
228 Ga0207707_10453123 3300025912 Bacteria 1098
229 Ga0207695_10124830 3300025913 Bacteria 2538
230 Ga0207660_10220743 3300025917 Bacteria 1487
231 Ga0207660_10393425 3300025917 Bacteria 1115
232 Ga0207662_10453221 3300025918 Bacteria 877
233 Ga0207657_10062935 3300025919 Bacteria 3174
234 Ga0207657_10409609 3300025919 Bacteria 1066
235 Ga0207649_10315995 3300025920 Bacteria 1146
236 Ga0207652_10026671 3300025921 Bacteria 4814
237 Ga0207652_10044785 3300025921 Bacteria 3771
238 Ga0207646_10144225 3300025922 Bacteria 2146
239 Ga0207646_10212269 3300025922 Bacteria 1748
240 Ga0207681_10035345 3300025923 Bacteria 3292
241 Ga0207681_10059847 3300025923 Bacteria 2612
242 Ga0207681_10072387 3300025923 Bacteria 2407
243 Ga0207694_10028442 3300025924 Bacteria 4261
244 Ga0207650_10130806 3300025925 Bacteria 1964
245 Ga0207650_10148890 3300025925 Bacteria 1846
246 Ga0207650_10237354 3300025925 Bacteria 1472
247 Ga0207659_10016524 3300025926 Bacteria 4804
248 Ga0207659_10033686 3300025926 Bacteria 3529
249 Ga0207659_10034662 3300025926 Bacteria 3482
250 Ga0207687_10024346 3300025927 Bacteria 4044
251 Ga0207687_10025557 3300025927 Bacteria 3952
252 Ga0207687_10582484 3300025927 Bacteria 941
253 Ga0207700_10058086 3300025928 Bacteria 2921
254 Ga0207700_10147170 3300025928 Bacteria 1943
255 Ga0207664_10074382 3300025929 Bacteria 2745
256 Ga0207644_10039686 3300025931 Bacteria 3324
257 Ga0207706_10068825 3300025933 Bacteria 3114
258 Ga0207706_10236414 3300025933 Bacteria 1597
259 Ga0207706_10243624 3300025933 Bacteria 1571
260 Ga0207706_10529905 3300025933 Bacteria 1015
261 Ga0207686_10050874 3300025934 Bacteria 2578
262 Ga0207686_10079226 3300025934 Bacteria 2139
263 Ga0207686_10127474 3300025934 Bacteria 1741
264 Ga0207686_10282682 3300025934 Bacteria 1225
265 Ga0207686_10411303 3300025934 Bacteria 1033
266 Ga0207709_10023381 3300025935 Bacteria 3517
267 Ga0207709_10052940 3300025935 Bacteria 2496
268 Ga0207670_10036808 3300025936 Bacteria 3186
269 Ga0207670_10130715 3300025936 Bacteria 1839
270 Ga0207670_10524035 3300025936 Bacteria 965
271 Ga0207669_10005445 3300025937 Bacteria 5711
272 Ga0207669_10043537 3300025937 Bacteria 2630
273 Ga0207669_10048881 3300025937 Bacteria 2517
274 Ga0207669_10154204 3300025937 Bacteria 1613
275 Ga0207704_10007412 3300025938 Bacteria 5182
276 Ga0207704_10354821 3300025938 Bacteria 1143
277 Ga0207691_10070971 3300025940 Bacteria 3144
278 Ga0207691_10225017 3300025940 Bacteria 1626
279 Ga0207691_10236733 3300025940 Bacteria 1579
280 Ga0207711_10017096 3300025941 Bacteria 6025
281 Ga0207711_10030248 3300025941 Bacteria 4567
282 Ga0207711_10111170 3300025941 Bacteria 2437
283 Ga0207711_10133113 3300025941 Bacteria 2231
284 Ga0207711_10314522 3300025941 Bacteria 1446
285 Ga0207689_10201565 3300025942 Bacteria 1642
286 Ga0207689_10427135 3300025942 Bacteria 1106
287 Ga0207661_10101252 3300025944 Bacteria 2420
288 Ga0207667_10076643 3300025949 Bacteria 3469
289 Ga0207651_10067185 3300025960 Bacteria 2522
290 Ga0207651_10077779 3300025960 Bacteria 2377
291 Ga0207712_10061429 3300025961 Bacteria 2667
292 Ga0207668_10041866 3300025972 Bacteria 3098
293 Ga0207668_10207359 3300025972 Bacteria 1565
294 Ga0207640_10010279 3300025981 Bacteria 5267
295 Ga0207640_10074736 3300025981 Bacteria 2295
296 Ga0207658_10018525 3300025986 Bacteria 4809
297 Ga0207658_10585320 3300025986 Bacteria 1001
298 Ga0207677_10093111 3300026023 Bacteria 2196
299 Ga0207677_10250165 3300026023 Bacteria 1439
300 Ga0207677_10460145 3300026023 Bacteria 1092
301 Ga0207703_10019414 3300026035 Bacteria 5311
302 Ga0207703_10065396 3300026035 Bacteria 2988
