F459906
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 530 | 278 | 501 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10219407|Ga0070658_102194072 |
| Length | 296 |
| Sequence | MRDHYQRPALASRAFFCARPSRACYPMPMRLRVCTWNVNSVRLRAEQVARFVRDHAPDVLCMQEIKCQNGEFPAEAFVEMGLPHLRIAGQKGWHGVAIASRLPIEDAPHLDICREKHARCVSGIVAGVEIQNFYIPAGGDLPDRELNPKFDHKLDFYEKLTAEMTRRDPKAPLIVTGDLNVAPGEFDVWNHRYMSKIVSHTPVEIEAFARLMASLGFTNILREAVPEPEKLASWWSYRAQDFRQSNRGLLLDHLLLSPGLREAAFRLGAPAARVHDDVREWEKPSDHAPVSVDLGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 2 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 3 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 4 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 5 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 6 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 7 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 8 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 9 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 10 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 11 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 12 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 13 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 14 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 15 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 16 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 17 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 18 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 19 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 20 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 21 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 22 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 23 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 24 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 25 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 26 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 27 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 28 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 29 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 87 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 135 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 136 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 141 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 142 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 144 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 145 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 146 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 148 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 155 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 158 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 159 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 160 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 161 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 164 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 215 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 216 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 219 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 220 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 221 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 232 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 233 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 234 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 235 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 236 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 237 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 238 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 239 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 240 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 241 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 242 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 243 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 244 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 245 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 246 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 247 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 248 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 249 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 251 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 252 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 253 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 254 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 255 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 256 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 257 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 258 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 259 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 260 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 261 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 262 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 263 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 264 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 265 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 266 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 267 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 268 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 269 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 270 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 271 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 272 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 274 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 275 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 276 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 277 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 278 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.53 |
| Metatranscriptomes | 0 |
| Isolates | 5.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.08 |
| Nodule | 0 |
| Rhizoplane | 2.64 |
| Rhizosphere | 65.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10042095 | 3300003320 | Bacteria | 1315 |
| 2 | Ga0055524_1011000 | 3300003775 | Bacteria | 3563 |
| 3 | Ga0055536_1003526 | 3300003781 | Bacteria | 8378 |
| 4 | Ga0055536_1008141 | 3300003781 | Bacteria | 4564 |
| 5 | Ga0055536_1009453 | 3300003781 | Bacteria | 4032 |
| 6 | Ga0055528_1015927 | 3300003790 | Bacteria | 2687 |
| 7 | Ga0055530_10000313 | 3300003791 | Bacteria | 44170 |
| 8 | Ga0055530_10002661 | 3300003791 | Bacteria | 11168 |
| 9 | Ga0055530_10006718 | 3300003791 | Bacteria | 5042 |
| 10 | Ga0055531_10002220 | 3300003794 | Bacteria | 13181 |
| 11 | Ga0055531_10004699 | 3300003794 | Bacteria | 8176 |
| 12 | Ga0065165_1000583 | 3300005262 | Bacteria | 53842 |
| 13 | Ga0070658_10219407 | 3300005327 | Bacteria | 1608 |
| 14 | Ga0070670_100000007 | 3300005331 | Bacteria | 318672 |
| 15 | Ga0070666_10039451 | 3300005335 | Bacteria | 3148 |
| 16 | Ga0070666_10071226 | 3300005335 | Bacteria | 2366 |
| 17 | Ga0070666_10288247 | 3300005335 | Bacteria | 1168 |
| 18 | Ga0070680_100169189 | 3300005336 | Bacteria | 1838 |
| 19 | Ga0070668_100000272 | 3300005347 | Bacteria | 34235 |
| 20 | Ga0070668_100005382 | 3300005347 | Bacteria | 9498 |
| 21 | Ga0070668_100010729 | 3300005347 | Bacteria | 6813 |
| 22 | Ga0070668_100044636 | 3300005347 | Bacteria | 3400 |
| 23 | Ga0070668_100117006 | 3300005347 | Bacteria | 2126 |
| 24 | Ga0070669_100001157 | 3300005353 | Bacteria | 19280 |
| 25 | Ga0070669_100009792 | 3300005353 | Bacteria | 6826 |
| 26 | Ga0070671_100001426 | 3300005355 | Bacteria | 17856 |
| 27 | Ga0070671_100168959 | 3300005355 | Bacteria | 1849 |
| 28 | Ga0070659_100002510 | 3300005366 | Bacteria | 13029 |
| 29 | Ga0070659_100012009 | 3300005366 | Bacteria | 6411 |
| 30 | Ga0070659_100041439 | 3300005366 | Bacteria | 3599 |
| 31 | Ga0070667_100000291 | 3300005367 | Bacteria | 56512 |
| 32 | Ga0070667_100004267 | 3300005367 | Bacteria | 12069 |
| 33 | Ga0070667_100006296 | 3300005367 | Bacteria | 9865 |
| 34 | Ga0070667_100010607 | 3300005367 | Bacteria | 7608 |
| 35 | Ga0070681_10042288 | 3300005458 | Bacteria | 4566 |
| 36 | Ga0070681_10156607 | 3300005458 | Bacteria | 2202 |
| 37 | Ga0070679_100141555 | 3300005530 | Bacteria | 2384 |
| 38 | Ga0068853_100029369 | 3300005539 | Bacteria | 4634 |
| 39 | Ga0068853_100179815 | 3300005539 | Bacteria | 1918 |
| 40 | Ga0070665_100000395 | 3300005548 | Bacteria | 64323 |
| 41 | Ga0070665_100002782 | 3300005548 | Bacteria | 18967 |
| 42 | Ga0070665_100017425 | 3300005548 | Bacteria | 7211 |
| 43 | Ga0070665_100155747 | 3300005548 | Bacteria | 2287 |
| 44 | Ga0068855_100034109 | 3300005563 | Bacteria | 6072 |
| 45 | Ga0068855_100156944 | 3300005563 | Bacteria | 2585 |
| 46 | Ga0068855_100394587 | 3300005563 | Bacteria | 1517 |
| 47 | Ga0068855_100422748 | 3300005563 | Bacteria | 1457 |
| 48 | Ga0070664_100011039 | 3300005564 | Bacteria | 7325 |
| 49 | Ga0070664_100097198 | 3300005564 | Bacteria | 2556 |
| 50 | Ga0068854_100311900 | 3300005578 | Bacteria | 1276 |
| 51 | Ga0068856_100096630 | 3300005614 | Bacteria | 2943 |
| 52 | Ga0068856_100726928 | 3300005614 | Bacteria | 1013 |
| 53 | Ga0068852_100258988 | 3300005616 | Bacteria | 1670 |
| 54 | Ga0068859_100001326 | 3300005617 | Bacteria | 25257 |
| 55 | Ga0068859_100001699 | 3300005617 | Bacteria | 22416 |
| 56 | Ga0068864_100002407 | 3300005618 | Bacteria | 15450 |
| 57 | Ga0068864_100003084 | 3300005618 | Bacteria | 13759 |
