F459997

General Info

Members Datasets Scaffolds Average Seq Length
530 291 1060 67

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0118934|Ga0495629_0118934_1452_1697
Length 81
Sequence MASTVAAQTDGRIEMPTGTVKWFSDEKGFGFITPDDGSSDLFVHQSAINSEGFRTLAEGAKVSFESEAGPKGPRAVSVQAL

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
200 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
201 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
202 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
203 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
204 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
205 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
206 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
207 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
208 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
209 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 2.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.49
Nodule 0
Rhizoplane 3.58
Rhizosphere 85.85
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0118934 3300046459 Bacteria 1841
2 LJQas_1037101 3300000549 Bacteria 575
3 JGI24744J21845_10083405 3300002077 Bacteria 585
4 Ga0006759J45824_1004196 3300003163 Bacteria 563
5 JGI25407J50210_10004778 3300003373 Bacteria 3308
6 Ga0007429J51699_1014583 3300003579 Bacteria 534
7 Ga0070658_10174928 3300005327 Bacteria 1805
8 Ga0070658_10363040 3300005327 Bacteria 1241
9 Ga0070658_10800587 3300005327 Bacteria 819
10 Ga0070683_100727288 3300005329 Bacteria 951
11 Ga0070683_101590100 3300005329 Bacteria 629
12 Ga0070670_101106263 3300005331 Bacteria 723
13 Ga0068869_101250624 3300005334 Bacteria 654
14 Ga0068869_101868030 3300005334 Bacteria 538
15 Ga0070666_10703468 3300005335 Bacteria 741
16 Ga0070680_100313590 3300005336 Bacteria 1331
17 Ga0070682_100022138 3300005337 Bacteria 3760
18 Ga0070682_101083431 3300005337 Bacteria 670
19 Ga0070682_101339471 3300005337 Bacteria 610
20 Ga0070682_101534438 3300005337 Bacteria 574
21 Ga0068868_100017424 3300005338 Bacteria 5353
22 Ga0068868_100263624 3300005338 Bacteria 1454
23 Ga0068868_101546729 3300005338 Bacteria 622
24 Ga0070660_100006317 3300005339 Bacteria 8207
25 Ga0070660_100015694 3300005339 Bacteria 5476
26 Ga0070689_100198401 3300005340 Bacteria 1637
27 Ga0070689_100872443 3300005340 Bacteria 795
28 Ga0070691_10434368 3300005341 Bacteria 747
29 Ga0070661_101481820 3300005344 Bacteria 572
30 Ga0070692_10745089 3300005345 Bacteria 664
31 Ga0070668_100077172 3300005347 Bacteria 2604
32 Ga0070669_100047118 3300005353 Bacteria 3144
33 Ga0070675_100185090 3300005354 Bacteria 1802
34 Ga0070671_100534800 3300005355 Bacteria 1010
35 Ga0070671_100671869 3300005355 Bacteria 898
36 Ga0070674_100095597 3300005356 Bacteria 2154
37 Ga0070674_100484987 3300005356 Bacteria 1027
38 Ga0070673_100232944 3300005364 Bacteria 1598
39 Ga0070673_102150828 3300005364 Bacteria 530
40 Ga0070673_102384926 3300005364 Bacteria 503
41 Ga0070688_100844709 3300005365 Bacteria 719
42 Ga0070688_101419495 3300005365 Bacteria 563
43 Ga0070688_101465700 3300005365 Bacteria 555
44 Ga0070659_100295248 3300005366 Bacteria 1350
45 Ga0070659_100376889 3300005366 Bacteria 1194
46 Ga0070659_100722949 3300005366 Bacteria 862
47 Ga0070659_101154166 3300005366 Bacteria 684
48 Ga0070667_100302560 3300005367 Bacteria 1440
49 Ga0070709_10206151 3300005434 Bacteria 1395
50 Ga0070714_102023770 3300005435 Bacteria 562
51 Ga0070701_10444509 3300005438 Bacteria 831
52 Ga0070711_100073356 3300005439 Bacteria 2418
53 Ga0070700_100259979 3300005441 Bacteria 1250
54 Ga0070694_100569131 3300005444 Bacteria 909
55 Ga0070708_101169797 3300005445 Bacteria 720
56 Ga0070663_100969870 3300005455 Bacteria 738
57 Ga0070678_100012624 3300005456 Bacteria 5263
58 Ga0070662_100488728 3300005457 Bacteria 1026
59 Ga0070681_10514571 3300005458 Bacteria 1110
60 Ga0070681_10581597 3300005458 Bacteria 1034
61 Ga0068867_100073938 3300005459 Bacteria 2553
62 Ga0070685_10175934 3300005466 Bacteria 1374
63 Ga0070685_10483645 3300005466 Bacteria 873
64 Ga0070707_101079447 3300005468 Bacteria 769
65 Ga0070679_100333584 3300005530 Bacteria 1465
66 Ga0070679_100634904 3300005530 Bacteria 1011
67 Ga0070684_100323517 3300005535 Bacteria 1417
68 Ga0070684_100334600 3300005535 Bacteria 1392
69 Ga0070684_100815227 3300005535 Bacteria 873
70 Ga0070684_101062382 3300005535 Bacteria 760
71 Ga0068853_102199284 3300005539 Bacteria 535
72 Ga0070672_100498071 3300005543 Bacteria 1054
73 Ga0070672_101090656 3300005543 Bacteria 709
74 Ga0070686_100084372 3300005544 Bacteria 2111
75 Ga0070695_100014781 3300005545 Bacteria 4709
76 Ga0070696_100448836 3300005546 Bacteria 1017
77 Ga0070693_100559504 3300005547 Bacteria 820
78 Ga0070665_101463719 3300005548 Bacteria 692
79 Ga0070704_100266671 3300005549 Bacteria 1413
80 Ga0070704_100879250 3300005549 Bacteria 805
81 Ga0070664_100721801 3300005564 Bacteria 929
82 Ga0070664_100974536 3300005564 Bacteria 796
83 Ga0070664_101360234 3300005564 Bacteria 671
84 Ga0070664_102205642 3300005564 Bacteria 523
85 Ga0068857_100903238 3300005577 Bacteria 847
86 Ga0068856_100271458 3300005614 Bacteria 1712
87 Ga0068856_100386514 3300005614 Bacteria 1419
88 Ga0068856_100605057 3300005614 Bacteria 1117
89 Ga0070702_100356713 3300005615 Bacteria 1032
90 Ga0070702_101038457 3300005615 Bacteria 651
91 Ga0068852_100202527 3300005616 Bacteria 1879
92 Ga0068852_100547009 3300005616 Bacteria 1158
93 Ga0068852_101050165 3300005616 Bacteria 834
94 Ga0068852_102622018 3300005616 Bacteria 524