303 Ga0207703_10141179 3300026035 Bacteria 2091
304 Ga0207703_10539900 3300026035 Bacteria 1098
305 Ga0207708_10022453 3300026075 Bacteria 4765
306 Ga0207708_10234779 3300026075 Bacteria 1473
307 Ga0207702_10111114 3300026078 Bacteria 2437
308 Ga0207641_10035902 3300026088 Bacteria 4134
309 Ga0207641_10147286 3300026088 Bacteria 2130
310 Ga0207641_10483715 3300026088 Bacteria 1200
311 Ga0207648_10040162 3300026089 Bacteria 4112
312 Ga0207648_10050763 3300026089 Bacteria 3626
313 Ga0207648_10096952 3300026089 Bacteria 2581
314 Ga0207648_10140991 3300026089 Bacteria 2124
315 Ga0207676_10012077 3300026095 Bacteria 6181
316 Ga0207676_10072541 3300026095 Bacteria 2768
317 Ga0207676_10093749 3300026095 Bacteria 2472
318 Ga0207675_100059063 3300026118 Bacteria 3579
319 Ga0207675_100100460 3300026118 Bacteria 2725
320 Ga0207675_100158695 3300026118 Bacteria 2156
321 Ga0207675_100366124 3300026118 Bacteria 1415
322 Ga0209970_1030532 3300027614 Bacteria 935
323 Ga0209983_1060144 3300027665 Bacteria 839
324 Ga0209966_1052585 3300027695 Bacteria 869
325 Ga0207428_10015437 3300027907 Bacteria 6607
326 Ga0207428_10157424 3300027907 Bacteria 1727
327 Ga0207428_10221108 3300027907 Bacteria 1419
328 Ga0207428_10384762 3300027907 Bacteria 1029
329 Ga0268266_10014138 3300028379 Bacteria 6869
330 Ga0268266_10050461 3300028379 Bacteria 3570
331 Ga0268266_10158569 3300028379 Bacteria 2046
332 Ga0268265_10005659 3300028380 Bacteria 8538
333 Ga0268265_10008952 3300028380 Bacteria 6770
334 Ga0268265_10141024 3300028380 Bacteria 2018
335 Ga0268265_10379527 3300028380 Bacteria 1300
336 Ga0268264_10110219 3300028381 Bacteria 2410
337 Ga0307511_10168033 3300030521 Bacteria 1213
338 Ga0265316_10255161 3300031344 Bacteria 1287
339 Ga0307408_100132347 3300031548 Bacteria 1947
340 Ga0265314_10094341 3300031711 Bacteria 1940
341 Ga0307405_10044578 3300031731 Bacteria 2713
342 Ga0307413_10029767 3300031824 Bacteria 3060
343 Ga0307410_10036232 3300031852 Bacteria 3211
344 Ga0307410_10720221 3300031852 Bacteria 842
345 Ga0307407_10029802 3300031903 Bacteria 2936
346 Ga0307407_10042726 3300031903 Bacteria 2544
347 Ga0307412_10026630 3300031911 Bacteria 3596
348 Ga0307412_10491851 3300031911 Bacteria 1019
349 Ga0307416_100053163 3300032002 Bacteria 3248
350 Ga0307416_100061516 3300032002 Bacteria 3065
351 Ga0307416_100849313 3300032002 Bacteria 1011
352 Ga0307414_10028922 3300032004 Bacteria 3601
353 Ga0307414_10233615 3300032004 Bacteria 1518
354 Ga0307411_10008920 3300032005 Bacteria 5233
355 Ga0307411_10199489 3300032005 Bacteria 1535
356 Ga0307411_10201535 3300032005 Bacteria 1529
357 Ga0307415_100258967 3300032126 Bacteria 1418
358 Ga0373958_0005121 3300034819 Bacteria 1975
359 Ga0373958_0064206 3300034819 Bacteria 802
360 Ga0373926_0108247 3300035083 Bacteria 1043
361 Ga0373928_0003886 3300035084 Bacteria 2850
362 Ga0373929_0000476 3300035085 Bacteria 7687
363 Ga0373934_0025094 3300035086 Bacteria 2307
364 Ga0373940_0013537 3300035088 Bacteria 1976
365 Ga0373952_0002124 3300035092 Bacteria 3561
366 Ga0373923_0065476 3300035111 Bacteria 1551
367 Ga0373932_0000869 3300035112 Bacteria 8931
368 Ga0373939_0002902 3300035114 Bacteria 4030
369 Ga0373941_0000162 3300035115 Bacteria 12194
370 Ga0373941_0142473 3300035115 Bacteria 873
371 Ga0373953_0035314 3300035117 Bacteria 1964
372 Ga0373943_0014498 3300035170 Bacteria 3570
373 Ga0373943_0071261 3300035170 Bacteria 1761
374 Ga0373943_0141145 3300035170 Bacteria 1298
375 Ga0373946_0134067 3300035171 Bacteria 1142
376 Ga0373955_0011602 3300035172 Bacteria 4206
377 Ga0373961_0002875 3300035241 Bacteria 4367