| 58 | Ga0068864_100086573 | 3300005618 | Bacteria | 2757 |
| 59 | Ga0068864_100167963 | 3300005618 | Bacteria | 1999 |
| 60 | Ga0068864_100365885 | 3300005618 | Bacteria | 1364 |
| 61 | Ga0068863_100000262 | 3300005841 | Bacteria | 55027 |
| 62 | Ga0068863_100003500 | 3300005841 | Bacteria | 15493 |
| 63 | Ga0068863_100003720 | 3300005841 | Bacteria | 15086 |
| 64 | Ga0068863_100044605 | 3300005841 | Bacteria | 4208 |
| 65 | Ga0068863_100602868 | 3300005841 | Bacteria | 1087 |
| 66 | Ga0068858_100001577 | 3300005842 | Bacteria | 23351 |
| 67 | Ga0068858_100011317 | 3300005842 | Bacteria | 8428 |
| 68 | Ga0068858_100074394 | 3300005842 | Bacteria | 3154 |
| 69 | Ga0068860_100000047 | 3300005843 | Bacteria | 213287 |
| 70 | Ga0068860_100002126 | 3300005843 | Bacteria | 20896 |
| 71 | Ga0068860_100003451 | 3300005843 | Bacteria | 16259 |
| 72 | Ga0068862_100004496 | 3300005844 | Bacteria | 11756 |
| 73 | Ga0068862_100035969 | 3300005844 | Bacteria | 4195 |
| 74 | Ga0068862_100062514 | 3300005844 | Bacteria | 3202 |
| 75 | Ga0068862_100096486 | 3300005844 | Bacteria | 2581 |
| 76 | Ga0075364_10000600 | 3300006051 | Bacteria | 18642 |
| 77 | Ga0075367_10053550 | 3300006178 | Bacteria | 2391 |
| 78 | Ga0075366_10040517 | 3300006195 | Bacteria | 2755 |
| 79 | Ga0075370_10027305 | 3300006353 | Bacteria | 3166 |
| 80 | Ga0097620_100001326 | 3300006931 | Bacteria | 25257 |
| 81 | Ga0097620_100001698 | 3300006931 | Bacteria | 22416 |
| 82 | Ga0105250_10048171 | 3300009092 | Bacteria | 1710 |
| 83 | Ga0105240_10003418 | 3300009093 | Bacteria | 24667 |
| 84 | Ga0105240_10004843 | 3300009093 | Bacteria | 20283 |
| 85 | Ga0105240_10012284 | 3300009093 | Bacteria | 11833 |
| 86 | Ga0105240_10100147 | 3300009093 | Bacteria | 3526 |
| 87 | Ga0105240_10163340 | 3300009093 | Bacteria | 2643 |
| 88 | Ga0105240_10864653 | 3300009093 | Bacteria | 975 |
| 89 | Ga0105245_10146375 | 3300009098 | Bacteria | 2229 |
| 90 | Ga0105247_10058669 | 3300009101 | Bacteria | 2381 |
| 91 | Ga0105248_10000746 | 3300009177 | Bacteria | 36566 |
| 92 | Ga0105248_10001254 | 3300009177 | Bacteria | 28372 |
| 93 | Ga0105248_10001644 | 3300009177 | Bacteria | 24861 |
| 94 | Ga0105248_10010845 | 3300009177 | Bacteria | 10062 |
| 95 | Ga0105248_10064392 | 3300009177 | Bacteria | 4116 |
| 96 | Ga0105248_10363005 | 3300009177 | Bacteria | 1631 |
| 97 | Ga0105248_10571402 | 3300009177 | Bacteria | 1276 |
| 98 | Ga0105237_10246297 | 3300009545 | Bacteria | 1789 |
| 99 | Ga0105238_10079187 | 3300009551 | Bacteria | 3276 |
| 100 | Ga0105238_10107149 | 3300009551 | Bacteria | 2776 |
| 101 | Ga0105238_10554103 | 3300009551 | Bacteria | 1154 |
| 102 | Ga0105238_10700525 | 3300009551 | Bacteria | 1025 |
| 103 | Ga0105249_10002418 | 3300009553 | Bacteria | 16212 |
| 104 | Ga0105249_10284569 | 3300009553 | Bacteria | 1652 |
| 105 | Ga0105249_10444750 | 3300009553 | Bacteria | 1334 |
| 106 | Ga0105249_10578067 | 3300009553 | Bacteria | 1176 |
| 107 | Ga0105239_10071623 | 3300010375 | Bacteria | 3808 |
| 108 | Ga0105239_10119796 | 3300010375 | Bacteria | 2922 |
| 109 | Ga0157373_10000879 | 3300013100 | Bacteria | 23263 |
| 110 | Ga0157373_10002637 | 3300013100 | Bacteria | 13606 |
| 111 | Ga0157371_10007280 | 3300013102 | Bacteria | 8989 |
| 112 | Ga0157370_10019913 | 3300013104 | Bacteria | 6713 |
| 113 | Ga0157370_10185989 | 3300013104 | Bacteria | 1929 |
| 114 | Ga0157369_10020217 | 3300013105 | Bacteria | 7444 |
| 115 | Ga0157369_10170137 | 3300013105 | Bacteria | 2296 |
| 116 | Ga0157369_10709319 | 3300013105 | Bacteria | 1036 |
| 117 | Ga0163162_10153192 | 3300013306 | Bacteria | 2424 |
| 118 | Ga0163162_11025038 | 3300013306 | Bacteria | 933 |
| 119 | Ga0157375_10240189 | 3300013308 | Bacteria | 1971 |
| 120 | Ga0163163_10008395 | 3300014325 | Bacteria | 9173 |
| 121 | Ga0163163_10041831 | 3300014325 | Bacteria | 4484 |
| 122 | Ga0163163_10092487 | 3300014325 | Bacteria | 3040 |
| 123 | Ga0163163_10145338 | 3300014325 | Bacteria | 2415 |
| 124 | Ga0163163_10163368 | 3300014325 | Bacteria | 2273 |
| 125 | Ga0163163_10179468 | 3300014325 | Bacteria | 2164 |
| 126 | Ga0163163_10572141 | 3300014325 | Bacteria | 1193 |
| 127 | Ga0157377_10192011 | 3300014745 | Bacteria | 1291 |
| 128 | Ga0157379_10003580 | 3300014968 | Bacteria | 13164 |
| 129 | Ga0157379_10024480 | 3300014968 | Bacteria | 5359 |
| 130 | Ga0157379_10059719 | 3300014968 | Bacteria | 3410 |
| 131 | Ga0157379_10152607 | 3300014968 | Bacteria | 2084 |
| 132 | Ga0157376_10344179 | 3300014969 | Bacteria | 1425 |
| 133 | Ga0213872_10008803 | 3300021361 | Bacteria | 4871 |
| 134 | Ga0213872_10020485 | 3300021361 | Bacteria | 3048 |
| 135 | Ga0213876_10000081 | 3300021384 | Bacteria | 108997 |
| 136 | Ga0213876_10077415 | 3300021384 | Bacteria | 1757 |
| 137 | Ga0209026_1001196 | 3300025250 | Bacteria | 12024 |
| 138 | Ga0209148_1010595 | 3300025254 | Bacteria | 1742 |
| 139 | Ga0209565_1000090 | 3300025263 | Bacteria | 146540 |
| 140 | Ga0209673_1004907 | 3300025273 | Bacteria | 6967 |
| 141 | Ga0209676_1000140 | 3300025292 | Bacteria | 176735 |
| 142 | Ga0209676_1000257 | 3300025292 | Bacteria | 112662 |
| 143 | Ga0209676_1001860 | 3300025292 | Bacteria | 17366 |
| 144 | Ga0209676_1005474 | 3300025292 | Bacteria | 6626 |
| 145 | Ga0209564_1015123 | 3300025295 | Bacteria | 3159 |
| 146 | Ga0209758_1001380 | 3300025297 | Bacteria | 28958 |
| 147 | Ga0209758_1002555 | 3300025297 | Bacteria | 18327 |
| 148 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 149 | Ga0209050_1003986 | 3300025298 | Bacteria | 10412 |
| 150 | Ga0209050_1006790 | 3300025298 | Bacteria | 6668 |
| 151 | Ga0209050_1012795 | 3300025298 | Bacteria | 3805 |
| 152 | Ga0209256_1008640 | 3300025299 | Bacteria | 4667 |
| 153 | Ga0209256_1026005 | 3300025299 | Bacteria | 1695 |
| 154 | Ga0209256_1027974 | 3300025299 | Bacteria | 1598 |
| 155 | Ga0209051_1000743 | 3300025303 | Bacteria | 35022 |
| 156 | Ga0209257_1000292 | 3300025304 | Bacteria | 110440 |
| 157 | Ga0209257_1000419 | 3300025304 | Bacteria | 81956 |
| 158 | Ga0209257_1000624 | 3300025304 | Bacteria | 56974 |
| 159 | Ga0209257_1003494 | 3300025304 | Bacteria | 13386 |
| 160 | Ga0209257_1006554 | 3300025304 | Bacteria | 7426 |
| 161 | Ga0207680_10020782 | 3300025903 | Bacteria | 3542 |
| 162 | Ga0207680_10024436 | 3300025903 | Bacteria | 3316 |
| 163 | Ga0207680_10041937 | 3300025903 | Bacteria | 2674 |
| 164 | Ga0207705_10001195 | 3300025909 | Bacteria | 21043 |
| 165 | Ga0207707_10237260 | 3300025912 | Bacteria | 1586 |
| 166 | Ga0207695_10000269 | 3300025913 | Bacteria | 130183 |
| 167 | Ga0207695_10000886 | 3300025913 | Bacteria | 54376 |
| 168 | Ga0207695_10010613 | 3300025913 | Bacteria | 11257 |
| 169 | Ga0207695_10057503 | 3300025913 | Bacteria | 4039 |
| 170 | Ga0207695_10090094 | 3300025913 | Bacteria | 3083 |
| 171 | Ga0207695_10291095 | 3300025913 | Bacteria | 1525 |
| 172 | Ga0207671_10171187 | 3300025914 | Bacteria | 1686 |
| 173 | Ga0207660_10007322 | 3300025917 | Bacteria | 7142 |
| 174 | Ga0207657_10000235 | 3300025919 | Bacteria | 58394 |
| 175 | Ga0207652_10083115 | 3300025921 | Bacteria | 2803 |
| 176 | Ga0207681_10014772 | 3300025923 | Bacteria | 4861 |
| 177 | Ga0207681_10094346 | 3300025923 | Bacteria | 2144 |
| 178 | Ga0207694_10020782 | 3300025924 | Bacteria | 4969 |
| 179 | Ga0207694_10065289 | 3300025924 | Bacteria | 2837 |
| 180 | Ga0207694_10084995 | 3300025924 | Bacteria | 2489 |
| 181 | Ga0207650_10000033 | 3300025925 | Bacteria | 226809 |
| 182 | Ga0207650_10025851 | 3300025925 | Bacteria | 4184 |
| 183 | Ga0207687_10125590 | 3300025927 | Bacteria | 1926 |
| 184 | Ga0207644_10003812 | 3300025931 | Bacteria | 9764 |
| 185 | Ga0207644_10016427 | 3300025931 | Bacteria | 4979 |
| 186 | Ga0207644_10288034 | 3300025931 | Bacteria | 1320 |
| 187 | Ga0207690_10000031 | 3300025932 | Bacteria | 154724 |
| 188 | Ga0207690_10026967 | 3300025932 | Bacteria | 3626 |
| 189 | Ga0207690_10072722 | 3300025932 | Bacteria | 2375 |
| 190 | Ga0207706_10044166 | 3300025933 | Bacteria | 3950 |
| 191 | Ga0207686_10190485 | 3300025934 | Bacteria | 1462 |
| 192 | Ga0207711_10000331 | 3300025941 | Bacteria | 50472 |
| 193 | Ga0207711_10000764 | 3300025941 | Bacteria | 31611 |
| 194 | Ga0207711_10005910 | 3300025941 | Bacteria | 10337 |
| 195 | Ga0207711_10099228 | 3300025941 | Bacteria | 2574 |
| 196 | Ga0207711_10247650 | 3300025941 | Bacteria | 1635 |
| 197 | Ga0207679_10073590 | 3300025945 | Bacteria | 2586 |
| 198 | Ga0207679_10083989 | 3300025945 | Bacteria | 2443 |
| 199 | Ga0207667_10006978 | 3300025949 | Bacteria | 13647 |
| 200 | Ga0207667_10009903 | 3300025949 | Bacteria | 11181 |
| 201 | Ga0207667_10009952 | 3300025949 | Bacteria | 11153 |
| 202 | Ga0207667_10125857 | 3300025949 | Bacteria | 2640 |
| 203 | Ga0207667_10164800 | 3300025949 | Bacteria | 2279 |
| 204 | Ga0207667_10367531 | 3300025949 | Bacteria | 1466 |
| 205 | Ga0207712_10001293 | 3300025961 | Bacteria | 17165 |
| 206 | Ga0207712_10383893 | 3300025961 | Bacteria | 1176 |
| 207 | Ga0207668_10000013 | 3300025972 | Bacteria | 167989 |
| 208 | Ga0207668_10001021 | 3300025972 | Bacteria | 16758 |
| 209 | Ga0207668_10002317 | 3300025972 | Bacteria | 11116 |
| 210 | Ga0207668_10006177 | 3300025972 | Bacteria | 7068 |
| 211 | Ga0207668_10018010 | 3300025972 | Bacteria | 4436 |
| 212 | Ga0207668_10288338 | 3300025972 | Bacteria | 1349 |
| 213 | Ga0207658_10000323 | 3300025986 | Bacteria | 48151 |
| 214 | Ga0207658_10002054 | 3300025986 | Bacteria | 15002 |