95 Ga0068859_100796466 3300005617 Bacteria 1033
96 Ga0068864_102386805 3300005618 Bacteria 535
97 Ga0068866_10790632 3300005718 Bacteria 659
98 Ga0068861_100233905 3300005719 Bacteria 1560
99 Ga0068861_101254354 3300005719 Bacteria 719
100 Ga0068851_10744982 3300005834 Bacteria 606
101 Ga0068870_10407006 3300005840 Bacteria 887
102 Ga0068863_102120698 3300005841 Bacteria 572
103 Ga0068858_100741211 3300005842 Bacteria 957
104 Ga0068858_101901532 3300005842 Bacteria 588
105 Ga0081455_10011226 3300005937 Bacteria 9013
106 Ga0081455_10089611 3300005937 Bacteria 2496
107 Ga0081455_10343523 3300005937 Bacteria 1055
108 Ga0081538_10000610 3300005981 Bacteria 39608
109 Ga0081540_1131761 3300005983 Bacteria 1019
110 Ga0081539_10473140 3300005985 Bacteria 519
111 Ga0075365_10007202 3300006038 Bacteria 6211
112 Ga0075365_10010327 3300006038 Bacteria 5427
113 Ga0075365_10014205 3300006038 Bacteria 4785
114 Ga0075365_10059382 3300006038 Bacteria 2549
115 Ga0075365_10176051 3300006038 Bacteria 1494
116 Ga0075365_10323698 3300006038 Bacteria 1086
117 Ga0075365_10389590 3300006038 Bacteria 983
118 Ga0075365_10485647 3300006038 Bacteria 873
119 Ga0075365_10675356 3300006038 Bacteria 730
120 Ga0075368_10442991 3300006042 Bacteria 575
121 Ga0075363_100218787 3300006048 Bacteria 1091
122 Ga0075363_100536273 3300006048 Bacteria 697
123 Ga0075363_100611594 3300006048 Bacteria 653
124 Ga0075363_100625872 3300006048 Bacteria 646
125 Ga0075363_100634124 3300006048 Bacteria 642
126 Ga0075364_10044358 3300006051 Bacteria 2892
127 Ga0075364_10060617 3300006051 Bacteria 2481
128 Ga0070715_10221088 3300006163 Bacteria 974
129 Ga0070716_100152363 3300006173 Bacteria 1489
130 Ga0070712_100009086 3300006175 Bacteria 6258
131 Ga0075367_10155472 3300006178 Bacteria 1421
132 Ga0075367_10253126 3300006178 Bacteria 1105
133 Ga0075367_10645251 3300006178 Bacteria 673
134 Ga0097621_100993268 3300006237 Bacteria 785
135 Ga0097621_101538541 3300006237 Bacteria 632
136 Ga0097621_101801463 3300006237 Bacteria 584
137 Ga0075370_10451130 3300006353 Bacteria 774
138 Ga0075428_100198182 3300006844 Bacteria 2171
139 Ga0075428_100619745 3300006844 Bacteria 1155
140 Ga0075428_101707350 3300006844 Bacteria 657
141 Ga0075430_100244462 3300006846 Bacteria 1487
142 Ga0075430_100733570 3300006846 Bacteria 814
143 Ga0075431_100695307 3300006847 Bacteria 995
144 Ga0075431_102134916 3300006847 Bacteria 515
145 Ga0075433_10400577 3300006852 Bacteria 1211
146 Ga0075434_101185187 3300006871 Bacteria 776
147 Ga0068865_100056858 3300006881 Bacteria 2727
148 Ga0068865_100343719 3300006881 Bacteria 1207
149 Ga0068865_101176865 3300006881 Bacteria 678
150 Ga0097620_100796616 3300006931 Bacteria 1033
151 Ga0105251_10550937 3300009011 Bacteria 543
152 Ga0111539_10311389 3300009094 Bacteria 1832
153 Ga0111539_10369343 3300009094 Bacteria 1670
154 Ga0111539_11390295 3300009094 Bacteria 814
155 Ga0105245_10209665 3300009098 Bacteria 1875
156 Ga0105245_11161853 3300009098 Bacteria 819
157 Ga0105245_12112807 3300009098 Bacteria 617
158 Ga0105247_11409325 3300009101 Bacteria 564
159 Ga0114129_10147408 3300009147 Bacteria 3223
160 Ga0114129_10231482 3300009147 Bacteria 2489
161 Ga0114129_10662233 3300009147 Bacteria 1346
162 Ga0105243_10533119 3300009148 Bacteria 1118
163 Ga0105243_10891063 3300009148 Bacteria 884
164 Ga0105243_11603859 3300009148 Bacteria 677
165 Ga0105241_10913276 3300009174 Bacteria 816
166 Ga0105242_10307171 3300009176 Bacteria 1450
167 Ga0105242_11088765 3300009176 Bacteria 812
168 Ga0105242_12622682 3300009176 Bacteria 553
169 Ga0105248_12373447 3300009177 Bacteria 604
170 Ga0105237_11589725 3300009545 Bacteria 661
171 Ga0105238_10757636 3300009551 Bacteria 985
172 Ga0105238_12822826 3300009551 Bacteria 522
173 Ga0105249_10600280 3300009553 Bacteria 1155
174 Ga0105239_10103636 3300010375 Bacteria 3149
175 Ga0105239_10690347 3300010375 Bacteria 1167
176 Ga0105246_11098740 3300011119 Bacteria 726
177 Ga0157371_11086725 3300013102 Bacteria 613
178 Ga0157370_11942165 3300013104 Bacteria 528
179 Ga0157369_10229710 3300013105 Bacteria 1940
180 Ga0157369_10331916 3300013105 Bacteria 1580
181 Ga0157374_11330401 3300013296 Bacteria 741
182 Ga0157372_10412338 3300013307 Bacteria 1574
183 Ga0157372_10580039 3300013307 Bacteria 1307
184 Ga0157372_12254345 3300013307 Bacteria 626
185 Ga0157375_11022664 3300013308 Bacteria 965
186 Ga0157375_11792485 3300013308 Bacteria 728
187 Ga0163163_10800107 3300014325 Bacteria 1006
188 Ga0163163_11473612 3300014325 Bacteria 742
189 Ga0163163_12111802 3300014325 Bacteria 623
190 Ga0157380_11506942 3300014326 Bacteria 726
191 Ga0157380_12057321 3300014326 Bacteria 633
192 Ga0157377_10365008 3300014745 Bacteria 973
193 Ga0157377_10512430 3300014745 Bacteria 840
194 Ga0157377_10952049 3300014745 Bacteria 646
195 Ga0157379_11345576 3300014968 Bacteria 691
196 Ga0157376_10676449 3300014969 Bacteria 1035
197 Ga0157376_10886178 3300014969 Unclassified 910
198 Ga0184600_114130 3300019190 Bacteria 636
199 Ga0206356_11117895 3300020070 Bacteria 769
200 Ga0206356_11274384 3300020070 Bacteria 629
201 Ga0206353_11158706 3300020082 Bacteria 543
202 Ga0213876_10023738 3300021384 Bacteria 3237
203 Ga0213875_10006453 3300021388 Bacteria 6154
204 Ga0224712_10307905 3300022467 Bacteria 742
205 Ga0207426_1035294 3300025302 Bacteria 1596
206 Ga0207642_11049160 3300025899 Bacteria 526
207 Ga0207688_10067966 3300025901 Bacteria 2017
208 Ga0207688_10676901 3300025901 Bacteria 652
209 Ga0207685_10222277 3300025905 Bacteria 899
210 Ga0207699_10286372 3300025906 Bacteria 1146