378 Ga0373962_0001294 3300035242 Bacteria 5878
379 Ga0373924_0027127 3300035410 Bacteria 2276
380 Ga0373924_0066840 3300035410 Bacteria 1512
381 Ga0373931_0001425 3300035691 Bacteria 10252
382 Ga0373931_0385259 3300035691 Bacteria 885
383 Ga0373935_0094398 3300035692 Bacteria 1963
384 Ga0373933_0131920 3300035724 Bacteria 1572
385 Ga0373933_0158390 3300035724 Bacteria 1437
386 Ga0373937_0111499 3300036401 Bacteria 2545
387 Ga0373937_0201095 3300036401 Bacteria 1873
388 Ga0373937_0212161 3300036401 Bacteria 1822
389 Ga0373937_0547980 3300036401 Bacteria 1099
390 Ga0373925_0036446 3300037068 Bacteria 3630
391 Ga0373925_0125144 3300037068 Bacteria 1999
392 Ga0373925_0255474 3300037068 Bacteria 1406
393 Ga0395901_0736848 3300038443 Bacteria 980
394 Ga0436365_0196462 3300039437 Bacteria 1159
395 Ga0436365_1477503 3300039437 Bacteria 3169
396 Ga0439441_053999 3300042001 Bacteria 833
397 Ga0450894_001375 3300042131 Bacteria 3516
398 Ga0450896_001990 3300042133 Bacteria 2599
399 Ga0439435_0032138 3300042436 Bacteria 1431
400 Ga0439444_0028252 3300042437 Bacteria 1038
401 Ga0451577_0175182 3300042876 Bacteria 1933
402 Ga0439440_0024555 3300042993 Bacteria 1383
403 Ga0453683_0057214 3300044673 Bacteria 2440
404 Ga0453684_0041993 3300044712 Bacteria 6172
405 Ga0451576_0239178 3300045051 Bacteria 1897
406 Ga0451576_0276138 3300045051 Bacteria 1757
407 Ga0495592_0046686 3300046454 Bacteria 3228
408 Ga0495629_0549387 3300046459 Bacteria 775
409 Ga0495582_0078830 3300046473 Bacteria 1828
410 Ga0495639_0074794 3300046475 Bacteria 1570
411 Ga0495639_0152036 3300046475 Bacteria 1117
412 Ga0495662_0268754 3300046476 Bacteria 839
413 Ga0495608_0077000 3300046511 Bacteria 2171
414 Ga0495618_0262316 3300046514 Bacteria 1082
415 Ga0495628_0189513 3300046516 Bacteria 1553
416 Ga0495630_0065438 3300046517 Bacteria 2732
417 Ga0495652_0235221 3300046529 Bacteria 1367
418 Ga0495640_0061808 3300046533 Bacteria 2543
419 Ga0495640_0278053 3300046533 Bacteria 1043
420 Ga0495586_0362430 3300046535 Bacteria 833
421 Ga0495587_0198759 3300046536 Bacteria 1134
422 Ga0495621_0022242 3300046539 Bacteria 2100
423 Ga0495645_0004545 3300046543 Bacteria 9467
424 Ga0495645_0093654 3300046543 Bacteria 2143
425 Ga0495667_0092973 3300046559 Bacteria 1953
426 Ga0495634_0051230 3300046642 Bacteria 2771
427 Ga0495647_0071361 3300046681 Bacteria 1391
428 Ga0495647_0132184 3300046681 Bacteria 1058
429 Ga0495647_0175361 3300046681 Bacteria 930
430 Ga0495647_0190611 3300046681 Bacteria 896
431 Ga0495658_0014786 3300046683 Bacteria 3993
432 Ga0495658_0019658 3300046683 Bacteria 3529
433 Ga0495669_0004751 3300046684 Bacteria 5631
434 Ga0495613_0003530 3300046689 Bacteria 11718
435 Ga0495613_0178398 3300046689 Bacteria 1505
436 Ga0495600_0178298 3300046809 Bacteria 1369
437 Ga0495604_0035813 3300047317 Bacteria 3917
438 Ga0495674_0004626 3300047319 Bacteria 13230
439 Ga0495674_0049820 3300047319 Bacteria 3698
440 Ga0495674_0322592 3300047319 Bacteria 1258
441 Ga0495680_0106070 3300047322 Bacteria 2089
442 Ga0495675_0179514 3300047444 Bacteria 1297
443 Ga0495684_0000682 3300047471 Bacteria 27327
444 Ga0496100_0005884 3300048903 Bacteria 6641
445 Ga0496100_0413813 3300048903 Bacteria 1029
446 Ga0496101_0000222 3300048904 Bacteria 42490
447 Ga0496101_0115492 3300048904 Bacteria 2025
448 Ga0496104_0001478 3300048907 Bacteria 20272
449 Ga0496104_0012796 3300048907 Bacteria 7558
450 Ga0496104_0023018 3300048907 Bacteria 5725
451 Ga0496104_0264515 3300048907 Bacteria 1632
452 Ga0496104_0363191 3300048907 Bacteria 1360
453 Ga0496104_0573568 3300048907 Bacteria 1039
454 Ga0496105_0189990 3300048908 Bacteria 1680