| 215 | Ga0207658_10055831 | 3300025986 | Bacteria | 2928 |
| 216 | Ga0207658_10093017 | 3300025986 | Bacteria | 2343 |
| 217 | Ga0207658_10318727 | 3300025986 | Bacteria | 1345 |
| 218 | Ga0207703_10000027 | 3300026035 | Bacteria | 209608 |
| 219 | Ga0207703_10006596 | 3300026035 | Bacteria | 9263 |
| 220 | Ga0207703_10007679 | 3300026035 | Bacteria | 8547 |
| 221 | Ga0207703_10038927 | 3300026035 | Bacteria | 3798 |
| 222 | Ga0207703_10132568 | 3300026035 | Bacteria | 2154 |
| 223 | Ga0207639_10034526 | 3300026041 | Bacteria | 3738 |
| 224 | Ga0207702_10144845 | 3300026078 | Bacteria | 2155 |
| 225 | Ga0207702_10344429 | 3300026078 | Bacteria | 1424 |
| 226 | Ga0207702_10575389 | 3300026078 | Bacteria | 1104 |
| 227 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 228 | Ga0207641_10004327 | 3300026088 | Bacteria | 12331 |
| 229 | Ga0207641_10005567 | 3300026088 | Bacteria | 10738 |
| 230 | Ga0207641_10083996 | 3300026088 | Bacteria | 2771 |
| 231 | Ga0207676_10000135 | 3300026095 | Bacteria | 64914 |
| 232 | Ga0207676_10000203 | 3300026095 | Bacteria | 51550 |
| 233 | Ga0207676_10087279 | 3300026095 | Bacteria | 2551 |
| 234 | Ga0207674_10490161 | 3300026116 | Bacteria | 1188 |
| 235 | Ga0209999_1000895 | 3300027543 | Bacteria | 4996 |
| 236 | Ga0209983_1003347 | 3300027665 | Bacteria | 3436 |
| 237 | Ga0209813_10031727 | 3300027866 | Bacteria | 1561 |
| 238 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 239 | Ga0268266_10003032 | 3300028379 | Bacteria | 17238 |
| 240 | Ga0268266_10021376 | 3300028379 | Bacteria | 5512 |
| 241 | Ga0268266_10183772 | 3300028379 | Bacteria | 1905 |
| 242 | Ga0268266_10658341 | 3300028379 | Bacteria | 1008 |
| 243 | Ga0268265_10002897 | 3300028380 | Bacteria | 12605 |
| 244 | Ga0268265_10063519 | 3300028380 | Bacteria | 2841 |
| 245 | Ga0268265_10064068 | 3300028380 | Bacteria | 2830 |
| 246 | Ga0268265_10303534 | 3300028380 | Bacteria | 1438 |
| 247 | Ga0268264_10000113 | 3300028381 | Bacteria | 203262 |
| 248 | Ga0268264_10000205 | 3300028381 | Bacteria | 120743 |
| 249 | Ga0268264_10005653 | 3300028381 | Bacteria | 10596 |
| 250 | Ga0268264_10339598 | 3300028381 | Bacteria | 1426 |
| 251 | Ga0307517_10011953 | 3300028786 | Bacteria | 11980 |
| 252 | Ga0307517_10024392 | 3300028786 | Bacteria | 7456 |
| 253 | Ga0307517_10078738 | 3300028786 | Bacteria | 2846 |
| 254 | Ga0265338_10040359 | 3300028800 | Bacteria | 4385 |
| 255 | Ga0265338_10047904 | 3300028800 | Bacteria | 3896 |
| 256 | Ga0265338_10099439 | 3300028800 | Bacteria | 2376 |
| 257 | Ga0265338_10142249 | 3300028800 | Bacteria | 1877 |
| 258 | Ga0265338_10186049 | 3300028800 | Bacteria | 1579 |
| 259 | Ga0265328_10000370 | 3300031239 | Bacteria | 20970 |
| 260 | Ga0265328_10002129 | 3300031239 | Bacteria | 8937 |
| 261 | Ga0265328_10034348 | 3300031239 | Bacteria | 1878 |
| 262 | Ga0265331_10184466 | 3300031250 | Bacteria | 942 |
| 263 | Ga0265327_10000331 | 3300031251 | Bacteria | 89636 |
| 264 | Ga0265327_10001088 | 3300031251 | Bacteria | 37825 |
| 265 | Ga0265327_10001225 | 3300031251 | Bacteria | 34433 |
| 266 | Ga0307513_10000178 | 3300031456 | Bacteria | 91751 |
| 267 | Ga0307513_10021691 | 3300031456 | Bacteria | 7576 |
| 268 | Ga0307513_10027358 | 3300031456 | Bacteria | 6550 |
| 269 | Ga0265314_10116665 | 3300031711 | Bacteria | 1688 |
| 270 | Ga0307516_10000144 | 3300031730 | Bacteria | 87138 |
| 271 | Ga0307413_10361626 | 3300031824 | Bacteria | 1124 |
| 272 | Ga0307413_10393883 | 3300031824 | Bacteria | 1083 |
| 273 | Ga0307410_10158181 | 3300031852 | Bacteria | 1695 |
| 274 | Ga0307412_10002217 | 3300031911 | Bacteria | 10785 |
| 275 | Ga0307414_10048083 | 3300032004 | Bacteria | 2940 |
| 276 | Ga0307414_10051035 | 3300032004 | Bacteria | 2869 |
| 277 | Ga0307414_10056959 | 3300032004 | Bacteria | 2744 |
| 278 | Ga0307414_10068561 | 3300032004 | Bacteria | 2546 |
| 279 | Ga0307414_10101841 | 3300032004 | Bacteria | 2163 |
| 280 | Ga0307414_10200853 | 3300032004 | Bacteria | 1621 |
| 281 | Ga0307414_10200925 | 3300032004 | Bacteria | 1621 |
| 282 | Ga0307414_10455031 | 3300032004 | Bacteria | 1123 |
| 283 | Ga0307415_100415475 | 3300032126 | Bacteria | 1153 |
| 284 | Ga0307510_10012875 | 3300033180 | Bacteria | 9930 |
| 285 | Ga0373926_0037853 | 3300035083 | Bacteria | 1717 |
| 286 | Ga0373936_0004232 | 3300035113 | Bacteria | 5417 |
| 287 | Ga0373927_0007778 | 3300035695 | Bacteria | 7249 |
| 288 | Ga0373947_0319358 | 3300035725 | Bacteria | 1038 |
| 289 | Ga0373937_0496997 | 3300036401 | Bacteria | 1159 |
| 290 | Ga0373925_0000653 | 3300037068 | Bacteria | 32591 |
| 291 | Ga0373925_0031244 | 3300037068 | Bacteria | 3913 |
| 292 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 293 | Ga0395899_0002855 | 3300037312 | Bacteria | 13906 |
| 294 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 295 | Ga0395900_0091736 | 3300037418 | Bacteria | 3121 |
| 296 | Ga0395900_0229711 | 3300037418 | Bacteria | 1866 |
| 297 | Ga0395898_0022989 | 3300037466 | Bacteria | 6304 |
| 298 | Ga0395898_0042939 | 3300037466 | Bacteria | 4458 |
| 299 | Ga0395898_0054819 | 3300037466 | Bacteria | 3889 |
| 300 | Ga0395905_0021654 | 3300037471 | Bacteria | 6080 |
| 301 | Ga0395905_0027712 | 3300037471 | Bacteria | 5342 |
| 302 | Ga0395905_0090233 | 3300037471 | Bacteria | 2873 |
| 303 | Ga0395905_0351962 | 3300037471 | Bacteria | 1365 |
| 304 | Ga0436364_0873267 | 3300037853 | Bacteria | 1512 |
| 305 | Ga0395901_0000013 | 3300038443 | Bacteria | 375733 |
| 306 | Ga0395901_0105328 | 3300038443 | Bacteria | 2960 |
| 307 | Ga0395901_0341230 | 3300038443 | Bacteria | 1548 |
| 308 | Ga0395901_0341761 | 3300038443 | Bacteria | 1546 |
| 309 | Ga0436365_0187494 | 3300039437 | Bacteria | 67801 |
| 310 | Ga0436365_1028735 | 3300039437 | Bacteria | 924 |
| 311 | Ga0436361_0940191 | 3300039447 | Bacteria | 3365 |
| 312 | Ga0436361_1069972 | 3300039447 | Bacteria | 36104 |
| 313 | Ga0436362_0049463 | 3300039453 | Bacteria | 1501 |
| 314 | Ga0439431_0027999 | 3300041997 | Bacteria | 1386 |
| 315 | Ga0439445_0042828 | 3300042004 | Bacteria | 1207 |
| 316 | Ga0453684_0117159 | 3300044712 | Bacteria | 3224 |
| 317 | Ga0466959_0028432 | 3300045049 | Bacteria | 4146 |
| 318 | Ga0495617_061434 | 3300046452 | Bacteria | 1242 |
| 319 | Ga0495590_0000467 | 3300046457 | Bacteria | 20006 |
| 320 | Ga0495629_0056529 | 3300046459 | Bacteria | 2743 |
| 321 | Ga0495638_0000283 | 3300046460 | Bacteria | 67742 |
| 322 | Ga0495638_0000292 | 3300046460 | Bacteria | 65766 |
| 323 | Ga0495638_0000939 | 3300046460 | Bacteria | 29527 |
| 324 | Ga0495638_0036419 | 3300046460 | Bacteria | 3135 |
| 325 | Ga0495650_0000168 | 3300046471 | Bacteria | 145714 |
| 326 | Ga0495585_0113098 | 3300046492 | Bacteria | 1442 |
| 327 | Ga0495607_0017682 | 3300046501 | Bacteria | 4568 |
| 328 | Ga0495583_0008671 | 3300046506 | Bacteria | 6185 |
| 329 | Ga0495606_0003607 | 3300046507 | Bacteria | 16276 |
| 330 | Ga0495610_0001080 | 3300046512 | Bacteria | 24952 |
| 331 | Ga0495610_0004585 | 3300046512 | Bacteria | 10134 |
| 332 | Ga0495610_0045762 | 3300046512 | Bacteria | 2163 |
| 333 | Ga0495616_0001277 | 3300046513 | Bacteria | 17673 |
| 334 | Ga0495616_0043246 | 3300046513 | Bacteria | 2289 |
| 335 | Ga0495620_0019780 | 3300046515 | Bacteria | 3302 |
| 336 | Ga0495628_0096218 | 3300046516 | Bacteria | 2287 |
| 337 | Ga0495630_0037598 | 3300046517 | Bacteria | 3620 |
| 338 | Ga0495631_0004826 | 3300046518 | Bacteria | 7106 |
| 339 | Ga0495632_0004711 | 3300046519 | Bacteria | 9207 |
| 340 | Ga0495637_0023266 | 3300046520 | Bacteria | 2818 |
| 341 | Ga0495637_0062793 | 3300046520 | Bacteria | 1519 |
| 342 | Ga0495643_0054919 | 3300046522 | Bacteria | 2130 |
| 343 | Ga0495643_0060500 | 3300046522 | Bacteria | 2010 |
| 344 | Ga0495644_0060242 | 3300046523 | Bacteria | 1427 |
| 345 | Ga0495648_0000107 | 3300046524 | Bacteria | 104376 |
| 346 | Ga0495642_0143425 | 3300046528 | Bacteria | 1031 |
| 347 | Ga0495654_0000085 | 3300046530 | Bacteria | 107010 |
| 348 | Ga0495598_0044498 | 3300046537 | Bacteria | 1312 |
| 349 | Ga0495609_0020633 | 3300046538 | Bacteria | 3043 |
| 350 | Ga0495597_0003622 | 3300046542 | Bacteria | 8887 |
| 351 | Ga0495622_0012681 | 3300046557 | Bacteria | 3906 |
| 352 | Ga0495633_0001477 | 3300046558 | Bacteria | 18231 |
| 353 | Ga0495668_0003283 | 3300046616 | Bacteria | 12284 |
| 354 | Ga0495668_0006744 | 3300046616 | Bacteria | 7468 |
| 355 | Ga0495668_0042080 | 3300046616 | Bacteria | 2543 |
| 356 | Ga0495668_0074955 | 3300046616 | Bacteria | 1858 |
| 357 | Ga0495611_0004621 | 3300046648 | Bacteria | 5923 |
| 358 | Ga0495625_0000034 | 3300046660 | Bacteria | 225120 |
| 359 | Ga0495625_0005125 | 3300046660 | Bacteria | 12110 |
| 360 | Ga0495625_0005802 | 3300046660 | Bacteria | 11152 |
| 361 | Ga0495625_0100003 | 3300046660 | Bacteria | 1993 |
| 362 | Ga0495625_0105456 | 3300046660 | Bacteria | 1930 |
| 363 | Ga0495625_0112556 | 3300046660 | Bacteria | 1859 |
| 364 | Ga0495669_0000007 | 3300046684 | Bacteria | 180797 |
| 365 | Ga0495669_0000919 | 3300046684 | Bacteria | 12304 |
| 366 | Ga0495669_0004238 | 3300046684 | Bacteria | 5907 |
| 367 | Ga0495613_0103597 | 3300046689 | Bacteria | 2054 |
| 368 | Ga0495670_0039294 | 3300046691 | Bacteria | 2360 |
| 369 | Ga0495671_0023786 | 3300046692 | Bacteria | 3199 |
| 370 | Ga0495649_0000171 | 3300046694 | Bacteria | 56672 |
| 371 | Ga0495589_0001385 | 3300046794 | Bacteria | 14102 |
| 372 | Ga0495672_0001097 | 3300047320 | Bacteria | 27486 |
| 373 | Ga0495677_0061942 | 3300047445 | Bacteria | 1388 |