211 Ga0207643_10053982 3300025908 Bacteria 2283
212 Ga0207643_10732143 3300025908 Bacteria 640
213 Ga0207643_10778360 3300025908 Bacteria 620
214 Ga0207705_10111374 3300025909 Bacteria 2023
215 Ga0207705_11008515 3300025909 Bacteria 643
216 Ga0207654_11363085 3300025911 Bacteria 517
217 Ga0207707_10073128 3300025912 Bacteria 2989
218 Ga0207671_11402976 3300025914 Bacteria 541
219 Ga0207693_10010485 3300025915 Bacteria 7521
220 Ga0207663_10091671 3300025916 Bacteria 2018
221 Ga0207657_10018613 3300025919 Bacteria 6620
222 Ga0207657_10135011 3300025919 Bacteria 2019
223 Ga0207657_10212945 3300025919 Bacteria 1550
224 Ga0207657_11189502 3300025919 Bacteria 580
225 Ga0207649_11579520 3300025920 Bacteria 519
226 Ga0207649_11586055 3300025920 Bacteria 518
227 Ga0207652_10457190 3300025921 Bacteria 1151
228 Ga0207652_11492671 3300025921 Bacteria 580
229 Ga0207681_10008549 3300025923 Bacteria 6252
230 Ga0207694_11085949 3300025924 Bacteria 677
231 Ga0207694_11513209 3300025924 Bacteria 566
232 Ga0207650_10278600 3300025925 Bacteria 1361
233 Ga0207650_10321709 3300025925 Bacteria 1267
234 Ga0207687_10013152 3300025927 Bacteria 5406
235 Ga0207687_10032700 3300025927 Bacteria 3524
236 Ga0207687_11207964 3300025927 Bacteria 650
237 Ga0207664_11486039 3300025929 Bacteria 599
238 Ga0207644_10527643 3300025931 Bacteria 976
239 Ga0207690_10051395 3300025932 Bacteria 2756
240 Ga0207690_10405609 3300025932 Bacteria 1088
241 Ga0207690_10441991 3300025932 Bacteria 1044
242 Ga0207690_10639402 3300025932 Bacteria 871
243 Ga0207706_10474578 3300025933 Bacteria 1081
244 Ga0207686_10448717 3300025934 Bacteria 992
245 Ga0207686_10633490 3300025934 Bacteria 844
246 Ga0207686_10985266 3300025934 Bacteria 683
247 Ga0207686_11440570 3300025934 Bacteria 567
248 Ga0207709_10039132 3300025935 Bacteria 2830
249 Ga0207709_10831194 3300025935 Bacteria 747
250 Ga0207670_10884923 3300025936 Bacteria 747
251 Ga0207669_10147428 3300025937 Bacteria 1643
252 Ga0207669_10858721 3300025937 Bacteria 756
253 Ga0207704_10503557 3300025938 Bacteria 976
254 Ga0207704_11243111 3300025938 Bacteria 636
255 Ga0207704_11288439 3300025938 Bacteria 624
256 Ga0207665_10034952 3300025939 Bacteria 3335
257 Ga0207691_11741628 3300025940 Bacteria 503
258 Ga0207711_10820491 3300025941 Bacteria 866
259 Ga0207661_10118615 3300025944 Bacteria 2249
260 Ga0207661_10869255 3300025944 Bacteria 830
261 Ga0207679_10200308 3300025945 Bacteria 1667
262 Ga0207679_10413735 3300025945 Bacteria 1189
263 Ga0207679_10493715 3300025945 Bacteria 1091
264 Ga0207679_11222570 3300025945 Bacteria 690
265 Ga0207651_10965129 3300025960 Bacteria 761
266 Ga0207651_11024613 3300025960 Bacteria 738
267 Ga0207712_10454787 3300025961 Bacteria 1086
268 Ga0207712_11083032 3300025961 Bacteria 713
269 Ga0207668_10182428 3300025972 Bacteria 1657
270 Ga0207640_10123999 3300025981 Bacteria 1856
271 Ga0207640_10310973 3300025981 Bacteria 1250
272 Ga0207658_10362959 3300025986 Bacteria 1264
273 Ga0207677_10014434 3300026023 Bacteria 4613
274 Ga0207677_10574220 3300026023 Bacteria 986
275 Ga0207677_10821929 3300026023 Bacteria 833
276 Ga0207677_12265731 3300026023 Bacteria 505
277 Ga0207703_10315584 3300026035 Bacteria 1430
278 Ga0207703_11065673 3300026035 Bacteria 776
279 Ga0207678_11279843 3300026067 Bacteria 649
280 Ga0207708_10099028 3300026075 Bacteria 2254
281 Ga0207708_10184805 3300026075 Bacteria 1656
282 Ga0207708_10534425 3300026075 Bacteria 987
283 Ga0207702_10217852 3300026078 Bacteria 1778
284 Ga0207702_10442610 3300026078 Bacteria 1260
285 Ga0207648_10570444 3300026089 Bacteria 1041
286 Ga0207648_11549686 3300026089 Bacteria 623
287 Ga0207676_11952207 3300026095 Bacteria 586
288 Ga0207674_11017620 3300026116 Bacteria 798
289 Ga0207675_100316715 3300026118 Bacteria 1522
290 Ga0207675_100814376 3300026118 Bacteria 948
291 Ga0207683_10007686 3300026121 Bacteria 9230
292 Ga0207683_10592895 3300026121 Bacteria 1025
293 Ga0207683_11532715 3300026121 Bacteria 615
294 Ga0207698_10299940 3300026142 Bacteria 1495
295 Ga0207698_10549857 3300026142 Bacteria 1131
296 Ga0207698_11238120 3300026142 Bacteria 761
297 Ga0209813_10324284 3300027866 Bacteria 604
298 Ga0207428_10069206 3300027907 Bacteria 2775
299 Ga0207428_10515916 3300027907 Bacteria 867
300 Ga0207428_11287658 3300027907 Bacteria 507
301 Ga0268266_10218801 3300028379 Bacteria 1750
302 Ga0268266_11467220 3300028379 Bacteria 658
303 Ga0268265_10627079 3300028380 Bacteria 1031
304 Ga0268265_11298215 3300028380 Bacteria 728
305 Ga0265777_105592 3300030877 Bacteria 834
306 Ga0307408_100102612 3300031548 Bacteria 2182
307 Ga0307408_100526363 3300031548 Bacteria 1039
308 Ga0307408_102452080 3300031548 Bacteria 507
309 Ga0316578_10148741 3300031728 Bacteria 1411
310 Ga0307405_10298560 3300031731 Bacteria 1221
311 Ga0307405_10408665 3300031731 Bacteria 1065
312 Ga0307413_10172175 3300031824 Bacteria 1534
313 Ga0307413_10329314 3300031824 Bacteria 1170
314 Ga0307413_10751786 3300031824 Bacteria 815
315 Ga0307413_10814427 3300031824 Bacteria 786
316 Ga0307413_11247956 3300031824 Bacteria 648
317 Ga0307410_10172919 3300031852 Bacteria 1629
318 Ga0307406_11076717 3300031901 Bacteria 693
319 Ga0307407_10116494 3300031903 Bacteria 1686
320 Ga0307407_10237167 3300031903 Bacteria 1242
321 Ga0307407_11007643 3300031903 Bacteria 644
322 Ga0307412_11499562 3300031911 Bacteria 613
323 Ga0307409_100001096 3300031995 Bacteria 12802
324 Ga0307409_101264488 3300031995 Bacteria 762
325 Ga0307416_100032254 3300032002 Bacteria 3955
326 Ga0307416_100040186 3300032002 Bacteria 3631