455 Ga0496105_0291401 3300048908 Bacteria 1314
456 Ga0496107_0011835 3300048910 Bacteria 6093
457 Ga0496108_0225264 3300048911 Bacteria 1630
458 Ga0496110_0061241 3300048913 Bacteria 3321
459 Ga0496110_0817344 3300048913 Bacteria 837
460 Ga0496112_0014577 3300048915 Bacteria 7302
461 Ga0496112_0090825 3300048915 Bacteria 3023
462 Ga0496112_0109110 3300048915 Bacteria 2738
463 Ga0496112_0159093 3300048915 Bacteria 2225
464 Ga0496112_0414445 3300048915 Bacteria 1286
465 Ga0496113_0058705 3300048916 Bacteria 2896
466 Ga0496114_0000416 3300048917 Bacteria 31603
467 Ga0496114_0080527 3300048917 Bacteria 2751
468 Ga0496114_0289401 3300048917 Bacteria 1445
469 Ga0496115_0343797 3300048918 Bacteria 1217
470 Ga0496115_0422201 3300048918 Bacteria 1080
471 Ga0501034_0029753 3300049571 Bacteria 5552
472 Ga0501043_0055792 3300049579 Bacteria 3104
473 Ga0501047_0005040 3300049581 Bacteria 12396
474 Ga0501047_0543817 3300049581 Bacteria 986
475 Ga0501067_0238662 3300049583 Bacteria 1012
476 Ga0501068_0253567 3300049584 Bacteria 1122
477 Ga0501069_0250502 3300049585 Bacteria 1033
478 Ga0501072_0299289 3300049588 Bacteria 1279
479 Ga0501073_0000842 3300049589 Bacteria 21848
480 Ga0501073_0140011 3300049589 Bacteria 1677
481 Ga0501074_0664230 3300049590 Bacteria 736
482 Ga0501075_0078051 3300049591 Bacteria 2507
483 Ga0501080_1033309 3300049742 Bacteria 712
484 Ga0501083_0303795 3300049744 Bacteria 1038
485 Ga0501044_0010338 3300049823 Bacteria 10131
486 Ga0501044_0361372 3300049823 Bacteria 1370
487 nmdc:mga05p37_173687_c1 3300050507 Bacteria 2626
488 nmdc:mga05p37_180383_c1 3300050507 Bacteria 2569
489 nmdc:mga05p37_31924_c1 3300050507 Bacteria 6438
490 nmdc:mga05p37_37393_c1 3300050507 Bacteria 5951
491 nmdc:mga05p37_3900_c2 3300050507 Bacteria 9812
492 nmdc:mga05p37_437388_c1 3300050507 Bacteria 1518
493 nmdc:mga05p37_56606_c2 3300050507 Bacteria 4434
494 nmdc:mga09592_255344_c1 3300050508 Bacteria 1519
495 nmdc:mga08y16_106682_c1 3300050511 Bacteria 2916
496 nmdc:mga08y16_18380_c1 3300050511 Bacteria 7369
497 nmdc:mga08y16_24143_c1 3300050511 Bacteria 6419
498 nmdc:mga08y16_506548_c1 3300050511 Bacteria 1226
499 nmdc:mga08y16_810171_c1 3300050511 Bacteria 929
500 nmdc:mga08y16_92293_c1 3300050511 Bacteria 3155
501 nmdc:mga0n895_129287_c1 3300050512 Bacteria 2550
502 nmdc:mga0n895_160033_c1 3300050512 Bacteria 2283
503 nmdc:mga0n895_16738_c1 3300050512 Bacteria 6737
504 nmdc:mga0n895_202086_c1 3300050512 Bacteria 2018
505 nmdc:mga0n895_50367_c1 3300050512 Bacteria 4083
506 nmdc:mga0n895_567_c1 3300050512 Bacteria 25311
507 nmdc:mga0rr50_104537_c1 3300050513 Bacteria 2231
508 nmdc:mga0rr50_114_c1 3300050513 Bacteria 44678
509 nmdc:mga0rr50_203514_c1 3300050513 Bacteria 1628
510 nmdc:mga0rr50_228976_c1 3300050513 Bacteria 1537
511 nmdc:mga0rr50_253177_c1 3300050513 Bacteria 1463
512 nmdc:mga0rr50_4071_c1 3300050513 Bacteria 8533
513 nmdc:mga0rr50_96164_c1 3300050513 Bacteria 2317
514 nmdc:mga08x19_16651_c1 3300050514 Bacteria 4486
515 nmdc:mga08x19_18247_c1 3300050514 Bacteria 4300
516 nmdc:mga08x19_19790_c1 3300050514 Bacteria 4137
517 nmdc:mga08x19_339232_c1 3300050514 Bacteria 1048
518 nmdc:mga08x19_5290_c1 3300050514 Bacteria 7632
519 nmdc:mga0a205_113353_c1 3300050515 Bacteria 2610
520 nmdc:mga0a205_292633_c1 3300050515 Bacteria 1503
521 nmdc:mga0a205_611882_c1 3300050515 Bacteria 942
522 nmdc:mga0a205_79619_c1 3300050515 Bacteria 2507
523 Ga0495601_0003363 3300053077 Bacteria 9157
524 Ga0495612_0081922 3300053078 Bacteria 1357
525 Ga0495595_0063838 3300053084 Bacteria 1730
526 Ga0495619_0001979 3300053085 Bacteria 13653