| 374 | Ga0495673_0000492 | 3300047469 | Bacteria | 42153 |
| 375 | Ga0495673_0000697 | 3300047469 | Bacteria | 32802 |
| 376 | Ga0495673_0007360 | 3300047469 | Bacteria | 6343 |
| 377 | Ga0495681_0043609 | 3300047470 | Bacteria | 2161 |
| 378 | Ga0495686_0001488 | 3300047472 | Bacteria | 25389 |
| 379 | Ga0495686_0004012 | 3300047472 | Bacteria | 12315 |
| 380 | Ga0495686_0030422 | 3300047472 | Bacteria | 3506 |
| 381 | Ga0495593_0033823 | 3300047673 | Bacteria | 2782 |
| 382 | Ga0496101_0438544 | 3300048904 | Bacteria | 1030 |
| 383 | Ga0496103_0178823 | 3300048906 | Bacteria | 1363 |
| 384 | Ga0496106_0536480 | 3300048909 | Bacteria | 939 |
| 385 | Ga0496107_0000085 | 3300048910 | Bacteria | 44306 |
| 386 | Ga0496107_0453614 | 3300048910 | Bacteria | 952 |
| 387 | Ga0496108_0337507 | 3300048911 | Bacteria | 1315 |
| 388 | Ga0496109_0074039 | 3300048912 | Bacteria | 3130 |
| 389 | Ga0496112_0073457 | 3300048915 | Bacteria | 3381 |
| 390 | Ga0496115_0001891 | 3300048918 | Bacteria | 14988 |
| 391 | Ga0496115_0003837 | 3300048918 | Bacteria | 10833 |
| 392 | Ga0496115_0011589 | 3300048918 | Bacteria | 6612 |
| 393 | Ga0496115_0033238 | 3300048918 | Bacteria | 4071 |
| 394 | Ga0496115_0073234 | 3300048918 | Bacteria | 2780 |
| 395 | Ga0496115_0608250 | 3300048918 | Bacteria | 868 |
| 396 | Ga0496116_0030216 | 3300048919 | Bacteria | 3896 |
| 397 | Ga0496118_0005332 | 3300048921 | Bacteria | 14647 |
| 398 | Ga0496119_0106591 | 3300048922 | Bacteria | 1563 |
| 399 | Ga0496121_0000042 | 3300048924 | Bacteria | 342304 |
| 400 | Ga0496121_0034434 | 3300048924 | Bacteria | 4558 |
| 401 | Ga0496121_0170224 | 3300048924 | Bacteria | 1583 |
| 402 | Ga0496121_0267828 | 3300048924 | Bacteria | 1176 |
| 403 | Ga0496122_0002925 | 3300048925 | Bacteria | 23284 |
| 404 | Ga0496123_0219862 | 3300048926 | Bacteria | 959 |
| 405 | Ga0496124_0031229 | 3300048927 | Bacteria | 4718 |
| 406 | Ga0496124_0407712 | 3300048927 | Bacteria | 941 |
| 407 | Ga0496125_0004796 | 3300048928 | Bacteria | 15397 |
| 408 | Ga0496125_0010081 | 3300048928 | Bacteria | 9586 |
| 409 | Ga0496125_0058254 | 3300048928 | Bacteria | 3122 |
| 410 | Ga0496126_0004759 | 3300048929 | Bacteria | 15996 |
| 411 | Ga0501032_0029180 | 3300049569 | Bacteria | 3788 |
| 412 | Ga0501033_0002538 | 3300049570 | Bacteria | 15455 |
| 413 | Ga0501033_0032648 | 3300049570 | Bacteria | 3910 |
| 414 | Ga0501034_0294946 | 3300049571 | Bacteria | 1559 |
| 415 | Ga0501037_0015263 | 3300049573 | Bacteria | 5651 |
| 416 | Ga0501037_0165055 | 3300049573 | Bacteria | 1577 |
| 417 | Ga0501047_0008331 | 3300049581 | Bacteria | 9785 |
| 418 | Ga0501047_0059385 | 3300049581 | Bacteria | 3692 |
| 419 | Ga0501047_0325418 | 3300049581 | Bacteria | 1376 |
| 420 | Ga0501048_0160555 | 3300049582 | Bacteria | 1591 |
| 421 | Ga0501035_0035106 | 3300049822 | Bacteria | 4553 |
| 422 | Ga0501044_0005062 | 3300049823 | Bacteria | 14710 |
| 423 | Ga0501044_0019605 | 3300049823 | Bacteria | 7231 |
| 424 | nmdc:mga03683_133527_c1 | 3300050489 | Bacteria | 1112 |
| 425 | nmdc:mga03n38_287812_c1 | 3300050490 | Bacteria | 879 |
| 426 | nmdc:mga00v17_685_c1 | 3300050491 | Bacteria | 18642 |
| 427 | nmdc:mga0k408_42736_c1 | 3300050493 | Bacteria | 2610 |
| 428 | nmdc:mga04h51_6330_c1 | 3300050495 | Bacteria | 3064 |
| 429 | nmdc:mga07m45_56608_c1 | 3300050496 | Bacteria | 2216 |
| 430 | nmdc:mga07m45_8698_c1 | 3300050496 | Bacteria | 5230 |
| 431 | nmdc:mga0sz30_2797_c1 | 3300050516 | Bacteria | 6229 |
| 432 | Ga0500635_0000123 | 3300053080 | Bacteria | 45690 |
| 433 | Ga0500643_000265 | 3300053087 | Bacteria | 46271 |
| 434 | Ga0500643_002905 | 3300053087 | Bacteria | 8515 |
| 435 | Ga0500643_004445 | 3300053087 | Bacteria | 6341 |
| 436 | Ga0500643_005542 | 3300053087 | Bacteria | 5423 |
| 437 | Ga0500643_011598 | 3300053087 | Bacteria | 3204 |
| 438 | Ga0500644_0000124 | 3300053088 | Bacteria | 47262 |
| 439 | Ga0500644_0001671 | 3300053088 | Bacteria | 5783 |
| 440 | Ga0500646_0066997 | 3300053090 | Bacteria | 1069 |
| 441 | Ga0500647_0001502 | 3300053091 | Bacteria | 8058 |
| 442 | Ga0500583_0028302 | 3300053092 | Bacteria | 2429 |
| 443 | Ga0500651_0002111 | 3300053093 | Bacteria | 10338 |
| 444 | Ga0500651_0074942 | 3300053093 | Bacteria | 2103 |
| 445 | Ga0500651_0079971 | 3300053093 | Bacteria | 2025 |
| 446 | Ga0500566_0033378 | 3300053094 | Bacteria | 3000 |
| 447 | Ga0500641_0000871 | 3300053096 | Bacteria | 10785 |
| 448 | Ga0500641_0001351 | 3300053096 | Bacteria | 8719 |
| 449 | Ga0500641_0194437 | 3300053096 | Bacteria | 867 |
| 450 | Ga0500650_0032999 | 3300053098 | Bacteria | 2361 |
| 451 | Ga0500554_047911 | 3300053102 | Bacteria | 1335 |
| 452 | Ga0500555_013525 | 3300053103 | Bacteria | 2354 |
| 453 | Ga0500555_014601 | 3300053103 | Bacteria | 2264 |
| 454 | Ga0500556_0001023 | 3300053104 | Bacteria | 14627 |
| 455 | Ga0500556_0037442 | 3300053104 | Bacteria | 1688 |
| 456 | Ga0500562_002828 | 3300053108 | Bacteria | 4325 |
| 457 | Ga0500562_003821 | 3300053108 | Bacteria | 3792 |
| 458 | Ga0500562_004079 | 3300053108 | Bacteria | 3681 |
| 459 | Ga0500569_002611 | 3300053109 | Bacteria | 3581 |
| 460 | Ga0500572_002628 | 3300053111 | Bacteria | 4260 |
| 461 | Ga0500593_033222 | 3300053117 | Bacteria | 2310 |
| 462 | Ga0500595_002332 | 3300053119 | Bacteria | 9491 |
| 463 | Ga0500595_008312 | 3300053119 | Bacteria | 4247 |
| 464 | Ga0500595_009160 | 3300053119 | Bacteria | 4009 |
| 465 | Ga0500597_097732 | 3300053120 | Bacteria | 1276 |
| 466 | Ga0500607_205471 | 3300053121 | Bacteria | 840 |
| 467 | Ga0500608_000011 | 3300053122 | Bacteria | 92215 |
| 468 | Ga0500608_001751 | 3300053122 | Bacteria | 7757 |
| 469 | Ga0500614_001062 | 3300053123 | Bacteria | 6832 |
| 470 | Ga0500642_0018179 | 3300053130 | Bacteria | 2713 |
| 471 | Ga0500655_025410 | 3300053133 | Bacteria | 1124 |
| 472 | Ga0500658_0002725 | 3300053134 | Bacteria | 6792 |
| 473 | Ga0500559_0000004 | 3300053136 | Bacteria | 241551 |
| 474 | Ga0500559_0005404 | 3300053136 | Bacteria | 5884 |
| 475 | Ga0500559_0014378 | 3300053136 | Bacteria | 3345 |
| 476 | Ga0500559_0025335 | 3300053136 | Bacteria | 2524 |
| 477 | Ga0500559_0127772 | 3300053136 | Bacteria | 1186 |
| 478 | Ga0500564_000063 | 3300053138 | Bacteria | 28411 |
| 479 | Ga0500577_0012108 | 3300053142 | Bacteria | 2597 |
| 480 | Ga0500590_046523 | 3300053148 | Bacteria | 2217 |
| 481 | Ga0500604_0023031 | 3300053151 | Bacteria | 1773 |
| 482 | Ga0500616_0005230 | 3300053153 | Bacteria | 8876 |
| 483 | Ga0500616_0044842 | 3300053153 | Bacteria | 2358 |
| 484 | Ga0500619_004773 | 3300053154 | Bacteria | 2947 |
| 485 | Ga0500622_0000643 | 3300053156 | Bacteria | 31235 |
| 486 | Ga0500622_0005996 | 3300053156 | Bacteria | 7140 |
| 487 | Ga0500622_0023760 | 3300053156 | Bacteria | 3246 |
| 488 | Ga0500622_0042108 | 3300053156 | Bacteria | 2374 |
| 489 | Ga0500622_0086872 | 3300053156 | Bacteria | 1558 |
| 490 | Ga0500639_084571 | 3300053163 | Bacteria | 1592 |
| 491 | Ga0500636_0003167 | 3300053177 | Bacteria | 9217 |
| 492 | Ga0500637_0005271 | 3300053178 | Bacteria | 6247 |
| 493 | Ga0500637_0098026 | 3300053178 | Bacteria | 1699 |
| 494 | Ga0500576_041914 | 3300053725 | Bacteria | 2057 |
| 495 | Ga0500645_001143 | 3300053730 | Bacteria | 14378 |
| 496 | Ga0500645_001630 | 3300053730 | Bacteria | 11078 |
| 497 | Ga0500645_013157 | 3300053730 | Bacteria | 2661 |
| 498 | Ga0500645_091407 | 3300053730 | Bacteria | 863 |
| 499 | Ga0500609_007218 | 3300053731 | Bacteria | 1500 |
| 500 | Ga0500552_004704 | 3300053733 | Bacteria | 1453 |
| 501 | Ga0500596_000393 | 3300053735 | Bacteria | 7980 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050489 | nmdc:mga03683_133527_c1 | nmdc:mga03683_133527_c1_11_727 | 238 |
| 2 | 3300003791 | Ga0055530_10000313 | Ga0055530_1000031331 | 245 |
| 3 | 3300003794 | Ga0055531_10004699 | Ga0055531_100046995 | 245 |
| 4 | 3300025297 | Ga0209758_1001380 | Ga0209758_100138029 | 245 |
| 5 | 3300025298 | Ga0209050_1000053 | Ga0209050_100005363 | 245 |
| 6 | 3300025304 | Ga0209257_1000419 | Ga0209257_100041985 | 245 |
| 7 | 3300031239 | Ga0265328_10000370 | Ga0265328_1000037015 | 245 |
| 8 | 3300031239 | Ga0265328_10034348 | Ga0265328_100343482 | 246 |
| 9 | 3300031239 | Ga0265328_10002129 | Ga0265328_100021292 | 247 |
| 10 | iso_pu_bacteria | 2891088606 | 2891093160 | 247 |
| 11 | 3300053731 | Ga0500609_007218 | Ga0500609_007218_711_1484 | 257 |
| 12 | iso_pu_bacteria | 2643221574 | 2643884549 | 260 |
| 13 | iso_pu_bacteria | 2643221699 | 2644549067 | 260 |
| 14 | iso_pu_bacteria | 2643221699 | 2644553203 | 260 |
| 15 | iso_pu_bacteria | 2928972540 | 2928974622 | 261 |
| 16 | iso_pu_bacteria | 2941485952 | 2941488065 | 261 |
| 17 | iso_pu_bacteria | 2977240413 | 2977243546 | 261 |
| 18 | 3300003781 | Ga0055536_1009453 | Ga0055536_10094531 | 264 |
| 19 | 3300025292 | Ga0209676_1000140 | Ga0209676_100014047 | 264 |
| 20 | 3300025292 | Ga0209676_1001860 | Ga0209676_10018608 | 264 |
| 21 | 3300025298 | Ga0209050_1012795 | Ga0209050_10127953 | 264 |
| 22 | 3300025304 | Ga0209257_1000292 | Ga0209257_100029243 | 264 |
| 23 | 3300031911 | Ga0307412_10002217 | Ga0307412_100022178 | 264 |
| 24 | 3300032004 | Ga0307414_10048083 | Ga0307414_100480832 | 264 |
| 25 | 3300032004 | Ga0307414_10056959 | Ga0307414_100569592 | 264 |
| 26 | 3300032004 | Ga0307414_10068561 | Ga0307414_100685614 | 264 |
| 27 | 3300032004 | Ga0307414_10200853 | Ga0307414_102008532 | 264 |
| 28 | 3300032004 | Ga0307414_10200925 | Ga0307414_102009251 | 264 |