327 Ga0307416_100124927 3300032002 Bacteria 2303
328 Ga0307416_100618563 3300032002 Bacteria 1165
329 Ga0307416_102144870 3300032002 Bacteria 660
330 Ga0307416_103224773 3300032002 Bacteria 546
331 Ga0307414_10050153 3300032004 Bacteria 2890
332 Ga0307414_11905826 3300032004 Bacteria 555
333 Ga0307414_11960707 3300032004 Bacteria 547
334 Ga0307411_11561840 3300032005 Bacteria 608
335 Ga0307415_100017991 3300032126 Bacteria 4254
336 Ga0307415_100160383 3300032126 Bacteria 1742
337 Ga0307415_100259292 3300032126 Bacteria 1417
338 Ga0307415_100541103 3300032126 Bacteria 1026
339 Ga0373940_0274284 3300035088 Bacteria 574
340 Ga0373941_0261944 3300035115 Bacteria 678
341 Ga0373943_0104036 3300035170 Bacteria 1489
342 Ga0316574_0068796 3300035398 Bacteria 2233
343 Ga0373933_0718986 3300035724 Bacteria 657
344 Ga0316582_0788848 3300036647 Bacteria 651
345 Ga0395898_0433237 3300037466 Bacteria 1253
346 Ga0395905_1901163 3300037471 Bacteria 501
347 Ga0436364_0045049 3300037853 Bacteria 87133
348 Ga0395901_0520105 3300038443 Bacteria 1209
349 Ga0395901_0638029 3300038443 Bacteria 1070
350 Ga0395901_1279569 3300038443 Bacteria 696
351 Ga0395901_1470194 3300038443 Bacteria 638
352 Ga0436365_0283725 3300039437 Bacteria 1042
353 Ga0436365_0696518 3300039437 Bacteria 60561
354 Ga0436361_0428821 3300039447 Bacteria 525
355 Ga0436363_1348304 3300039450 Bacteria 4783
356 Ga0436362_0112354 3300039453 Bacteria 3414
357 Ga0451787_770723 3300041441 Bacteria 630
358 Ga0451791_1610830 3300041451 Bacteria 806
359 Ga0451791_1766138 3300041451 Bacteria 510
360 Ga0451793_0147801 3300041452 Bacteria 1066
361 Ga0451797_0608078 3300041453 Bacteria 520
362 Ga0451798_0076475 3300041458 Bacteria 1070
363 Ga0451800_0049861 3300041459 Bacteria 572
364 Ga0451802_1103034 3300041460 Bacteria 1394
365 Ga0451804_1114275 3300041463 Bacteria 503
366 Ga0451837_0879342 3300041494 Bacteria 614
367 Ga0451837_1616205 3300041494 Bacteria 1522
368 Ga0451839_1281219 3300041496 Bacteria 660
369 Ga0451843_0866541 3300041509 Bacteria 1094
370 Ga0466972_0189947 3300044658 Bacteria 963
371 Ga0466972_0190729 3300044658 Bacteria 961
372 Ga0466965_0230057 3300044683 Bacteria 990
373 Ga0466963_0167124 3300044694 Bacteria 1532
374 Ga0466963_0201054 3300044694 Bacteria 1394
375 Ga0466963_0520276 3300044694 Bacteria 840
376 Ga0466963_0985884 3300044694 Bacteria 593
377 Ga0466964_0107671 3300044706 Bacteria 1239
378 Ga0466957_1392643 3300044842 Bacteria 510
379 Ga0466960_0000018 3300044901 Bacteria 55572
380 Ga0466960_0139953 3300044901 Bacteria 1285
381 Ga0466960_0258806 3300044901 Bacteria 969
382 Ga0466960_0319861 3300044901 Bacteria 878
383 Ga0466958_0508817 3300045836 Bacteria 781
384 Ga0466967_0211211 3300045976 Bacteria 1841
385 Ga0466967_1167640 3300045976 Bacteria 767
386 Ga0466967_1327341 3300045976 Bacteria 716
387 Ga0466967_1329029 3300045976 Bacteria 716
388 Ga0466967_1371626 3300045976 Bacteria 704
389 Ga0466967_1572706 3300045976 Bacteria 655
390 Ga0466967_1704397 3300045976 Bacteria 628
391 Ga0495638_0024483 3300046460 Bacteria 3936
392 Ga0495641_0561075 3300046461 Unclassified 521
393 Ga0495650_0000054 3300046471 Bacteria 313631
394 Ga0495582_0542839 3300046473 Bacteria 672
395 Ga0495584_0249071 3300046491 Bacteria 903
396 Ga0495584_0740679 3300046491 Bacteria 501
397 Ga0495585_0374846 3300046492 Bacteria 688
398 Ga0495596_0074284 3300046500 Bacteria 1320
399 Ga0495596_0283333 3300046500 Bacteria 644
400 Ga0495596_0286129 3300046500 Bacteria 641
401 Ga0495630_1359347 3300046517 Bacteria 535
402 Ga0495644_0220362 3300046523 Bacteria 733
403 Ga0495609_0441851 3300046538 Bacteria 517
404 Ga0495667_0666756 3300046559 Bacteria 646
405 Ga0495656_0193022 3300046615 Bacteria 1007
406 Ga0495635_0439811 3300046663 Bacteria 863
407 Ga0495635_0857565 3300046663 Bacteria 583
408 Ga0495660_0397911 3300046810 Bacteria 604
409 Ga0496106_1397288 3300048909 Bacteria 541
410 Ga0496108_0711122 3300048911 Bacteria 871
411 Ga0496109_0581114 3300048912 Bacteria 1056
412 Ga0496110_0588068 3300048913 Bacteria 1010
413 Ga0496110_0747461 3300048913 Bacteria 881
414 Ga0496110_0976356 3300048913 Bacteria 754
415 Ga0496111_0030361 3300048914 Bacteria 3843
416 Ga0496112_1048112 3300048915 Bacteria 734
417 Ga0496113_0407974 3300048916 Bacteria 1091
418 Ga0496114_1036704 3300048917 Bacteria 704
419 Ga0496121_0750305 3300048924 Bacteria 580
420 Ga0501318_040247 3300049534 Bacteria 666
421 Ga0501031_0043083 3300049568 Bacteria 2946
422 Ga0501031_0150236 3300049568 Bacteria 1522
423 Ga0501031_0317843 3300049568 Bacteria 1009
424 Ga0501031_0405267 3300049568 Bacteria 882
425 Ga0501032_0012903 3300049569 Bacteria 5957
426 Ga0501032_0183335 3300049569 Bacteria 1370
427 Ga0501032_0422420 3300049569 Bacteria 855
428 Ga0501033_0188313 3300049570 Bacteria 1477
429 Ga0501034_0019903 3300049571 Bacteria 6856
430 Ga0501034_0079186 3300049571 Bacteria 3290
431 Ga0501034_0117945 3300049571 Bacteria 2641
432 Ga0501034_0365101 3300049571 Bacteria 1370
433 Ga0501034_0450626 3300049571 Bacteria 1205
434 Ga0501036_0084431 3300049572 Bacteria 2684
435 Ga0501036_0113650 3300049572 Bacteria 2288
436 Ga0501036_0299572 3300049572 Bacteria 1345
437 Ga0501037_0042195 3300049573 Bacteria 3353
438 Ga0501037_0419471 3300049573 Bacteria 916
439 Ga0501038_0005317 3300049574 Bacteria 11963
440 Ga0501038_0288140 3300049574 Bacteria 1291
441 Ga0501039_0029922 3300049575 Bacteria 4196
442 Ga0501039_0113922 3300049575 Bacteria 2115
443 Ga0501040_0054924 3300049576 Bacteria 2731
444 Ga0501040_0360887 3300049576 Bacteria 1041