527 Ga0590071_001549 3300059421 Bacteria 6015
528 Ga0590074_007650 3300059423 Bacteria 1796
529 Ga0590075_000822 3300059424 Bacteria 8164
530 Ga0590075_060135 3300059424 Bacteria 979
531 Ga0590077_001087 3300059426 Bacteria 6731
532 Ga0501034_0154904
533 JGI24751J29686_10011144
534 Ga0065715_10098936
535 Ga0065715_10345576
536 Ga0070658_10023619
537 Ga0070676_10006255
538 Ga0070676_10064781
539 Ga0070676_10136513
540 Ga0070690_100052481
541 Ga0070670_100112669
542 Ga0070670_100136809
543 Ga0070677_10062896
544 Ga0068869_100482244
545 Ga0070666_10036007
546 Ga0070666_10200820
547 Ga0070680_100189108
548 Ga0068868_100036623
549 Ga0068868_100777555
550 Ga0070689_100142097
551 Ga0070689_100246615
552 Ga0070691_10001817
553 Ga0070692_10054100
554 Ga0070692_10288215
555 Ga0070668_100091013
556 Ga0070669_100020427
557 Ga0070669_100158574
558 Ga0070669_100192244
559 Ga0070675_100000055
560 Ga0070675_100194031
561 Ga0070675_100807327
562 Ga0070671_100104194
563 Ga0070671_100220534
564 Ga0070671_100263844
565 Ga0070671_100519871
566 Ga0070674_100008789
567 Ga0070674_100013152
568 Ga0070674_100236649
569 Ga0070674_100429616
570 Ga0070673_100138876
571 Ga0070673_100198822
572 Ga0070688_100080837
573 Ga0070659_100153437
574 Ga0070709_10065043
575 Ga0070714_100010088
576 Ga0070713_100138788
577 Ga0070701_10018366
578 Ga0070711_100449097
579 Ga0070705_100006979
580 Ga0070705_100111121
581 Ga0070705_100477987
582 Ga0070700_100008749
583 Ga0070700_100114318
584 Ga0070694_100013957
585 Ga0070694_100206932
586 Ga0070708_100101940
587 Ga0070662_100184250
588 Ga0070681_10004061
589 Ga0070681_10075207
590 Ga0070681_10246622
591 Ga0070681_10284906
592 Ga0068867_100013036
593 Ga0068867_100487205
594 Ga0070706_100440109
595 Ga0070707_100208133
596 Ga0070698_100114994
597 Ga0070698_100575881
598 Ga0070699_100297815
599 Ga0070699_100306118
600 Ga0070699_100507559
601 Ga0070679_100032819
602 Ga0070679_100154007
603 Ga0070672_100174961
604 Ga0070686_100000926
605 Ga0070686_100025575
606 Ga0070695_100039144
607 Ga0070696_100009094
608 Ga0070696_100136601
609 Ga0070665_100007145
610 Ga0070665_100030260
611 Ga0070665_100426596
612 Ga0070704_100036172
613 Ga0068855_100329568
614 Ga0068854_100011885
615 Ga0068854_100036116
616 Ga0068854_100097722
617 Ga0068856_100104691
618 Ga0070702_100008320
619 Ga0070702_100287894
620 Ga0068852_100405379
621 Ga0068859_100042652
622 Ga0068859_100124386
623 Ga0068864_100022967
624 Ga0068864_100093617
625 Ga0068864_100268653
626 Ga0068866_10039630
627 Ga0068866_10309947
628 Ga0068851_10127531
629 Ga0068863_100256964
630 Ga0068858_100000761
631 Ga0068858_100012172
632 Ga0068858_100093738
633 Ga0068860_100526005
634 Ga0068862_100011518
635 Ga0068862_100013148
636 Ga0068862_100064039
637 Ga0068862_100559551
638 Ga0081539_10006667
639 Ga0070716_100163231
640 Ga0070716_100278807
641 Ga0097621_100019394
642 Ga0097621_100113756
643 Ga0097621_100329518
644 Ga0068871_100002863
645 Ga0068871_100014197
646 Ga0068871_100028927
647 Ga0068871_100050250
648 Ga0068871_100542807
649 Ga0075428_100023790
650 Ga0075431_100096671
651 Ga0075431_100587193
652 Ga0075433_10083754
653 Ga0075433_10414204
654 Ga0075434_100007565
655 Ga0075434_100032315
656 Ga0075434_100042544
657 Ga0075434_100219087
658 Ga0075434_100898293
659 Ga0075429_100285639
660 Ga0068865_100009647
661 Ga0068865_100049245
662 Ga0075436_100003532
663 Ga0075436_100014961
664 Ga0075436_100031703
665 Ga0075436_100057261
666 Ga0075436_100058897
667 Ga0097620_100042652
668 Ga0097620_100124390
669 Ga0075435_100000894
670 Ga0075435_100003390
671 Ga0075435_100007416
672 Ga0075435_100050091