| 29 | 3300032004 | Ga0307414_10455031 | Ga0307414_104550312 | 264 |
| 30 | 3300048918 | Ga0496115_0003837 | Ga0496115_0003837_1712_2506 | 264 |
| 31 | 3300053088 | Ga0500644_0001671 | Ga0500644_0001671_718_1512 | 264 |
| 32 | 3300053093 | Ga0500651_0002111 | Ga0500651_0002111_8108_8902 | 264 |
| 33 | 3300053156 | Ga0500622_0086872 | Ga0500622_0086872_743_1537 | 264 |
| 34 | iso_pu_bacteria | 2582581279 | 2585149727 | 264 |
| 35 | iso_pu_bacteria | 2585428106 | 2587915781 | 264 |
| 36 | iso_pu_bacteria | 2643221545 | 2643750134 | 264 |
| 37 | iso_pu_bacteria | 2643221552 | 2643781786 | 264 |
| 38 | iso_pu_bacteria | 2643221583 | 2643922353 | 264 |
| 39 | iso_pu_bacteria | 2643221584 | 2643931976 | 264 |
| 40 | iso_pu_bacteria | 2643221598 | 2643999660 | 264 |
| 41 | iso_pu_bacteria | 2643221614 | 2644087646 | 264 |
| 42 | iso_pu_bacteria | 2643221640 | 2644223331 | 264 |
| 43 | iso_pu_bacteria | 2643221642 | 2644236399 | 264 |
| 44 | iso_pu_bacteria | 2643221661 | 2644344310 | 264 |
| 45 | iso_pu_bacteria | 2643221666 | 2644367005 | 264 |
| 46 | iso_pu_bacteria | 2643221691 | 2644507023 | 264 |
| 47 | iso_pu_bacteria | 2791355048 | 2792460853 | 264 |
| 48 | iso_pu_bacteria | 2843744320 | 2843745487 | 264 |
| 49 | iso_pu_bacteria | 2849560528 | 2849561101 | 264 |
| 50 | iso_pu_bacteria | 2849573788 | 2849578567 | 264 |
| 51 | iso_pu_bacteria | 2851153111 | 2851157137 | 264 |
| 52 | iso_pu_bacteria | 2857504554 | 2857505707 | 264 |
| 53 | iso_pu_bacteria | 2884960567 | 2884965523 | 264 |
| 54 | iso_pu_bacteria | 2898329390 | 2898332795 | 264 |
| 55 | iso_pu_bacteria | 2928531327 | 2928532190 | 264 |
| 56 | 3300013102 | Ga0157371_10007280 | Ga0157371_100072802 | 265 |
| 57 | 3300013104 | Ga0157370_10019913 | Ga0157370_100199133 | 265 |
| 58 | 3300013105 | Ga0157369_10020217 | Ga0157369_100202173 | 265 |
| 59 | 3300031824 | Ga0307413_10393883 | Ga0307413_103938831 | 265 |
| 60 | 3300032004 | Ga0307414_10051035 | Ga0307414_100510352 | 265 |
| 61 | 3300032004 | Ga0307414_10101841 | Ga0307414_101018412 | 265 |
| 62 | 3300046558 | Ga0495633_0001477 | Ga0495633_0001477_1103_1900 | 265 |
| 63 | 3300046694 | Ga0495649_0000171 | Ga0495649_0000171_12264_13061 | 265 |
| 64 | 3300048919 | Ga0496116_0030216 | Ga0496116_0030216_476_1279 | 265 |
| 65 | 3300048925 | Ga0496122_0002925 | Ga0496122_0002925_9764_10561 | 265 |
| 66 | 3300048926 | Ga0496123_0219862 | Ga0496123_0219862_135_932 | 265 |
| 67 | 3300048928 | Ga0496125_0004796 | Ga0496125_0004796_1436_2239 | 265 |
| 68 | 3300053093 | Ga0500651_0074942 | Ga0500651_0074942_175_972 | 265 |
| 69 | 3300009551 | Ga0105238_10700525 | Ga0105238_107005251 | 266 |
| 70 | 3300037853 | Ga0436364_0873267 | Ga0436364_0873267_435_1235 | 266 |
| 71 | 3300039437 | Ga0436365_1028735 | Ga0436365_1028735_98_898 | 266 |
| 72 | 3300046537 | Ga0495598_0044498 | Ga0495598_0044498_456_1256 | 266 |
| 73 | 3300003320 | rootH2_10042095 | rootH2_100420951 | 268 |
| 74 | 3300003775 | Ga0055524_1011000 | Ga0055524_10110002 | 268 |
| 75 | 3300003781 | Ga0055536_1003526 | Ga0055536_10035268 | 268 |
| 76 | 3300003781 | Ga0055536_1008141 | Ga0055536_10081413 | 268 |
| 77 | 3300003790 | Ga0055528_1015927 | Ga0055528_10159272 | 268 |
| 78 | 3300003791 | Ga0055530_10002661 | Ga0055530_1000266111 | 268 |
| 79 | 3300003791 | Ga0055530_10006718 | Ga0055530_100067183 | 268 |
| 80 | 3300003794 | Ga0055531_10002220 | Ga0055531_1000222013 | 268 |
| 81 | 3300005262 | Ga0065165_1000583 | Ga0065165_10005836 | 268 |
| 82 | 3300005327 | Ga0070658_10219407 | Ga0070658_102194072 | 268 |
| 83 | 3300005331 | Ga0070670_100000007 | Ga0070670_10000000713 | 268 |
| 84 | 3300005335 | Ga0070666_10039451 | Ga0070666_100394513 | 268 |
| 85 | 3300005335 | Ga0070666_10071226 | Ga0070666_100712262 | 268 |
| 86 | 3300005335 | Ga0070666_10288247 | Ga0070666_102882471 | 268 |
| 87 | 3300005336 | Ga0070680_100169189 | Ga0070680_1001691892 | 268 |
| 88 | 3300005347 | Ga0070668_100000272 | Ga0070668_1000002725 | 268 |
| 89 | 3300005347 | Ga0070668_100005382 | Ga0070668_1000053827 | 268 |
| 90 | 3300005347 | Ga0070668_100010729 | Ga0070668_1000107298 | 268 |
| 91 | 3300005347 | Ga0070668_100044636 | Ga0070668_1000446363 | 268 |
| 92 | 3300005347 | Ga0070668_100117006 | Ga0070668_1001170062 | 268 |
| 93 | 3300005353 | Ga0070669_100001157 | Ga0070669_10000115711 | 268 |
| 94 | 3300005353 | Ga0070669_100009792 | Ga0070669_1000097927 | 268 |
| 95 | 3300005355 | Ga0070671_100001426 | Ga0070671_10000142614 | 268 |
| 96 | 3300005355 | Ga0070671_100168959 | Ga0070671_1001689592 | 268 |
| 97 | 3300005366 | Ga0070659_100002510 | Ga0070659_10000251010 | 268 |
| 98 | 3300005366 | Ga0070659_100012009 | Ga0070659_1000120095 | 268 |
| 99 | 3300005366 | Ga0070659_100041439 | Ga0070659_1000414395 | 268 |
| 100 | 3300005367 | Ga0070667_100000291 | Ga0070667_10000029128 | 268 |
| 101 | 3300005367 | Ga0070667_100004267 | Ga0070667_10000426710 | 268 |
| 102 | 3300005367 | Ga0070667_100006296 | Ga0070667_1000062962 | 268 |
| 103 | 3300005367 | Ga0070667_100010607 | Ga0070667_1000106076 | 268 |
| 104 | 3300005458 | Ga0070681_10042288 | Ga0070681_100422884 | 268 |
| 105 | 3300005458 | Ga0070681_10156607 | Ga0070681_101566071 | 268 |
| 106 | 3300005530 | Ga0070679_100141555 | Ga0070679_1001415553 | 268 |
| 107 | 3300005539 | Ga0068853_100029369 | Ga0068853_1000293692 | 268 |
| 108 | 3300005539 | Ga0068853_100179815 | Ga0068853_1001798152 | 268 |
| 109 | 3300005548 | Ga0070665_100000395 | Ga0070665_10000039538 | 268 |
| 110 | 3300005548 | Ga0070665_100002782 | Ga0070665_10000278210 | 268 |
| 111 | 3300005548 | Ga0070665_100017425 | Ga0070665_1000174258 | 268 |
| 112 | 3300005548 | Ga0070665_100155747 | Ga0070665_1001557472 | 268 |
| 113 | 3300005563 | Ga0068855_100034109 | Ga0068855_1000341097 | 268 |
| 114 | 3300005563 | Ga0068855_100156944 | Ga0068855_1001569444 | 268 |
| 115 | 3300005563 | Ga0068855_100394587 | Ga0068855_1003945872 | 268 |
| 116 | 3300005563 | Ga0068855_100422748 | Ga0068855_1004227481 | 268 |
| 117 | 3300005564 | Ga0070664_100011039 | Ga0070664_1000110397 | 268 |
| 118 | 3300005564 | Ga0070664_100097198 | Ga0070664_1000971983 | 268 |
| 119 | 3300005578 | Ga0068854_100311900 | Ga0068854_1003119002 | 268 |
| 120 | 3300005614 | Ga0068856_100096630 | Ga0068856_1000966303 | 268 |
| 121 | 3300005614 | Ga0068856_100726928 | Ga0068856_1007269282 | 268 |
| 122 | 3300005616 | Ga0068852_100258988 | Ga0068852_1002589882 | 268 |
| 123 | 3300005617 | Ga0068859_100001326 | Ga0068859_1000013268 | 268 |
| 124 | 3300005617 | Ga0068859_100001699 | Ga0068859_10000169915 | 268 |
| 125 | 3300005618 | Ga0068864_100002407 | Ga0068864_1000024078 | 268 |
| 126 | 3300005618 | Ga0068864_100003084 | Ga0068864_10000308410 | 268 |
| 127 | 3300005618 | Ga0068864_100086573 | Ga0068864_1000865733 | 268 |
| 128 | 3300005618 | Ga0068864_100167963 | Ga0068864_1001679632 | 268 |
| 129 | 3300005618 | Ga0068864_100365885 | Ga0068864_1003658852 | 268 |
| 130 | 3300005841 | Ga0068863_100000262 | Ga0068863_10000026257 | 268 |
| 131 | 3300005841 | Ga0068863_100003500 | Ga0068863_10000350011 | 268 |
| 132 | 3300005841 | Ga0068863_100003720 | Ga0068863_10000372013 | 268 |
| 133 | 3300005841 | Ga0068863_100044605 | Ga0068863_1000446052 | 268 |
| 134 | 3300005841 | Ga0068863_100602868 | Ga0068863_1006028682 | 268 |
| 135 | 3300005842 | Ga0068858_100001577 | Ga0068858_10000157710 | 268 |
| 136 | 3300005842 | Ga0068858_100011317 | Ga0068858_1000113178 | 268 |
| 137 | 3300005842 | Ga0068858_100074394 | Ga0068858_1000743943 | 268 |
| 138 | 3300005843 | Ga0068860_100000047 | Ga0068860_10000004713 | 268 |
| 139 | 3300005843 | Ga0068860_100002126 | Ga0068860_10000212617 | 268 |
| 140 | 3300005843 | Ga0068860_100003451 | Ga0068860_1000034513 | 268 |
| 141 | 3300005844 | Ga0068862_100004496 | Ga0068862_1000044965 | 268 |
| 142 | 3300005844 | Ga0068862_100035969 | Ga0068862_1000359693 | 268 |
| 143 | 3300005844 | Ga0068862_100062514 | Ga0068862_1000625141 | 268 |
| 144 | 3300005844 | Ga0068862_100096486 | Ga0068862_1000964863 | 268 |
| 145 | 3300006051 | Ga0075364_10000600 | Ga0075364_1000060018 | 268 |
| 146 | 3300006178 | Ga0075367_10053550 | Ga0075367_100535502 | 268 |
| 147 | 3300006195 | Ga0075366_10040517 | Ga0075366_100405172 | 268 |
| 148 | 3300006353 | Ga0075370_10027305 | Ga0075370_100273054 | 268 |
| 149 | 3300006931 | Ga0097620_100001326 | Ga0097620_1000013268 | 268 |
| 150 | 3300006931 | Ga0097620_100001698 | Ga0097620_1000016988 | 268 |
| 151 | 3300009092 | Ga0105250_10048171 | Ga0105250_100481712 | 268 |
| 152 | 3300009093 | Ga0105240_10003418 | Ga0105240_1000341823 | 268 |
| 153 | 3300009093 | Ga0105240_10004843 | Ga0105240_100048437 | 268 |
| 154 | 3300009093 | Ga0105240_10012284 | Ga0105240_1001228412 | 268 |
| 155 | 3300009093 | Ga0105240_10100147 | Ga0105240_101001475 | 268 |
| 156 | 3300009093 | Ga0105240_10163340 | Ga0105240_101633404 | 268 |
| 157 | 3300009093 | Ga0105240_10864653 | Ga0105240_108646531 | 268 |
| 158 | 3300009098 | Ga0105245_10146375 | Ga0105245_101463752 | 268 |
| 159 | 3300009101 | Ga0105247_10058669 | Ga0105247_100586692 | 268 |
| 160 | 3300009177 | Ga0105248_10000746 | Ga0105248_100007463 | 268 |
| 161 | 3300009177 | Ga0105248_10001254 | Ga0105248_100012543 | 268 |
| 162 | 3300009177 | Ga0105248_10001644 | Ga0105248_1000164422 | 268 |
| 163 | 3300009177 | Ga0105248_10010845 | Ga0105248_100108452 | 268 |
| 164 | 3300009177 | Ga0105248_10064392 | Ga0105248_100643925 | 268 |
| 165 | 3300009177 | Ga0105248_10363005 | Ga0105248_103630051 | 268 |