445 Ga0501041_0057611 3300049577 Bacteria 2376
446 Ga0501041_0550298 3300049577 Bacteria 735
447 Ga0501042_0027727 3300049578 Bacteria 3984
448 Ga0501043_0247897 3300049579 Bacteria 1372
449 Ga0501043_0514524 3300049579 Bacteria 893
450 Ga0501046_0012563 3300049580 Bacteria 7201
451 Ga0501047_0414743 3300049581 Bacteria 1178
452 Ga0501047_0532035 3300049581 Bacteria 1000
453 Ga0501048_0022728 3300049582 Bacteria 4584
454 Ga0501048_0122592 3300049582 Bacteria 1837
455 Ga0501048_0474318 3300049582 Bacteria 897
456 Ga0501067_0015280 3300049583 Bacteria 4249
457 Ga0501068_0010174 3300049584 Bacteria 5279
458 Ga0501068_0179364 3300049584 Bacteria 1339
459 Ga0501069_0030217 3300049585 Bacteria 2975
460 Ga0501070_0012952 3300049586 Bacteria 7028
461 Ga0501070_0266360 3300049586 Bacteria 1400
462 Ga0501071_0202170 3300049587 Bacteria 1493
463 Ga0501071_0408687 3300049587 Bacteria 1037
464 Ga0501071_0480392 3300049587 Bacteria 952
465 Ga0501072_0072326 3300049588 Bacteria 2725
466 Ga0501072_0285750 3300049588 Bacteria 1312
467 Ga0501072_0485478 3300049588 Bacteria 977
468 Ga0501073_0017201 3300049589 Bacteria 5237
469 Ga0501074_0073278 3300049590 Bacteria 2460
470 Ga0501074_0768392 3300049590 Bacteria 679
471 Ga0501075_0344151 3300049591 Bacteria 1136
472 Ga0501076_0283347 3300049592 Bacteria 1358
473 Ga0501076_0441802 3300049592 Bacteria 1071
474 Ga0501079_0441773 3300049741 Bacteria 1021
475 Ga0501079_1255267 3300049741 Bacteria 583
476 Ga0501080_0006668 3300049742 Bacteria 10390
477 Ga0501081_0128181 3300049743 Bacteria 1811
478 Ga0501083_0056755 3300049744 Bacteria 2623
479 Ga0501083_0614401 3300049744 Bacteria 707
480 Ga0501035_0164182 3300049822 Bacteria 1921
481 Ga0501035_0308537 3300049822 Bacteria 1332
482 Ga0501044_0017065 3300049823 Bacteria 7790
483 Ga0501044_0018196 3300049823 Bacteria 7537
484 Ga0501045_0175664 3300049824 Bacteria 1596
485 nmdc:mga03n38_202586_c1 3300050490 Bacteria 1028
486 nmdc:mga03n38_244047_c1 3300050490 Bacteria 946
487 nmdc:mga03n38_898679_c1 3300050490 Bacteria 520
488 nmdc:mga00v17_17205_c1 3300050491 Bacteria 4087
489 nmdc:mga00v17_404058_c1 3300050491 Bacteria 888
490 nmdc:mga00v17_701775_c1 3300050491 Bacteria 649
491 nmdc:mga00v17_870247_c1 3300050491 Bacteria 572
492 nmdc:mga00v17_88683_c1 3300050491 Bacteria 1940
493 nmdc:mga0yw44_1037902_c1 3300050492 Bacteria 555
494 nmdc:mga0yw44_1232332_c1 3300050492 Bacteria 505
495 nmdc:mga0yw44_1771_c2 3300050492 Bacteria 2659
496 nmdc:mga0yw44_254107_c1 3300050492 Bacteria 1170
497 nmdc:mga0yw44_309615_c1 3300050492 Bacteria 1059
498 nmdc:mga0yw44_511317_c1 3300050492 Bacteria 815
499 nmdc:mga0yw44_5541_c1 3300050492 Bacteria 5986
500 nmdc:mga0yw44_651425_c1 3300050492 Bacteria 716
501 nmdc:mga0yw44_79916_c1 3300050492 Bacteria 2047
502 nmdc:mga0yw44_845235_c1 3300050492 Bacteria 621
503 nmdc:mga06z11_260595_c1 3300050494 Bacteria 1023
504 nmdc:mga06z11_866135_c1 3300050494 Bacteria 550
505 nmdc:mga04h51_28736_c1 3300050495 Bacteria 1736
506 nmdc:mga05p37_1104929_c1 3300050507 Bacteria 830
507 nmdc:mga05p37_348027_c1 3300050507 Bacteria 1745
508 nmdc:mga05p37_633944_c1 3300050507 Bacteria 1200
509 nmdc:mga09592_1331123_c1 3300050508 Bacteria 589
510 nmdc:mga0qj67_3007_c1 3300050509 Bacteria 12110
511 nmdc:mga0qj67_797066_c1 3300050509 Bacteria 748
512 nmdc:mga06r32_1680691_c1 3300050510 Bacteria 572
513 nmdc:mga06r32_2025040_c1 3300050510 Bacteria 509
514 nmdc:mga08y16_1339590_c1 3300050511 Bacteria 681
515 nmdc:mga08y16_300647_c1 3300050511 Bacteria 1654
516 nmdc:mga08y16_302974_c1 3300050511 Bacteria 1647
517 nmdc:mga08y16_718055_c1 3300050511 Bacteria 998
518 Ga0500561_0267744 3300053137 Bacteria 544
519 Ga0501084_0014283 3300054114 Bacteria 6577
520 Ga0501084_0129317 3300054114 Bacteria 2126
521 Ga0501084_1084750 3300054114 Bacteria 672
522 Ga0587066_077221 3300059490 Bacteria 714
523 Ga0587080_079972 3300059503 Bacteria 669
524 Ga0587090_095192 3300059510 Bacteria 615
525 Ga0501082_0062630 3300060353 Bacteria 3202
526 Ga0501082_1592978 3300060353 Bacteria 570
527 Ga0466962_0398171 3300061719 Bacteria 689
528 Ga0530510_0008772 3300061734 Bacteria 7072
529 Ga0530510_0074373 3300061734 Bacteria 2467
530 Ga0530510_0160304 3300061734 Bacteria 1664
531 Ga0495629_0118934
532 LJQas_1037101
533 JGI24744J21845_10083405
534 Ga0006759J45824_1004196
535 JGI25407J50210_10004778
536 Ga0007429J51699_1014583
537 Ga0070658_10174928
538 Ga0070658_10363040
539 Ga0070658_10800587
540 Ga0070683_100727288
541 Ga0070683_101590100
542 Ga0070670_101106263
543 Ga0068869_101250624
544 Ga0068869_101868030
545 Ga0070666_10703468
546 Ga0070680_100313590
547 Ga0070682_100022138
548 Ga0070682_101083431
549 Ga0070682_101339471
550 Ga0070682_101534438
551 Ga0068868_100017424
552 Ga0068868_100263624
553 Ga0068868_101546729
554 Ga0070660_100006317
555 Ga0070660_100015694
556 Ga0070689_100198401
557 Ga0070689_100872443
558 Ga0070691_10434368
559 Ga0070661_101481820
560 Ga0070692_10745089
561 Ga0070668_100077172
562 Ga0070669_100047118
563 Ga0070675_100185090
564 Ga0070671_100534800
565 Ga0070671_100671869
566 Ga0070674_100095597
567 Ga0070674_100484987
568 Ga0070673_100232944
569 Ga0070673_102150828
570 Ga0070673_102384926
571 Ga0070688_100844709
572 Ga0070688_101419495
573 Ga0070688_101465700
574 Ga0070659_100295248
575 Ga0070659_100376889
576 Ga0070659_100722949
577 Ga0070659_101154166
578 Ga0070667_100302560
579 Ga0070709_10206151
580 Ga0070714_102023770
581 Ga0070701_10444509
582 Ga0070711_100073356
583 Ga0070700_100259979
584 Ga0070694_100569131
585 Ga0070708_101169797
586 Ga0070663_100969870