673 Ga0075435_100060506
674 Ga0075435_100255007
675 Ga0075435_100318581
676 Ga0075435_100377511
677 Ga0105240_10060998
678 Ga0105240_10298819
679 Ga0105240_10463638
680 Ga0111539_10001440
681 Ga0111539_10004657
682 Ga0111539_10478565
683 Ga0111539_11057715
684 Ga0105245_10035367
685 Ga0105245_10251108
686 Ga0105245_10269686
687 Ga0105245_10337853
688 Ga0105245_10375620
689 Ga0105245_10901617
690 Ga0105247_10033321
691 Ga0114129_10005698
692 Ga0114129_10017539
693 Ga0114129_10018144
694 Ga0114129_10021621
695 Ga0114129_10080039
696 Ga0114129_10120934
697 Ga0114129_10380370
698 Ga0114129_10504499
699 Ga0114129_10521936
700 Ga0114129_10539314
701 Ga0114129_11184628
702 Ga0105243_10014932
703 Ga0105243_10116206
704 Ga0105243_10141369
705 Ga0105243_10464179
706 Ga0105242_10016938
707 Ga0105242_10035935
708 Ga0105242_10056184
709 Ga0105242_10278006
710 Ga0105248_10010609
711 Ga0105248_10086656
712 Ga0105248_10144074
713 Ga0105248_10173430
714 Ga0105248_10225992
715 Ga0105248_10471220
716 Ga0105238_10055683
717 Ga0105238_10122850
718 Ga0105249_10480091
719 Ga0105249_10620165
720 Ga0157374_10174597
721 Ga0163162_10054054
722 Ga0163162_10995752
723 Ga0157375_10121315
724 Ga0157375_10238222
725 Ga0157375_11129845
726 Ga0163163_10003074
727 Ga0163163_10075540
728 Ga0163163_10160984
729 Ga0163163_10483625
730 Ga0163163_10661061
731 Ga0157380_10034411
732 Ga0157380_10283421
733 Ga0157379_10054969
734 Ga0157379_10177399
735 Ga0157379_10297347
736 Ga0157379_10307349
737 Ga0157379_10317828
738 Ga0157376_10006652
739 Ga0157376_10039331
740 Ga0157376_10192833
741 Ga0157376_10219183
742 Ga0157376_10473175
743 Ga0163161_10320298
744 Ga0207666_1006632
745 Ga0207642_10096783
746 Ga0207642_10101813
747 Ga0207642_10205402
748 Ga0207710_10005045
749 Ga0207680_10085159
750 Ga0207680_10104903
751 Ga0207685_10064368
752 Ga0207699_10026006
753 Ga0207645_10006009
754 Ga0207645_10006324
755 Ga0207645_10067745
756 Ga0207705_10046296
757 Ga0207654_10219741
758 Ga0207707_10009702
759 Ga0207707_10453123
760 Ga0207695_10124830
761 Ga0207660_10220743
762 Ga0207660_10393425
763 Ga0207662_10453221
764 Ga0207657_10062935
765 Ga0207657_10409609
766 Ga0207649_10315995
767 Ga0207652_10026671
768 Ga0207652_10044785
769 Ga0207646_10144225
770 Ga0207646_10212269
771 Ga0207681_10035345
772 Ga0207681_10059847
773 Ga0207681_10072387
774 Ga0207694_10028442
775 Ga0207650_10130806
776 Ga0207650_10148890
777 Ga0207650_10237354
778 Ga0207659_10016524
779 Ga0207659_10033686
780 Ga0207659_10034662
781 Ga0207687_10024346
782 Ga0207687_10025557
783 Ga0207687_10582484
784 Ga0207700_10058086
785 Ga0207700_10147170
786 Ga0207664_10074382
787 Ga0207644_10039686
788 Ga0207706_10068825
789 Ga0207706_10236414
790 Ga0207706_10243624
791 Ga0207706_10529905
792 Ga0207686_10050874
793 Ga0207686_10079226
794 Ga0207686_10127474
795 Ga0207686_10282682
796 Ga0207686_10411303
797 Ga0207709_10023381
798 Ga0207709_10052940
799 Ga0207670_10036808
800 Ga0207670_10130715
801 Ga0207670_10524035
802 Ga0207669_10005445
803 Ga0207669_10043537
804 Ga0207669_10048881
805 Ga0207669_10154204
806 Ga0207704_10007412
807 Ga0207704_10354821
808 Ga0207691_10070971
809 Ga0207691_10225017
810 Ga0207691_10236733
811 Ga0207711_10017096
812 Ga0207711_10030248
813 Ga0207711_10111170
814 Ga0207711_10133113
815 Ga0207711_10314522
816 Ga0207689_10201565
817 Ga0207689_10427135
818 Ga0207661_10101252
819 Ga0207667_10076643
820 Ga0207651_10067185
821 Ga0207651_10077779
822 Ga0207712_10061429
823 Ga0207668_10041866
824 Ga0207668_10207359
825 Ga0207640_10010279
826 Ga0207640_10074736
827 Ga0207658_10018525
828 Ga0207658_10585320