| 166 | 3300009177 | Ga0105248_10571402 | Ga0105248_105714022 | 268 |
| 167 | 3300009545 | Ga0105237_10246297 | Ga0105237_102462972 | 268 |
| 168 | 3300009551 | Ga0105238_10079187 | Ga0105238_100791872 | 268 |
| 169 | 3300009551 | Ga0105238_10107149 | Ga0105238_101071494 | 268 |
| 170 | 3300009551 | Ga0105238_10554103 | Ga0105238_105541031 | 268 |
| 171 | 3300009553 | Ga0105249_10002418 | Ga0105249_100024188 | 268 |
| 172 | 3300009553 | Ga0105249_10284569 | Ga0105249_102845692 | 268 |
| 173 | 3300009553 | Ga0105249_10444750 | Ga0105249_104447502 | 268 |
| 174 | 3300009553 | Ga0105249_10578067 | Ga0105249_105780672 | 268 |
| 175 | 3300010375 | Ga0105239_10071623 | Ga0105239_100716234 | 268 |
| 176 | 3300010375 | Ga0105239_10119796 | Ga0105239_101197961 | 268 |
| 177 | 3300013100 | Ga0157373_10000879 | Ga0157373_1000087920 | 268 |
| 178 | 3300013100 | Ga0157373_10002637 | Ga0157373_100026373 | 268 |
| 179 | 3300013104 | Ga0157370_10185989 | Ga0157370_101859892 | 268 |
| 180 | 3300013105 | Ga0157369_10170137 | Ga0157369_101701373 | 268 |
| 181 | 3300013105 | Ga0157369_10709319 | Ga0157369_107093192 | 268 |
| 182 | 3300013306 | Ga0163162_10153192 | Ga0163162_101531922 | 268 |
| 183 | 3300013306 | Ga0163162_11025038 | Ga0163162_110250382 | 268 |
| 184 | 3300013308 | Ga0157375_10240189 | Ga0157375_102401893 | 268 |
| 185 | 3300014325 | Ga0163163_10008395 | Ga0163163_100083952 | 268 |
| 186 | 3300014325 | Ga0163163_10041831 | Ga0163163_100418314 | 268 |
| 187 | 3300014325 | Ga0163163_10092487 | Ga0163163_100924872 | 268 |
| 188 | 3300014325 | Ga0163163_10145338 | Ga0163163_101453384 | 268 |
| 189 | 3300014325 | Ga0163163_10163368 | Ga0163163_101633682 | 268 |
| 190 | 3300014325 | Ga0163163_10179468 | Ga0163163_101794683 | 268 |
| 191 | 3300014325 | Ga0163163_10572141 | Ga0163163_105721411 | 268 |
| 192 | 3300014745 | Ga0157377_10192011 | Ga0157377_101920112 | 268 |
| 193 | 3300014968 | Ga0157379_10003580 | Ga0157379_100035806 | 268 |
| 194 | 3300014968 | Ga0157379_10024480 | Ga0157379_100244801 | 268 |
| 195 | 3300014968 | Ga0157379_10059719 | Ga0157379_100597191 | 268 |
| 196 | 3300014968 | Ga0157379_10152607 | Ga0157379_101526072 | 268 |
| 197 | 3300014969 | Ga0157376_10344179 | Ga0157376_103441791 | 268 |
| 198 | 3300021361 | Ga0213872_10008803 | Ga0213872_100088037 | 268 |
| 199 | 3300021361 | Ga0213872_10020485 | Ga0213872_100204853 | 268 |
| 200 | 3300021384 | Ga0213876_10000081 | Ga0213876_1000008181 | 268 |
| 201 | 3300021384 | Ga0213876_10077415 | Ga0213876_100774152 | 268 |
| 202 | 3300025250 | Ga0209026_1001196 | Ga0209026_10011965 | 268 |
| 203 | 3300025254 | Ga0209148_1010595 | Ga0209148_10105952 | 268 |
| 204 | 3300025263 | Ga0209565_1000090 | Ga0209565_1000090138 | 268 |
| 205 | 3300025273 | Ga0209673_1004907 | Ga0209673_10049075 | 268 |
| 206 | 3300025292 | Ga0209676_1000257 | Ga0209676_10002574 | 268 |
| 207 | 3300025292 | Ga0209676_1005474 | Ga0209676_10054744 | 268 |
| 208 | 3300025295 | Ga0209564_1015123 | Ga0209564_10151232 | 268 |
| 209 | 3300025297 | Ga0209758_1002555 | Ga0209758_100255515 | 268 |
| 210 | 3300025298 | Ga0209050_1003986 | Ga0209050_10039863 | 268 |
| 211 | 3300025298 | Ga0209050_1006790 | Ga0209050_10067904 | 268 |
| 212 | 3300025299 | Ga0209256_1008640 | Ga0209256_10086404 | 268 |
| 213 | 3300025299 | Ga0209256_1026005 | Ga0209256_10260051 | 268 |
| 214 | 3300025299 | Ga0209256_1027974 | Ga0209256_10279741 | 268 |
| 215 | 3300025303 | Ga0209051_1000743 | Ga0209051_10007434 | 268 |
| 216 | 3300025304 | Ga0209257_1000624 | Ga0209257_100062412 | 268 |
| 217 | 3300025304 | Ga0209257_1003494 | Ga0209257_10034949 | 268 |
| 218 | 3300025304 | Ga0209257_1006554 | Ga0209257_10065544 | 268 |
| 219 | 3300025903 | Ga0207680_10020782 | Ga0207680_100207824 | 268 |
| 220 | 3300025903 | Ga0207680_10024436 | Ga0207680_100244363 | 268 |
| 221 | 3300025903 | Ga0207680_10041937 | Ga0207680_100419373 | 268 |
| 222 | 3300025909 | Ga0207705_10001195 | Ga0207705_1000119516 | 268 |
| 223 | 3300025912 | Ga0207707_10237260 | Ga0207707_102372602 | 268 |
| 224 | 3300025913 | Ga0207695_10000269 | Ga0207695_1000026967 | 268 |
| 225 | 3300025913 | Ga0207695_10000886 | Ga0207695_100008863 | 268 |
| 226 | 3300025913 | Ga0207695_10010613 | Ga0207695_100106138 | 268 |
| 227 | 3300025913 | Ga0207695_10057503 | Ga0207695_100575035 | 268 |
| 228 | 3300025913 | Ga0207695_10090094 | Ga0207695_100900943 | 268 |
| 229 | 3300025913 | Ga0207695_10291095 | Ga0207695_102910953 | 268 |
| 230 | 3300025914 | Ga0207671_10171187 | Ga0207671_101711872 | 268 |
| 231 | 3300025917 | Ga0207660_10007322 | Ga0207660_100073228 | 268 |
| 232 | 3300025919 | Ga0207657_10000235 | Ga0207657_1000023512 | 268 |
| 233 | 3300025921 | Ga0207652_10083115 | Ga0207652_100831155 | 268 |
| 234 | 3300025923 | Ga0207681_10014772 | Ga0207681_100147723 | 268 |
| 235 | 3300025923 | Ga0207681_10094346 | Ga0207681_100943463 | 268 |
| 236 | 3300025924 | Ga0207694_10020782 | Ga0207694_100207826 | 268 |
| 237 | 3300025924 | Ga0207694_10065289 | Ga0207694_100652892 | 268 |
| 238 | 3300025924 | Ga0207694_10084995 | Ga0207694_100849954 | 268 |
| 239 | 3300025925 | Ga0207650_10000033 | Ga0207650_1000003382 | 268 |
| 240 | 3300025925 | Ga0207650_10025851 | Ga0207650_100258513 | 268 |
| 241 | 3300025927 | Ga0207687_10125590 | Ga0207687_101255902 | 268 |
| 242 | 3300025931 | Ga0207644_10003812 | Ga0207644_100038125 | 268 |
| 243 | 3300025931 | Ga0207644_10016427 | Ga0207644_100164271 | 268 |
| 244 | 3300025931 | Ga0207644_10288034 | Ga0207644_102880341 | 268 |
| 245 | 3300025932 | Ga0207690_10000031 | Ga0207690_1000003175 | 268 |
| 246 | 3300025932 | Ga0207690_10026967 | Ga0207690_100269675 | 268 |
| 247 | 3300025932 | Ga0207690_10072722 | Ga0207690_100727222 | 268 |
| 248 | 3300025933 | Ga0207706_10044166 | Ga0207706_100441662 | 268 |
| 249 | 3300025934 | Ga0207686_10190485 | Ga0207686_101904852 | 268 |
| 250 | 3300025941 | Ga0207711_10000331 | Ga0207711_1000033127 | 268 |
| 251 | 3300025941 | Ga0207711_10000764 | Ga0207711_1000076429 | 268 |
| 252 | 3300025941 | Ga0207711_10005910 | Ga0207711_1000591011 | 268 |
| 253 | 3300025941 | Ga0207711_10099228 | Ga0207711_100992283 | 268 |
| 254 | 3300025941 | Ga0207711_10247650 | Ga0207711_102476502 | 268 |
| 255 | 3300025945 | Ga0207679_10073590 | Ga0207679_100735902 | 268 |
| 256 | 3300025945 | Ga0207679_10083989 | Ga0207679_100839892 | 268 |
| 257 | 3300025949 | Ga0207667_10006978 | Ga0207667_100069784 | 268 |
| 258 | 3300025949 | Ga0207667_10009903 | Ga0207667_100099037 | 268 |
| 259 | 3300025949 | Ga0207667_10009952 | Ga0207667_1000995211 | 268 |
| 260 | 3300025949 | Ga0207667_10125857 | Ga0207667_101258573 | 268 |
| 261 | 3300025949 | Ga0207667_10164800 | Ga0207667_101648001 | 268 |
| 262 | 3300025949 | Ga0207667_10367531 | Ga0207667_103675313 | 268 |
| 263 | 3300025961 | Ga0207712_10001293 | Ga0207712_100012937 | 268 |
| 264 | 3300025961 | Ga0207712_10383893 | Ga0207712_103838931 | 268 |
| 265 | 3300025972 | Ga0207668_10000013 | Ga0207668_1000001371 | 268 |
| 266 | 3300025972 | Ga0207668_10001021 | Ga0207668_1000102116 | 268 |
| 267 | 3300025972 | Ga0207668_10002317 | Ga0207668_100023172 | 268 |
| 268 | 3300025972 | Ga0207668_10006177 | Ga0207668_100061773 | 268 |
| 269 | 3300025972 | Ga0207668_10018010 | Ga0207668_100180103 | 268 |
| 270 | 3300025972 | Ga0207668_10288338 | Ga0207668_102883382 | 268 |
| 271 | 3300025986 | Ga0207658_10000323 | Ga0207658_1000032346 | 268 |
| 272 | 3300025986 | Ga0207658_10002054 | Ga0207658_100020548 | 268 |
| 273 | 3300025986 | Ga0207658_10055831 | Ga0207658_100558312 | 268 |
| 274 | 3300025986 | Ga0207658_10093017 | Ga0207658_100930172 | 268 |
| 275 | 3300025986 | Ga0207658_10318727 | Ga0207658_103187272 | 268 |
| 276 | 3300026035 | Ga0207703_10000027 | Ga0207703_10000027191 | 268 |
| 277 | 3300026035 | Ga0207703_10006596 | Ga0207703_100065969 | 268 |
| 278 | 3300026035 | Ga0207703_10007679 | Ga0207703_100076795 | 268 |
| 279 | 3300026035 | Ga0207703_10038927 | Ga0207703_100389272 | 268 |
| 280 | 3300026035 | Ga0207703_10132568 | Ga0207703_101325682 | 268 |
| 281 | 3300026041 | Ga0207639_10034526 | Ga0207639_100345266 | 268 |
| 282 | 3300026078 | Ga0207702_10144845 | Ga0207702_101448453 | 268 |
| 283 | 3300026078 | Ga0207702_10344429 | Ga0207702_103444293 | 268 |
| 284 | 3300026078 | Ga0207702_10575389 | Ga0207702_105753892 | 268 |
| 285 | 3300026088 | Ga0207641_10000003 | Ga0207641_10000003177 | 268 |
| 286 | 3300026088 | Ga0207641_10004327 | Ga0207641_100043279 | 268 |
| 287 | 3300026088 | Ga0207641_10005567 | Ga0207641_1000556711 | 268 |
| 288 | 3300026088 | Ga0207641_10083996 | Ga0207641_100839961 | 268 |
| 289 | 3300026095 | Ga0207676_10000135 | Ga0207676_1000013513 | 268 |
| 290 | 3300026095 | Ga0207676_10000203 | Ga0207676_100002039 | 268 |
| 291 | 3300026095 | Ga0207676_10087279 | Ga0207676_100872793 | 268 |
| 292 | 3300026116 | Ga0207674_10490161 | Ga0207674_104901611 | 268 |
| 293 | 3300027543 | Ga0209999_1000895 | Ga0209999_10008951 | 268 |
| 294 | 3300027665 | Ga0209983_1003347 | Ga0209983_10033474 | 268 |
| 295 | 3300027866 | Ga0209813_10031727 | Ga0209813_100317272 | 268 |
| 296 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031463 | 268 |
| 297 | 3300028379 | Ga0268266_10003032 | Ga0268266_1000303211 | 268 |
| 298 | 3300028379 | Ga0268266_10021376 | Ga0268266_100213767 | 268 |
| 299 | 3300028379 | Ga0268266_10183772 | Ga0268266_101837722 | 268 |
| 300 | 3300028379 | Ga0268266_10658341 | Ga0268266_106583411 | 268 |
| 301 | 3300028380 | Ga0268265_10002897 | Ga0268265_100028978 | 268 |