587 Ga0070678_100012624
588 Ga0070662_100488728
589 Ga0070681_10514571
590 Ga0070681_10581597
591 Ga0068867_100073938
592 Ga0070685_10175934
593 Ga0070685_10483645
594 Ga0070707_101079447
595 Ga0070679_100333584
596 Ga0070679_100634904
597 Ga0070684_100323517
598 Ga0070684_100334600
599 Ga0070684_100815227
600 Ga0070684_101062382
601 Ga0068853_102199284
602 Ga0070672_100498071
603 Ga0070672_101090656
604 Ga0070686_100084372
605 Ga0070695_100014781
606 Ga0070696_100448836
607 Ga0070693_100559504
608 Ga0070665_101463719
609 Ga0070704_100266671
610 Ga0070704_100879250
611 Ga0070664_100721801
612 Ga0070664_100974536
613 Ga0070664_101360234
614 Ga0070664_102205642
615 Ga0068857_100903238
616 Ga0068856_100271458
617 Ga0068856_100386514
618 Ga0068856_100605057
619 Ga0070702_100356713
620 Ga0070702_101038457
621 Ga0068852_100202527
622 Ga0068852_100547009
623 Ga0068852_101050165
624 Ga0068852_102622018
625 Ga0068859_100796466
626 Ga0068864_102386805
627 Ga0068866_10790632
628 Ga0068861_100233905
629 Ga0068861_101254354
630 Ga0068851_10744982
631 Ga0068870_10407006
632 Ga0068863_102120698
633 Ga0068858_100741211
634 Ga0068858_101901532
635 Ga0081455_10011226
636 Ga0081455_10089611
637 Ga0081455_10343523
638 Ga0081538_10000610
639 Ga0081540_1131761
640 Ga0081539_10473140
641 Ga0075365_10007202
642 Ga0075365_10010327
643 Ga0075365_10014205
644 Ga0075365_10059382
645 Ga0075365_10176051
646 Ga0075365_10323698
647 Ga0075365_10389590
648 Ga0075365_10485647
649 Ga0075365_10675356
650 Ga0075368_10442991
651 Ga0075363_100218787
652 Ga0075363_100536273
653 Ga0075363_100611594
654 Ga0075363_100625872
655 Ga0075363_100634124
656 Ga0075364_10044358
657 Ga0075364_10060617
658 Ga0070715_10221088
659 Ga0070716_100152363
660 Ga0070712_100009086
661 Ga0075367_10155472
662 Ga0075367_10253126
663 Ga0075367_10645251
664 Ga0097621_100993268
665 Ga0097621_101538541
666 Ga0097621_101801463
667 Ga0075370_10451130
668 Ga0075428_100198182
669 Ga0075428_100619745
670 Ga0075428_101707350
671 Ga0075430_100244462
672 Ga0075430_100733570
673 Ga0075431_100695307
674 Ga0075431_102134916
675 Ga0075433_10400577
676 Ga0075434_101185187
677 Ga0068865_100056858
678 Ga0068865_100343719
679 Ga0068865_101176865
680 Ga0097620_100796616
681 Ga0105251_10550937
682 Ga0111539_10311389
683 Ga0111539_10369343
684 Ga0111539_11390295
685 Ga0105245_10209665
686 Ga0105245_11161853
687 Ga0105245_12112807
688 Ga0105247_11409325
689 Ga0114129_10147408
690 Ga0114129_10231482
691 Ga0114129_10662233
692 Ga0105243_10533119
693 Ga0105243_10891063
694 Ga0105243_11603859
695 Ga0105241_10913276
696 Ga0105242_10307171
697 Ga0105242_11088765
698 Ga0105242_12622682
699 Ga0105248_12373447
700 Ga0105237_11589725
701 Ga0105238_10757636
702 Ga0105238_12822826
703 Ga0105249_10600280
704 Ga0105239_10103636
705 Ga0105239_10690347
706 Ga0105246_11098740
707 Ga0157371_11086725
708 Ga0157370_11942165
709 Ga0157369_10229710
710 Ga0157369_10331916
711 Ga0157374_11330401
712 Ga0157372_10412338
713 Ga0157372_10580039
714 Ga0157372_12254345
715 Ga0157375_11022664
716 Ga0157375_11792485
717 Ga0163163_10800107
718 Ga0163163_11473612
719 Ga0163163_12111802
720 Ga0157380_11506942
721 Ga0157380_12057321
722 Ga0157377_10365008
723 Ga0157377_10512430
724 Ga0157377_10952049
725 Ga0157379_11345576
726 Ga0157376_10676449
727 Ga0157376_10886178
728 Ga0184600_114130
729 Ga0206356_11117895
730 Ga0206356_11274384
731 Ga0206353_11158706
732 Ga0213876_10023738
733 Ga0213875_10006453
734 Ga0224712_10307905
735 Ga0207426_1035294
736 Ga0207642_11049160
737 Ga0207688_10067966
738 Ga0207688_10676901
739 Ga0207685_10222277
740 Ga0207699_10286372
741 Ga0207643_10053982
742 Ga0207643_10732143
743 Ga0207643_10778360
744 Ga0207705_10111374
745 Ga0207705_11008515
746 Ga0207654_11363085
747 Ga0207707_10073128
748 Ga0207671_11402976
749 Ga0207693_10010485
750 Ga0207663_10091671
751 Ga0207657_10018613
752 Ga0207657_10135011
753 Ga0207657_10212945
754 Ga0207657_11189502
755 Ga0207649_11579520
756 Ga0207649_11586055
757 Ga0207652_10457190
758 Ga0207652_11492671
759 Ga0207681_10008549
760 Ga0207694_11085949
761 Ga0207694_11513209
762 Ga0207650_10278600
763 Ga0207650_10321709
764 Ga0207687_10013152
765 Ga0207687_10032700
766 Ga0207687_11207964
767 Ga0207664_11486039
768 Ga0207644_10527643
769 Ga0207690_10051395
770 Ga0207690_10405609
771 Ga0207690_10441991
772 Ga0207690_10639402
773 Ga0207706_10474578
774 Ga0207686_10448717
775 Ga0207686_10633490
776 Ga0207686_10985266
777 Ga0207686_11440570
778 Ga0207709_10039132
779 Ga0207709_10831194
780 Ga0207670_10884923
781 Ga0207669_10147428
782 Ga0207669_10858721
783 Ga0207704_10503557
784 Ga0207704_11243111
785 Ga0207704_11288439
786 Ga0207665_10034952
787 Ga0207691_11741628
788 Ga0207711_10820491
789 Ga0207661_10118615
790 Ga0207661_10869255
791 Ga0207679_10200308
792 Ga0207679_10413735
793 Ga0207679_10493715
794 Ga0207679_11222570
795 Ga0207651_10965129
796 Ga0207651_11024613
797 Ga0207712_10454787
798 Ga0207712_11083032
799 Ga0207668_10182428
800 Ga0207640_10123999
801 Ga0207640_10310973
802 Ga0207658_10362959
803 Ga0207677_10014434
804 Ga0207677_10574220
805 Ga0207677_10821929
806 Ga0207677_12265731
807 Ga0207703_10315584
808 Ga0207703_11065673
809 Ga0207678_11279843
810 Ga0207708_10099028
811 Ga0207708_10184805
812 Ga0207708_10534425
813 Ga0207702_10217852
814 Ga0207702_10442610
815 Ga0207648_10570444
816 Ga0207648_11549686
817 Ga0207676_11952207
818 Ga0207674_11017620
819 Ga0207675_100316715
820 Ga0207675_100814376
821 Ga0207683_10007686
822 Ga0207683_10592895
823 Ga0207683_11532715
824 Ga0207698_10299940
825 Ga0207698_10549857
826 Ga0207698_11238120
827 Ga0209813_10324284
828 Ga0207428_10069206
829 Ga0207428_10515916
830 Ga0207428_11287658
831 Ga0268266_10218801
832 Ga0268266_11467220
833 Ga0268265_10627079
834 Ga0268265_11298215
835 Ga0265777_105592
836 Ga0307408_100102612
837 Ga0307408_100526363
838 Ga0307408_102452080
839 Ga0316578_10148741
840 Ga0307405_10298560
841 Ga0307405_10408665
842 Ga0307413_10172175
843 Ga0307413_10329314
844 Ga0307413_10751786
845 Ga0307413_10814427
846 Ga0307413_11247956
847 Ga0307410_10172919
848 Ga0307406_11076717
849 Ga0307407_10116494
850 Ga0307407_10237167
851 Ga0307407_11007643
852 Ga0307412_11499562
853 Ga0307409_100001096
854 Ga0307409_101264488
855 Ga0307416_100032254
856 Ga0307416_100040186
857 Ga0307416_100124927
858 Ga0307416_100618563
859 Ga0307416_102144870
860 Ga0307416_103224773
861 Ga0307414_10050153
862 Ga0307414_11905826
863 Ga0307414_11960707
864 Ga0307411_11561840
865 Ga0307415_100017991
866 Ga0307415_100160383
867 Ga0307415_100259292
868 Ga0307415_100541103
869 Ga0373940_0274284
870 Ga0373941_0261944
871 Ga0373943_0104036
872 Ga0316574_0068796
873 Ga0373933_0718986
874 Ga0316582_0788848
875 Ga0395898_0433237
876 Ga0395905_1901163
877 Ga0436364_0045049
878 Ga0395901_0520105
879 Ga0395901_0638029
880 Ga0395901_1279569
881 Ga0395901_1470194
882 Ga0436365_0283725
883 Ga0436365_0696518
884 Ga0436361_0428821
885 Ga0436363_1348304
886 Ga0436362_0112354
887 Ga0451787_770723
888 Ga0451791_1610830
889 Ga0451791_1766138
890 Ga0451793_0147801
891 Ga0451797_0608078
892 Ga0451798_0076475
893 Ga0451800_0049861
894 Ga0451802_1103034
895 Ga0451804_1114275
896 Ga0451837_0879342
897 Ga0451837_1616205
898 Ga0451839_1281219
899 Ga0451843_0866541
900 Ga0466972_0189947
901 Ga0466972_0190729
902 Ga0466965_0230057
903 Ga0466963_0167124
904 Ga0466963_0201054
905 Ga0466963_0520276
906 Ga0466963_0985884
907 Ga0466964_0107671
908 Ga0466957_1392643
909 Ga0466960_0000018
910 Ga0466960_0139953
911 Ga0466960_0258806
912 Ga0466960_0319861
913 Ga0466958_0508817
914 Ga0466967_0211211
915 Ga0466967_1167640
916 Ga0466967_1327341
917 Ga0466967_1329029
918 Ga0466967_1371626
919 Ga0466967_1572706
920 Ga0466967_1704397
921 Ga0495638_0024483
922 Ga0495641_0561075
923 Ga0495650_0000054
924 Ga0495582_0542839
925 Ga0495584_0249071
926 Ga0495584_0740679
927 Ga0495585_0374846
928 Ga0495596_0074284
929 Ga0495596_0283333
930 Ga0495596_0286129
931 Ga0495630_1359347
932 Ga0495644_0220362
933 Ga0495609_0441851
934 Ga0495667_0666756
935 Ga0495656_0193022
936 Ga0495635_0439811
937 Ga0495635_0857565
938 Ga0495660_0397911
939 Ga0496106_1397288
940 Ga0496108_0711122
941 Ga0496109_0581114
942 Ga0496110_0588068
943 Ga0496110_0747461
944 Ga0496110_0976356
945 Ga0496111_0030361
946 Ga0496112_1048112
947 Ga0496113_0407974
948 Ga0496114_1036704
949 Ga0496121_0750305
950 Ga0501318_040247
951 Ga0501031_0043083
952 Ga0501031_0150236
953 Ga0501031_0317843
954 Ga0501031_0405267
955 Ga0501032_0012903
956 Ga0501032_0183335
957 Ga0501032_0422420
958 Ga0501033_0188313
959 Ga0501034_0019903
960 Ga0501034_0079186
961 Ga0501034_0117945
962 Ga0501034_0365101
963 Ga0501034_0450626
964 Ga0501036_0084431
965 Ga0501036_0113650
966 Ga0501036_0299572
967 Ga0501037_0042195
968 Ga0501037_0419471
969 Ga0501038_0005317
970 Ga0501038_0288140
971 Ga0501039_0029922
972 Ga0501039_0113922
973 Ga0501040_0054924
974 Ga0501040_0360887
975 Ga0501041_0057611
976 Ga0501041_0550298
977 Ga0501042_0027727
978 Ga0501043_0247897
979 Ga0501043_0514524
980 Ga0501046_0012563
981 Ga0501047_0414743
982 Ga0501047_0532035
983 Ga0501048_0022728
984 Ga0501048_0122592
985 Ga0501048_0474318
986 Ga0501067_0015280
987 Ga0501068_0010174
988 Ga0501068_0179364
989 Ga0501069_0030217
990 Ga0501070_0012952
991 Ga0501070_0266360
992 Ga0501071_0202170
993 Ga0501071_0408687
994 Ga0501071_0480392
995 Ga0501072_0072326
996 Ga0501072_0285750
997 Ga0501072_0485478
998 Ga0501073_0017201
999 Ga0501074_0073278
1000 Ga0501074_0768392
1001 Ga0501075_0344151
1002 Ga0501076_0283347
1003 Ga0501076_0441802
1004 Ga0501079_0441773
1005 Ga0501079_1255267
1006 Ga0501080_0006668
1007 Ga0501081_0128181
1008 Ga0501083_0056755
1009 Ga0501083_0614401
1010 Ga0501035_0164182
1011 Ga0501035_0308537
1012 Ga0501044_0017065
1013 Ga0501044_0018196
1014 Ga0501045_0175664
1015 nmdc:mga03n38_202586_c1
1016 nmdc:mga03n38_244047_c1
1017 nmdc:mga03n38_898679_c1
1018 nmdc:mga00v17_17205_c1
1019 nmdc:mga00v17_404058_c1
1020 nmdc:mga00v17_701775_c1
1021 nmdc:mga00v17_870247_c1
1022 nmdc:mga00v17_88683_c1
1023 nmdc:mga0yw44_1037902_c1
1024 nmdc:mga0yw44_1232332_c1
1025 nmdc:mga0yw44_1771_c2
1026 nmdc:mga0yw44_254107_c1
1027 nmdc:mga0yw44_309615_c1
1028 nmdc:mga0yw44_511317_c1
1029 nmdc:mga0yw44_5541_c1
1030 nmdc:mga0yw44_651425_c1
1031 nmdc:mga0yw44_79916_c1
1032 nmdc:mga0yw44_845235_c1
1033 nmdc:mga06z11_260595_c1
1034 nmdc:mga06z11_866135_c1
1035 nmdc:mga04h51_28736_c1
1036 nmdc:mga05p37_1104929_c1
1037 nmdc:mga05p37_348027_c1
1038 nmdc:mga05p37_633944_c1
1039 nmdc:mga09592_1331123_c1
1040 nmdc:mga0qj67_3007_c1
1041 nmdc:mga0qj67_797066_c1
1042 nmdc:mga06r32_1680691_c1
1043 nmdc:mga06r32_2025040_c1
1044 nmdc:mga08y16_1339590_c1
1045 nmdc:mga08y16_300647_c1
1046 nmdc:mga08y16_302974_c1
1047 nmdc:mga08y16_718055_c1
1048 Ga0500561_0267744
1049 Ga0501084_0014283
1050 Ga0501084_0129317
1051 Ga0501084_1084750
1052 Ga0587066_077221
1053 Ga0587080_079972
1054 Ga0587090_095192
1055 Ga0501082_0062630
1056 Ga0501082_1592978
1057 Ga0466962_0398171
1058 Ga0530510_0008772
1059 Ga0530510_0074373
1060 Ga0530510_0160304