829 Ga0207677_10093111
830 Ga0207677_10250165
831 Ga0207677_10460145
832 Ga0207703_10019414
833 Ga0207703_10065396
834 Ga0207703_10141179
835 Ga0207703_10539900
836 Ga0207708_10022453
837 Ga0207708_10234779
838 Ga0207702_10111114
839 Ga0207641_10035902
840 Ga0207641_10147286
841 Ga0207641_10483715
842 Ga0207648_10040162
843 Ga0207648_10050763
844 Ga0207648_10096952
845 Ga0207648_10140991
846 Ga0207676_10012077
847 Ga0207676_10072541
848 Ga0207676_10093749
849 Ga0207675_100059063
850 Ga0207675_100100460
851 Ga0207675_100158695
852 Ga0207675_100366124
853 Ga0209970_1030532
854 Ga0209983_1060144
855 Ga0209966_1052585
856 Ga0207428_10015437
857 Ga0207428_10157424
858 Ga0207428_10221108
859 Ga0207428_10384762
860 Ga0268266_10014138
861 Ga0268266_10050461
862 Ga0268266_10158569
863 Ga0268265_10005659
864 Ga0268265_10008952
865 Ga0268265_10141024
866 Ga0268265_10379527
867 Ga0268264_10110219
868 Ga0307511_10168033
869 Ga0265316_10255161
870 Ga0307408_100132347
871 Ga0265314_10094341
872 Ga0307405_10044578
873 Ga0307413_10029767
874 Ga0307410_10036232
875 Ga0307410_10720221
876 Ga0307407_10029802
877 Ga0307407_10042726
878 Ga0307412_10026630
879 Ga0307412_10491851
880 Ga0307416_100053163
881 Ga0307416_100061516
882 Ga0307416_100849313
883 Ga0307414_10028922
884 Ga0307414_10233615
885 Ga0307411_10008920
886 Ga0307411_10199489
887 Ga0307411_10201535
888 Ga0307415_100258967
889 Ga0373958_0005121
890 Ga0373958_0064206
891 Ga0373926_0108247
892 Ga0373928_0003886
893 Ga0373929_0000476
894 Ga0373934_0025094
895 Ga0373940_0013537
896 Ga0373952_0002124
897 Ga0373923_0065476
898 Ga0373932_0000869
899 Ga0373939_0002902
900 Ga0373941_0000162
901 Ga0373941_0142473
902 Ga0373953_0035314
903 Ga0373943_0014498
904 Ga0373943_0071261
905 Ga0373943_0141145
906 Ga0373946_0134067
907 Ga0373955_0011602
908 Ga0373961_0002875
909 Ga0373962_0001294
910 Ga0373924_0027127
911 Ga0373924_0066840
912 Ga0373931_0001425
913 Ga0373931_0385259
914 Ga0373935_0094398
915 Ga0373933_0131920
916 Ga0373933_0158390
917 Ga0373937_0111499
918 Ga0373937_0201095
919 Ga0373937_0212161
920 Ga0373937_0547980
921 Ga0373925_0036446
922 Ga0373925_0125144
923 Ga0373925_0255474
924 Ga0395901_0736848
925 Ga0436365_0196462
926 Ga0436365_1477503
927 Ga0439441_053999
928 Ga0450894_001375
929 Ga0450896_001990
930 Ga0439435_0032138
931 Ga0439444_0028252
932 Ga0451577_0175182
933 Ga0439440_0024555
934 Ga0453683_0057214
935 Ga0453684_0041993
936 Ga0451576_0239178
937 Ga0451576_0276138
938 Ga0495592_0046686
939 Ga0495629_0549387
940 Ga0495582_0078830
941 Ga0495639_0074794
942 Ga0495639_0152036
943 Ga0495662_0268754
944 Ga0495608_0077000
945 Ga0495618_0262316
946 Ga0495628_0189513
947 Ga0495630_0065438
948 Ga0495652_0235221
949 Ga0495640_0061808
950 Ga0495640_0278053
951 Ga0495586_0362430
952 Ga0495587_0198759
953 Ga0495621_0022242
954 Ga0495645_0004545
955 Ga0495645_0093654
956 Ga0495667_0092973
957 Ga0495634_0051230
958 Ga0495647_0071361
959 Ga0495647_0132184
960 Ga0495647_0175361
961 Ga0495647_0190611
962 Ga0495658_0014786
963 Ga0495658_0019658
964 Ga0495669_0004751
965 Ga0495613_0003530
966 Ga0495613_0178398
967 Ga0495600_0178298
968 Ga0495604_0035813
969 Ga0495674_0004626
970 Ga0495674_0049820
971 Ga0495674_0322592
972 Ga0495680_0106070
973 Ga0495675_0179514
974 Ga0495684_0000682
975 Ga0496100_0005884
976 Ga0496100_0413813
977 Ga0496101_0000222
978 Ga0496101_0115492
979 Ga0496104_0001478
980 Ga0496104_0012796
981 Ga0496104_0023018
982 Ga0496104_0264515
983 Ga0496104_0363191
984 Ga0496104_0573568
985 Ga0496105_0189990
986 Ga0496105_0291401
987 Ga0496107_0011835
988 Ga0496108_0225264
989 Ga0496110_0061241
990 Ga0496110_0817344
991 Ga0496112_0014577
992 Ga0496112_0090825
993 Ga0496112_0109110
994 Ga0496112_0159093
995 Ga0496112_0414445
996 Ga0496113_0058705
997 Ga0496114_0000416
998 Ga0496114_0080527
999 Ga0496114_0289401
1000 Ga0496115_0343797
1001 Ga0496115_0422201
1002 Ga0501034_0029753
1003 Ga0501043_0055792
1004 Ga0501047_0005040
1005 Ga0501047_0543817
1006 Ga0501067_0238662
1007 Ga0501068_0253567
1008 Ga0501069_0250502
1009 Ga0501072_0299289
1010 Ga0501073_0000842
1011 Ga0501073_0140011
1012 Ga0501074_0664230
1013 Ga0501075_0078051
1014 Ga0501080_1033309
1015 Ga0501083_0303795
1016 Ga0501044_0010338
1017 Ga0501044_0361372
1018 nmdc:mga05p37_173687_c1
1019 nmdc:mga05p37_180383_c1
1020 nmdc:mga05p37_31924_c1
1021 nmdc:mga05p37_37393_c1
1022 nmdc:mga05p37_3900_c2
1023 nmdc:mga05p37_437388_c1
1024 nmdc:mga05p37_56606_c2
1025 nmdc:mga09592_255344_c1
1026 nmdc:mga08y16_106682_c1
1027 nmdc:mga08y16_18380_c1
1028 nmdc:mga08y16_24143_c1
1029 nmdc:mga08y16_506548_c1
1030 nmdc:mga08y16_810171_c1
1031 nmdc:mga08y16_92293_c1
1032 nmdc:mga0n895_129287_c1
1033 nmdc:mga0n895_160033_c1
1034 nmdc:mga0n895_16738_c1
1035 nmdc:mga0n895_202086_c1
1036 nmdc:mga0n895_50367_c1
1037 nmdc:mga0n895_567_c1
1038 nmdc:mga0rr50_104537_c1
1039 nmdc:mga0rr50_114_c1
1040 nmdc:mga0rr50_203514_c1
1041 nmdc:mga0rr50_228976_c1
1042 nmdc:mga0rr50_253177_c1
1043 nmdc:mga0rr50_4071_c1
1044 nmdc:mga0rr50_96164_c1
1045 nmdc:mga08x19_16651_c1
1046 nmdc:mga08x19_18247_c1
1047 nmdc:mga08x19_19790_c1
1048 nmdc:mga08x19_339232_c1
1049 nmdc:mga08x19_5290_c1
1050 nmdc:mga0a205_113353_c1
1051 nmdc:mga0a205_292633_c1
1052 nmdc:mga0a205_611882_c1
1053 nmdc:mga0a205_79619_c1
1054 Ga0495601_0003363
1055 Ga0495612_0081922
1056 Ga0495595_0063838
1057 Ga0495619_0001979
1058 Ga0590071_001549
1059 Ga0590074_007650
1060 Ga0590075_000822
1061 Ga0590075_060135
1062 Ga0590077_001087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

31

149

0.9

PF13183

Fer4_8

4Fe-4S dicluster domain

182

255

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kf6-assembly1.cif.gz_B e. coli quinol-fumarate reductase with bound inhibitor hqno 0.6182 1 246
1kf6-assembly1.cif.gz_B e. coli quinol-fumarate reductase with bound inhibitor hqno 0.5921 1 246
2bs3-assembly1.cif.gz_B glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes 0.5905 1 239
2acz-assembly1.cif.gz_B complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.5795 1 243
2bs3-assembly1.cif.gz_B glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes 0.5744 1 239
ID Description Score Start End Superfamily
2wu2F02 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.5593 121 247 1.10.1060.10
2wu2F02 Mainly Alpha;Orthogonal Bundle;Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2;Alpha-helical ferredoxin 0.5403 121 247 1.10.1060.10
af_Q9NA80_129_263_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.5159 2 110 3.10.20.90
af_A0A0N7KNQ5_188_268_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.4944 1 98 3.10.20.90
af_A0A0N7KNQ5_188_268_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.468 1 98 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A849G0P9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.952 1 96 GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A3M2HB32-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9488 2 104 GO:0009055
GO:0051537
AF-A0A2D9ZQM6-F1-model_v4 deleted 0.9465 1 98
AF-A0A7X8VMZ1-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9433 1 103 GO:0009055
GO:0051537
AF-A0A847GCC4-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.942 1 92 GO:0009055
GO:0051537

Map