| 302 | 3300028380 | Ga0268265_10063519 | Ga0268265_100635191 | 268 |
| 303 | 3300028380 | Ga0268265_10064068 | Ga0268265_100640684 | 268 |
| 304 | 3300028380 | Ga0268265_10303534 | Ga0268265_103035342 | 268 |
| 305 | 3300028381 | Ga0268264_10000113 | Ga0268264_10000113192 | 268 |
| 306 | 3300028381 | Ga0268264_10000205 | Ga0268264_100002053 | 268 |
| 307 | 3300028381 | Ga0268264_10005653 | Ga0268264_1000565310 | 268 |
| 308 | 3300028381 | Ga0268264_10339598 | Ga0268264_103395982 | 268 |
| 309 | 3300028786 | Ga0307517_10011953 | Ga0307517_100119534 | 268 |
| 310 | 3300028786 | Ga0307517_10024392 | Ga0307517_100243928 | 268 |
| 311 | 3300028786 | Ga0307517_10078738 | Ga0307517_100787384 | 268 |
| 312 | 3300028800 | Ga0265338_10040359 | Ga0265338_100403593 | 268 |
| 313 | 3300028800 | Ga0265338_10047904 | Ga0265338_100479043 | 268 |
| 314 | 3300028800 | Ga0265338_10099439 | Ga0265338_100994391 | 268 |
| 315 | 3300028800 | Ga0265338_10142249 | Ga0265338_101422491 | 268 |
| 316 | 3300028800 | Ga0265338_10186049 | Ga0265338_101860491 | 268 |
| 317 | 3300031250 | Ga0265331_10184466 | Ga0265331_101844661 | 268 |
| 318 | 3300031251 | Ga0265327_10000331 | Ga0265327_1000033176 | 268 |
| 319 | 3300031251 | Ga0265327_10001088 | Ga0265327_1000108821 | 268 |
| 320 | 3300031251 | Ga0265327_10001225 | Ga0265327_1000122510 | 268 |
| 321 | 3300031456 | Ga0307513_10000178 | Ga0307513_1000017861 | 268 |
| 322 | 3300031456 | Ga0307513_10021691 | Ga0307513_100216918 | 268 |
| 323 | 3300031456 | Ga0307513_10027358 | Ga0307513_100273582 | 268 |
| 324 | 3300031711 | Ga0265314_10116665 | Ga0265314_101166652 | 268 |
| 325 | 3300031730 | Ga0307516_10000144 | Ga0307516_1000014460 | 268 |
| 326 | 3300031824 | Ga0307413_10361626 | Ga0307413_103616262 | 268 |
| 327 | 3300031852 | Ga0307410_10158181 | Ga0307410_101581811 | 268 |
| 328 | 3300032126 | Ga0307415_100415475 | Ga0307415_1004154752 | 268 |
| 329 | 3300033180 | Ga0307510_10012875 | Ga0307510_1001287510 | 268 |
| 330 | 3300035083 | Ga0373926_0037853 | Ga0373926_0037853_450_1256 | 268 |
| 331 | 3300035113 | Ga0373936_0004232 | Ga0373936_0004232_2378_3184 | 268 |
| 332 | 3300035695 | Ga0373927_0007778 | Ga0373927_0007778_4090_4896 | 268 |
| 333 | 3300035725 | Ga0373947_0319358 | Ga0373947_0319358_19_825 | 268 |
| 334 | 3300036401 | Ga0373937_0496997 | Ga0373937_0496997_269_1075 | 268 |
| 335 | 3300037068 | Ga0373925_0000653 | Ga0373925_0000653_9503_10309 | 268 |
| 336 | 3300037068 | Ga0373925_0031244 | Ga0373925_0031244_406_1212 | 268 |
| 337 | 3300037312 | Ga0395899_0000003 | Ga0395899_0000003_1029905_1030711 | 268 |
| 338 | 3300037312 | Ga0395899_0002855 | Ga0395899_0002855_6749_7555 | 268 |
| 339 | 3300037418 | Ga0395900_0000002 | Ga0395900_0000002_345716_346522 | 268 |
| 340 | 3300037418 | Ga0395900_0091736 | Ga0395900_0091736_828_1634 | 268 |
| 341 | 3300037418 | Ga0395900_0229711 | Ga0395900_0229711_974_1780 | 268 |
| 342 | 3300037466 | Ga0395898_0022989 | Ga0395898_0022989_3947_4753 | 268 |
| 343 | 3300037466 | Ga0395898_0042939 | Ga0395898_0042939_3178_3984 | 268 |
| 344 | 3300037466 | Ga0395898_0054819 | Ga0395898_0054819_1792_2598 | 268 |
| 345 | 3300037471 | Ga0395905_0021654 | Ga0395905_0021654_4788_5594 | 268 |
| 346 | 3300037471 | Ga0395905_0027712 | Ga0395905_0027712_3901_4707 | 268 |
| 347 | 3300037471 | Ga0395905_0090233 | Ga0395905_0090233_1905_2711 | 268 |
| 348 | 3300037471 | Ga0395905_0351962 | Ga0395905_0351962_409_1215 | 268 |
| 349 | 3300038443 | Ga0395901_0000013 | Ga0395901_0000013_357263_358069 | 268 |
| 350 | 3300038443 | Ga0395901_0105328 | Ga0395901_0105328_1838_2644 | 268 |
| 351 | 3300038443 | Ga0395901_0341230 | Ga0395901_0341230_632_1438 | 268 |
| 352 | 3300038443 | Ga0395901_0341761 | Ga0395901_0341761_429_1235 | 268 |
| 353 | 3300039437 | Ga0436365_0187494 | Ga0436365_0187494_2017_2859 | 268 |
| 354 | 3300039447 | Ga0436361_0940191 | Ga0436361_0940191_1377_2183 | 268 |
| 355 | 3300039447 | Ga0436361_1069972 | Ga0436361_1069972_20889_21695 | 268 |
| 356 | 3300039453 | Ga0436362_0049463 | Ga0436362_0049463_610_1416 | 268 |
| 357 | 3300041997 | Ga0439431_0027999 | Ga0439431_0027999_198_1004 | 268 |
| 358 | 3300042004 | Ga0439445_0042828 | Ga0439445_0042828_24_830 | 268 |
| 359 | 3300044712 | Ga0453684_0117159 | Ga0453684_0117159_919_1725 | 268 |
| 360 | 3300045049 | Ga0466959_0028432 | Ga0466959_0028432_2765_3571 | 268 |
| 361 | 3300046452 | Ga0495617_061434 | Ga0495617_061434_79_885 | 268 |
| 362 | 3300046457 | Ga0495590_0000467 | Ga0495590_0000467_14501_15307 | 268 |
| 363 | 3300046459 | Ga0495629_0056529 | Ga0495629_0056529_894_1700 | 268 |
| 364 | 3300046460 | Ga0495638_0000283 | Ga0495638_0000283_57227_58033 | 268 |
| 365 | 3300046460 | Ga0495638_0000292 | Ga0495638_0000292_9573_10379 | 268 |
| 366 | 3300046460 | Ga0495638_0000939 | Ga0495638_0000939_26930_27736 | 268 |
| 367 | 3300046460 | Ga0495638_0036419 | Ga0495638_0036419_1097_1903 | 268 |
| 368 | 3300046471 | Ga0495650_0000168 | Ga0495650_0000168_72047_72853 | 268 |
| 369 | 3300046492 | Ga0495585_0113098 | Ga0495585_0113098_137_943 | 268 |
| 370 | 3300046501 | Ga0495607_0017682 | Ga0495607_0017682_1621_2427 | 268 |
| 371 | 3300046506 | Ga0495583_0008671 | Ga0495583_0008671_3481_4287 | 268 |
| 372 | 3300046507 | Ga0495606_0003607 | Ga0495606_0003607_2092_2898 | 268 |
| 373 | 3300046512 | Ga0495610_0001080 | Ga0495610_0001080_21897_22703 | 268 |
| 374 | 3300046512 | Ga0495610_0004585 | Ga0495610_0004585_9288_10094 | 268 |
| 375 | 3300046512 | Ga0495610_0045762 | Ga0495610_0045762_226_1032 | 268 |
| 376 | 3300046513 | Ga0495616_0001277 | Ga0495616_0001277_7236_8042 | 268 |
| 377 | 3300046513 | Ga0495616_0043246 | Ga0495616_0043246_181_987 | 268 |
| 378 | 3300046515 | Ga0495620_0019780 | Ga0495620_0019780_1688_2494 | 268 |
| 379 | 3300046516 | Ga0495628_0096218 | Ga0495628_0096218_412_1218 | 268 |
| 380 | 3300046517 | Ga0495630_0037598 | Ga0495630_0037598_1416_2222 | 268 |
| 381 | 3300046518 | Ga0495631_0004826 | Ga0495631_0004826_4717_5523 | 268 |
| 382 | 3300046519 | Ga0495632_0004711 | Ga0495632_0004711_2046_2852 | 268 |
| 383 | 3300046520 | Ga0495637_0023266 | Ga0495637_0023266_1933_2739 | 268 |
| 384 | 3300046520 | Ga0495637_0062793 | Ga0495637_0062793_330_1136 | 268 |
| 385 | 3300046522 | Ga0495643_0054919 | Ga0495643_0054919_205_1011 | 268 |
| 386 | 3300046522 | Ga0495643_0060500 | Ga0495643_0060500_1066_1872 | 268 |
| 387 | 3300046523 | Ga0495644_0060242 | Ga0495644_0060242_355_1161 | 268 |
| 388 | 3300046524 | Ga0495648_0000107 | Ga0495648_0000107_1681_2487 | 268 |
| 389 | 3300046528 | Ga0495642_0143425 | Ga0495642_0143425_18_824 | 268 |
| 390 | 3300046530 | Ga0495654_0000085 | Ga0495654_0000085_69240_70046 | 268 |
| 391 | 3300046538 | Ga0495609_0020633 | Ga0495609_0020633_817_1623 | 268 |
| 392 | 3300046542 | Ga0495597_0003622 | Ga0495597_0003622_3016_3822 | 268 |
| 393 | 3300046557 | Ga0495622_0012681 | Ga0495622_0012681_944_1750 | 268 |
| 394 | 3300046616 | Ga0495668_0003283 | Ga0495668_0003283_2146_2952 | 268 |
| 395 | 3300046616 | Ga0495668_0006744 | Ga0495668_0006744_1531_2337 | 268 |
| 396 | 3300046616 | Ga0495668_0042080 | Ga0495668_0042080_591_1397 | 268 |
| 397 | 3300046616 | Ga0495668_0074955 | Ga0495668_0074955_158_964 | 268 |
| 398 | 3300046648 | Ga0495611_0004621 | Ga0495611_0004621_3305_4111 | 268 |
| 399 | 3300046660 | Ga0495625_0000034 | Ga0495625_0000034_213514_214320 | 268 |
| 400 | 3300046660 | Ga0495625_0005125 | Ga0495625_0005125_2139_2945 | 268 |
| 401 | 3300046660 | Ga0495625_0005802 | Ga0495625_0005802_2262_3068 | 268 |
| 402 | 3300046660 | Ga0495625_0100003 | Ga0495625_0100003_592_1398 | 268 |
| 403 | 3300046660 | Ga0495625_0105456 | Ga0495625_0105456_25_831 | 268 |
| 404 | 3300046660 | Ga0495625_0112556 | Ga0495625_0112556_203_1009 | 268 |
| 405 | 3300046684 | Ga0495669_0000007 | Ga0495669_0000007_135631_136437 | 268 |
| 406 | 3300046684 | Ga0495669_0000919 | Ga0495669_0000919_7758_8564 | 268 |
| 407 | 3300046684 | Ga0495669_0004238 | Ga0495669_0004238_1003_1809 | 268 |
| 408 | 3300046689 | Ga0495613_0103597 | Ga0495613_0103597_421_1227 | 268 |
| 409 | 3300046691 | Ga0495670_0039294 | Ga0495670_0039294_707_1513 | 268 |
| 410 | 3300046692 | Ga0495671_0023786 | Ga0495671_0023786_947_1753 | 268 |
| 411 | 3300046794 | Ga0495589_0001385 | Ga0495589_0001385_3212_4018 | 268 |
| 412 | 3300047320 | Ga0495672_0001097 | Ga0495672_0001097_9562_10368 | 268 |
| 413 | 3300047445 | Ga0495677_0061942 | Ga0495677_0061942_268_1074 | 268 |
| 414 | 3300047469 | Ga0495673_0000492 | Ga0495673_0000492_120_926 | 268 |
| 415 | 3300047469 | Ga0495673_0000697 | Ga0495673_0000697_887_1693 | 268 |
| 416 | 3300047469 | Ga0495673_0007360 | Ga0495673_0007360_5466_6272 | 268 |
| 417 | 3300047470 | Ga0495681_0043609 | Ga0495681_0043609_1133_1939 | 268 |
| 418 | 3300047472 | Ga0495686_0001488 | Ga0495686_0001488_730_1536 | 268 |
| 419 | 3300047472 | Ga0495686_0004012 | Ga0495686_0004012_10472_11278 | 268 |
| 420 | 3300047472 | Ga0495686_0030422 | Ga0495686_0030422_663_1469 | 268 |
| 421 | 3300047673 | Ga0495593_0033823 | Ga0495593_0033823_1749_2555 | 268 |
| 422 | 3300048904 | Ga0496101_0438544 | Ga0496101_0438544_191_997 | 268 |
| 423 | 3300048906 | Ga0496103_0178823 | Ga0496103_0178823_407_1213 | 268 |
| 424 | 3300048909 | Ga0496106_0536480 | Ga0496106_0536480_71_877 | 268 |
| 425 | 3300048910 | Ga0496107_0000085 | Ga0496107_0000085_10464_11270 | 268 |
| 426 | 3300048910 | Ga0496107_0453614 | Ga0496107_0453614_118_924 | 268 |
| 427 | 3300048911 | Ga0496108_0337507 | Ga0496108_0337507_212_1018 | 268 |