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

16

81

0.98

PF08206

OB_RNB

Ribonuclease B OB domain

18

51

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9412 2 67
8h1i-assembly1.cif.gz_B crystal structure of plygrcs, a bacteriophage endolysin in complex with cold shock protein c 0.941 2 67
6ktc-assembly1.cif.gz_A crystal structure of ybx1 csd with m5c rna 0.937 2 65
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9324 1 67
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9308 1 67
ID Description Score Start End Superfamily
af_P0A976_2_68_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.97 2 65 2.40.50.140
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9374 2 65 2.40.50.140
2haxB02 Special;Other non-globular;Rhinovirus 14, subunit 4; 0.929 41 67 6.20.370.130
2haxA02 Special;Other non-globular;Rhinovirus 14, subunit 4; 0.928 45 67 6.20.370.130
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9231 2 65 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7X8UUM1-F1-model_v4 Cold shock domain-containing protein 0.9883 1 67 GO:0003676
GO:0005737
AF-A0A7K4CUT4-F1-model_v4 DEAD/DEAH box helicase 0.984 2 67 GO:0003676
GO:0003724
GO:0005524
GO:0005829
GO:0016787
GO:0071103
GO:0140097
AF-A0A0D8TVC7-F1-model_v4 deleted 0.9837 3 67
AF-A0A086E3S8-F1-model_v4 deleted 0.9756 2 64
AF-A0A7X8UUM1-F1-model_v4 Cold shock domain-containing protein 0.9739 1 67 GO:0003676
GO:0005737

Map