| 428 | 3300048912 | Ga0496109_0074039 | Ga0496109_0074039_1322_2128 | 268 |
| 429 | 3300048915 | Ga0496112_0073457 | Ga0496112_0073457_297_1103 | 268 |
| 430 | 3300048918 | Ga0496115_0001891 | Ga0496115_0001891_1912_2718 | 268 |
| 431 | 3300048918 | Ga0496115_0011589 | Ga0496115_0011589_1097_1903 | 268 |
| 432 | 3300048918 | Ga0496115_0033238 | Ga0496115_0033238_559_1365 | 268 |
| 433 | 3300048918 | Ga0496115_0073234 | Ga0496115_0073234_1019_1825 | 268 |
| 434 | 3300048918 | Ga0496115_0608250 | Ga0496115_0608250_49_855 | 268 |
| 435 | 3300048921 | Ga0496118_0005332 | Ga0496118_0005332_3837_4643 | 268 |
| 436 | 3300048922 | Ga0496119_0106591 | Ga0496119_0106591_153_959 | 268 |
| 437 | 3300048924 | Ga0496121_0000042 | Ga0496121_0000042_304196_305002 | 268 |
| 438 | 3300048924 | Ga0496121_0034434 | Ga0496121_0034434_2846_3652 | 268 |
| 439 | 3300048924 | Ga0496121_0170224 | Ga0496121_0170224_17_823 | 268 |
| 440 | 3300048924 | Ga0496121_0267828 | Ga0496121_0267828_262_1071 | 268 |
| 441 | 3300048927 | Ga0496124_0031229 | Ga0496124_0031229_2310_3116 | 268 |
| 442 | 3300048927 | Ga0496124_0407712 | Ga0496124_0407712_89_895 | 268 |
| 443 | 3300048928 | Ga0496125_0010081 | Ga0496125_0010081_1098_1904 | 268 |
| 444 | 3300048928 | Ga0496125_0058254 | Ga0496125_0058254_1364_2170 | 268 |
| 445 | 3300048929 | Ga0496126_0004759 | Ga0496126_0004759_7463_8269 | 268 |
| 446 | 3300049569 | Ga0501032_0029180 | Ga0501032_0029180_1209_2015 | 268 |
| 447 | 3300049570 | Ga0501033_0002538 | Ga0501033_0002538_14156_14962 | 268 |
| 448 | 3300049570 | Ga0501033_0032648 | Ga0501033_0032648_296_1102 | 268 |
| 449 | 3300049571 | Ga0501034_0294946 | Ga0501034_0294946_240_1046 | 268 |
| 450 | 3300049573 | Ga0501037_0015263 | Ga0501037_0015263_186_992 | 268 |
| 451 | 3300049573 | Ga0501037_0165055 | Ga0501037_0165055_401_1207 | 268 |
| 452 | 3300049581 | Ga0501047_0008331 | Ga0501047_0008331_2102_2908 | 268 |
| 453 | 3300049581 | Ga0501047_0059385 | Ga0501047_0059385_2684_3490 | 268 |
| 454 | 3300049581 | Ga0501047_0325418 | Ga0501047_0325418_550_1356 | 268 |
| 455 | 3300049582 | Ga0501048_0160555 | Ga0501048_0160555_45_851 | 268 |
| 456 | 3300049822 | Ga0501035_0035106 | Ga0501035_0035106_1340_2146 | 268 |
| 457 | 3300049823 | Ga0501044_0005062 | Ga0501044_0005062_4315_5121 | 268 |
| 458 | 3300049823 | Ga0501044_0019605 | Ga0501044_0019605_1235_2041 | 268 |
| 459 | 3300050490 | nmdc:mga03n38_287812_c1 | nmdc:mga03n38_287812_c1_41_847 | 268 |
| 460 | 3300050491 | nmdc:mga00v17_685_c1 | nmdc:mga00v17_685_c1_14647_15453 | 268 |
| 461 | 3300050493 | nmdc:mga0k408_42736_c1 | nmdc:mga0k408_42736_c1_448_1254 | 268 |
| 462 | 3300050495 | nmdc:mga04h51_6330_c1 | nmdc:mga04h51_6330_c1_736_1542 | 268 |
| 463 | 3300050496 | nmdc:mga07m45_56608_c1 | nmdc:mga07m45_56608_c1_619_1425 | 268 |
| 464 | 3300050496 | nmdc:mga07m45_8698_c1 | nmdc:mga07m45_8698_c1_3729_4535 | 268 |
| 465 | 3300050516 | nmdc:mga0sz30_2797_c1 | nmdc:mga0sz30_2797_c1_518_1324 | 268 |
| 466 | 3300053080 | Ga0500635_0000123 | Ga0500635_0000123_12261_13067 | 268 |
| 467 | 3300053087 | Ga0500643_000265 | Ga0500643_000265_32472_33278 | 268 |
| 468 | 3300053087 | Ga0500643_002905 | Ga0500643_002905_6530_7336 | 268 |
| 469 | 3300053087 | Ga0500643_004445 | Ga0500643_004445_1804_2610 | 268 |
| 470 | 3300053087 | Ga0500643_005542 | Ga0500643_005542_864_1670 | 268 |
| 471 | 3300053087 | Ga0500643_011598 | Ga0500643_011598_1002_1808 | 268 |
| 472 | 3300053088 | Ga0500644_0000124 | Ga0500644_0000124_1088_1894 | 268 |
| 473 | 3300053090 | Ga0500646_0066997 | Ga0500646_0066997_214_1020 | 268 |
| 474 | 3300053091 | Ga0500647_0001502 | Ga0500647_0001502_4236_5042 | 268 |
| 475 | 3300053092 | Ga0500583_0028302 | Ga0500583_0028302_879_1685 | 268 |
| 476 | 3300053093 | Ga0500651_0079971 | Ga0500651_0079971_1175_1981 | 268 |
| 477 | 3300053094 | Ga0500566_0033378 | Ga0500566_0033378_2151_2957 | 268 |
| 478 | 3300053096 | Ga0500641_0000871 | Ga0500641_0000871_9923_10729 | 268 |
| 479 | 3300053096 | Ga0500641_0001351 | Ga0500641_0001351_2915_3721 | 268 |
| 480 | 3300053096 | Ga0500641_0194437 | Ga0500641_0194437_38_844 | 268 |
| 481 | 3300053098 | Ga0500650_0032999 | Ga0500650_0032999_1154_1960 | 268 |
| 482 | 3300053102 | Ga0500554_047911 | Ga0500554_047911_24_830 | 268 |
| 483 | 3300053103 | Ga0500555_013525 | Ga0500555_013525_695_1501 | 268 |
| 484 | 3300053103 | Ga0500555_014601 | Ga0500555_014601_94_900 | 268 |
| 485 | 3300053104 | Ga0500556_0001023 | Ga0500556_0001023_10956_11762 | 268 |
| 486 | 3300053104 | Ga0500556_0037442 | Ga0500556_0037442_435_1241 | 268 |
| 487 | 3300053108 | Ga0500562_002828 | Ga0500562_002828_84_890 | 268 |
| 488 | 3300053108 | Ga0500562_003821 | Ga0500562_003821_2968_3774 | 268 |
| 489 | 3300053108 | Ga0500562_004079 | Ga0500562_004079_631_1440 | 268 |
| 490 | 3300053109 | Ga0500569_002611 | Ga0500569_002611_1873_2679 | 268 |
| 491 | 3300053111 | Ga0500572_002628 | Ga0500572_002628_1867_2673 | 268 |
| 492 | 3300053117 | Ga0500593_033222 | Ga0500593_033222_763_1572 | 268 |
| 493 | 3300053119 | Ga0500595_002332 | Ga0500595_002332_5789_6595 | 268 |
| 494 | 3300053119 | Ga0500595_008312 | Ga0500595_008312_3205_4017 | 268 |
| 495 | 3300053119 | Ga0500595_009160 | Ga0500595_009160_1528_2334 | 268 |
| 496 | 3300053120 | Ga0500597_097732 | Ga0500597_097732_359_1165 | 268 |
| 497 | 3300053121 | Ga0500607_205471 | Ga0500607_205471_17_823 | 268 |
| 498 | 3300053122 | Ga0500608_000011 | Ga0500608_000011_11369_12175 | 268 |
| 499 | 3300053122 | Ga0500608_001751 | Ga0500608_001751_3844_4650 | 268 |
| 500 | 3300053123 | Ga0500614_001062 | Ga0500614_001062_4242_5048 | 268 |
| 501 | 3300053130 | Ga0500642_0018179 | Ga0500642_0018179_271_1077 | 268 |
| 502 | 3300053133 | Ga0500655_025410 | Ga0500655_025410_60_866 | 268 |
| 503 | 3300053134 | Ga0500658_0002725 | Ga0500658_0002725_2469_3275 | 268 |
| 504 | 3300053136 | Ga0500559_0000004 | Ga0500559_0000004_223495_224301 | 268 |
| 505 | 3300053136 | Ga0500559_0005404 | Ga0500559_0005404_2896_3702 | 268 |
| 506 | 3300053136 | Ga0500559_0014378 | Ga0500559_0014378_1654_2460 | 268 |
| 507 | 3300053136 | Ga0500559_0025335 | Ga0500559_0025335_895_1701 | 268 |
| 508 | 3300053136 | Ga0500559_0127772 | Ga0500559_0127772_120_926 | 268 |
| 509 | 3300053138 | Ga0500564_000063 | Ga0500564_000063_27590_28396 | 268 |
| 510 | 3300053142 | Ga0500577_0012108 | Ga0500577_0012108_788_1594 | 268 |
| 511 | 3300053148 | Ga0500590_046523 | Ga0500590_046523_513_1319 | 268 |
| 512 | 3300053151 | Ga0500604_0023031 | Ga0500604_0023031_886_1692 | 268 |
| 513 | 3300053153 | Ga0500616_0005230 | Ga0500616_0005230_1113_1919 | 268 |
| 514 | 3300053153 | Ga0500616_0044842 | Ga0500616_0044842_273_1079 | 268 |
| 515 | 3300053154 | Ga0500619_004773 | Ga0500619_004773_735_1541 | 268 |
| 516 | 3300053156 | Ga0500622_0000643 | Ga0500622_0000643_20142_20948 | 268 |
| 517 | 3300053156 | Ga0500622_0005996 | Ga0500622_0005996_1821_2630 | 268 |
| 518 | 3300053156 | Ga0500622_0023760 | Ga0500622_0023760_1323_2129 | 268 |
| 519 | 3300053156 | Ga0500622_0042108 | Ga0500622_0042108_1019_1825 | 268 |
| 520 | 3300053163 | Ga0500639_084571 | Ga0500639_084571_44_850 | 268 |
| 521 | 3300053177 | Ga0500636_0003167 | Ga0500636_0003167_8081_8887 | 268 |
| 522 | 3300053178 | Ga0500637_0005271 | Ga0500637_0005271_5067_5873 | 268 |
| 523 | 3300053178 | Ga0500637_0098026 | Ga0500637_0098026_602_1408 | 268 |
| 524 | 3300053725 | Ga0500576_041914 | Ga0500576_041914_464_1270 | 268 |
| 525 | 3300053730 | Ga0500645_001143 | Ga0500645_001143_4508_5317 | 268 |
| 526 | 3300053730 | Ga0500645_001630 | Ga0500645_001630_2329_3135 | 268 |
| 527 | 3300053730 | Ga0500645_013157 | Ga0500645_013157_1362_2168 | 268 |
| 528 | 3300053730 | Ga0500645_091407 | Ga0500645_091407_21_830 | 268 |
| 529 | 3300053733 | Ga0500552_004704 | Ga0500552_004704_136_942 | 268 |
| 530 | 3300053735 | Ga0500596_000393 | Ga0500596_000393_5988_6794 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9342 | 3 | 268 |
| 2voa-assembly1.cif.gz_B | structure of an ap endonuclease from archaeoglobus fulgidus | 0.9272 | 3 | 268 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9178 | 3 | 266 |
| 6fke-assembly1.cif.gz_A | structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin | 0.9041 | 3 | 266 |
| 2jc4-assembly1.cif.gz_A | 3'-5' exonuclease (nexo) from neisseria meningitidis | 0.9037 | 3 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9318 | 3 | 268 | 3.60.10.10 |
| 2voaB00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9248 | 3 | 268 | 3.60.10.10 |
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.9102 | 3 | 266 | 3.60.10.10 |
| 6fk4A00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.8966 | 3 | 266 | 3.60.10.10 |
| af_P09030_1_268_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.8762 | 3 | 268 | 3.60.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354EQZ5-F1-model_v4 | Exodeoxyribonuclease III | 0.9933 | 1 | 174 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-A0A0V2F737-F1-model_v4 | deleted | 0.9912 | 1 | 268 |
|
| AF-A0A4Q3SZN9-F1-model_v4 | Exodeoxyribonuclease III | 0.991 | 1 | 144 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 |
| AF-A0A258DE36-F1-model_v4 | Exodeoxyribonuclease III | 0.9884 | 29 | 268 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 GO:0046872 |
| AF-A0A4Q3SZN9-F1-model_v4 | Exodeoxyribonuclease III | 0.9842 | 1 | 144 |
GO:0003677
GO:0004519 GO:0006281 GO:0008311 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar