F459906

General Info

Members Datasets Scaffolds Average Seq Length
530 278 501 268

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10219407|Ga0070658_102194072
Length 296
Sequence MRDHYQRPALASRAFFCARPSRACYPMPMRLRVCTWNVNSVRLRAEQVARFVRDHAPDVLCMQEIKCQNGEFPAEAFVEMGLPHLRIAGQKGWHGVAIASRLPIEDAPHLDICREKHARCVSGIVAGVEIQNFYIPAGGDLPDRELNPKFDHKLDFYEKLTAEMTRRDPKAPLIVTGDLNVAPGEFDVWNHRYMSKIVSHTPVEIEAFARLMASLGFTNILREAVPEPEKLASWWSYRAQDFRQSNRGLLLDHLLLSPGLREAAFRLGAPAARVHDDVREWEKPSDHAPVSVDLGL

Samples

Sample ID Description Type Environment
1 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
2 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
3 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
4 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
5 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
6 2643221583 Caulobacter sp. Root655 Isolate Unclassified
7 2643221584 Caulobacter sp. Root656 Isolate Unclassified
8 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
9 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
13 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
14 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
15 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
16 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
17 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
18 2849560528 Caulobacter zeae 410 Isolate Unclassified
19 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
20 2851153111 Caulobacter radicis 736 Isolate Unclassified
21 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
22 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
23 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
24 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
25 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
26 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
27 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
28 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
241 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
242 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
243 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
247 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
248 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
249 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
250 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
251 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
252 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
253 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
254 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
257 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
260 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
261 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
262 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
263 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
264 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
265 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
266 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
267 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
272 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
273 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
274 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
275 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
276 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
277 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
278 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.08
Nodule 0
Rhizoplane 2.64
Rhizosphere 65.85
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10042095 3300003320 Bacteria 1315
2 Ga0055524_1011000 3300003775 Bacteria 3563
3 Ga0055536_1003526 3300003781 Bacteria 8378
4 Ga0055536_1008141 3300003781 Bacteria 4564
5 Ga0055536_1009453 3300003781 Bacteria 4032
6 Ga0055528_1015927 3300003790 Bacteria 2687
7 Ga0055530_10000313 3300003791 Bacteria 44170
8 Ga0055530_10002661 3300003791 Bacteria 11168
9 Ga0055530_10006718 3300003791 Bacteria 5042
10 Ga0055531_10002220 3300003794 Bacteria 13181
11 Ga0055531_10004699 3300003794 Bacteria 8176
12 Ga0065165_1000583 3300005262 Bacteria 53842
13 Ga0070658_10219407 3300005327 Bacteria 1608
14 Ga0070670_100000007 3300005331 Bacteria 318672
15 Ga0070666_10039451 3300005335 Bacteria 3148
16 Ga0070666_10071226 3300005335 Bacteria 2366
17 Ga0070666_10288247 3300005335 Bacteria 1168
18 Ga0070680_100169189 3300005336 Bacteria 1838
19 Ga0070668_100000272 3300005347 Bacteria 34235
20 Ga0070668_100005382 3300005347 Bacteria 9498
21 Ga0070668_100010729 3300005347 Bacteria 6813
22 Ga0070668_100044636 3300005347 Bacteria 3400
23 Ga0070668_100117006 3300005347 Bacteria 2126
24 Ga0070669_100001157 3300005353 Bacteria 19280
25 Ga0070669_100009792 3300005353 Bacteria 6826
26 Ga0070671_100001426 3300005355 Bacteria 17856
27 Ga0070671_100168959 3300005355 Bacteria 1849
28 Ga0070659_100002510 3300005366 Bacteria 13029
29 Ga0070659_100012009 3300005366 Bacteria 6411
30 Ga0070659_100041439 3300005366 Bacteria 3599
31 Ga0070667_100000291 3300005367 Bacteria 56512
32 Ga0070667_100004267 3300005367 Bacteria 12069
33 Ga0070667_100006296 3300005367 Bacteria 9865
34 Ga0070667_100010607 3300005367 Bacteria 7608
35 Ga0070681_10042288 3300005458 Bacteria 4566
36 Ga0070681_10156607 3300005458 Bacteria 2202
37 Ga0070679_100141555 3300005530 Bacteria 2384
38 Ga0068853_100029369 3300005539 Bacteria 4634
39 Ga0068853_100179815 3300005539 Bacteria 1918
40 Ga0070665_100000395 3300005548 Bacteria 64323
41 Ga0070665_100002782 3300005548 Bacteria 18967
42 Ga0070665_100017425 3300005548 Bacteria 7211
43 Ga0070665_100155747 3300005548 Bacteria 2287
44 Ga0068855_100034109 3300005563 Bacteria 6072
45 Ga0068855_100156944 3300005563 Bacteria 2585
46 Ga0068855_100394587 3300005563 Bacteria 1517
47 Ga0068855_100422748 3300005563 Bacteria 1457
48 Ga0070664_100011039 3300005564 Bacteria 7325
49 Ga0070664_100097198 3300005564 Bacteria 2556
50 Ga0068854_100311900 3300005578 Bacteria 1276
51 Ga0068856_100096630 3300005614 Bacteria 2943
52 Ga0068856_100726928 3300005614 Bacteria 1013
53 Ga0068852_100258988 3300005616 Bacteria 1670
54 Ga0068859_100001326 3300005617 Bacteria 25257
55 Ga0068859_100001699 3300005617 Bacteria 22416
56 Ga0068864_100002407 3300005618 Bacteria 15450
57 Ga0068864_100003084 3300005618 Bacteria 13759
58 Ga0068864_100086573 3300005618 Bacteria 2757
59 Ga0068864_100167963 3300005618 Bacteria 1999
60 Ga0068864_100365885 3300005618 Bacteria 1364
61 Ga0068863_100000262 3300005841 Bacteria 55027
62 Ga0068863_100003500 3300005841 Bacteria 15493
63 Ga0068863_100003720 3300005841 Bacteria 15086
64 Ga0068863_100044605 3300005841 Bacteria 4208
65 Ga0068863_100602868 3300005841 Bacteria 1087
66 Ga0068858_100001577 3300005842 Bacteria 23351
67 Ga0068858_100011317 3300005842 Bacteria 8428
68 Ga0068858_100074394 3300005842 Bacteria 3154
69 Ga0068860_100000047 3300005843 Bacteria 213287
70 Ga0068860_100002126 3300005843 Bacteria 20896
71 Ga0068860_100003451 3300005843 Bacteria 16259
72 Ga0068862_100004496 3300005844 Bacteria 11756
73 Ga0068862_100035969 3300005844 Bacteria 4195
74 Ga0068862_100062514 3300005844 Bacteria 3202
75 Ga0068862_100096486 3300005844 Bacteria 2581
76 Ga0075364_10000600 3300006051 Bacteria 18642
77 Ga0075367_10053550 3300006178 Bacteria 2391
78 Ga0075366_10040517 3300006195 Bacteria 2755
79 Ga0075370_10027305 3300006353 Bacteria 3166
80 Ga0097620_100001326 3300006931 Bacteria 25257
81 Ga0097620_100001698 3300006931 Bacteria 22416
82 Ga0105250_10048171 3300009092 Bacteria 1710
83 Ga0105240_10003418 3300009093 Bacteria 24667
84 Ga0105240_10004843 3300009093 Bacteria 20283
85 Ga0105240_10012284 3300009093 Bacteria 11833
86 Ga0105240_10100147 3300009093 Bacteria 3526
87 Ga0105240_10163340 3300009093 Bacteria 2643
88 Ga0105240_10864653 3300009093 Bacteria 975
89 Ga0105245_10146375 3300009098 Bacteria 2229
90 Ga0105247_10058669 3300009101 Bacteria 2381
91 Ga0105248_10000746 3300009177 Bacteria 36566
92 Ga0105248_10001254 3300009177 Bacteria 28372
93 Ga0105248_10001644 3300009177 Bacteria 24861
94 Ga0105248_10010845 3300009177 Bacteria 10062
95 Ga0105248_10064392 3300009177 Bacteria 4116
96 Ga0105248_10363005 3300009177 Bacteria 1631
97 Ga0105248_10571402 3300009177 Bacteria 1276
98 Ga0105237_10246297 3300009545 Bacteria 1789
99 Ga0105238_10079187 3300009551 Bacteria 3276
100 Ga0105238_10107149 3300009551 Bacteria 2776
101 Ga0105238_10554103 3300009551 Bacteria 1154
102 Ga0105238_10700525 3300009551 Bacteria 1025
103 Ga0105249_10002418 3300009553 Bacteria 16212
104 Ga0105249_10284569 3300009553 Bacteria 1652
105 Ga0105249_10444750 3300009553 Bacteria 1334
106 Ga0105249_10578067 3300009553 Bacteria 1176
107 Ga0105239_10071623 3300010375 Bacteria 3808
108 Ga0105239_10119796 3300010375 Bacteria 2922
109 Ga0157373_10000879 3300013100 Bacteria 23263
110 Ga0157373_10002637 3300013100 Bacteria 13606
111 Ga0157371_10007280 3300013102 Bacteria 8989
112 Ga0157370_10019913 3300013104 Bacteria 6713
113 Ga0157370_10185989 3300013104 Bacteria 1929
114 Ga0157369_10020217 3300013105 Bacteria 7444
115 Ga0157369_10170137 3300013105 Bacteria 2296
116 Ga0157369_10709319 3300013105 Bacteria 1036
117 Ga0163162_10153192 3300013306 Bacteria 2424
118 Ga0163162_11025038 3300013306 Bacteria 933
119 Ga0157375_10240189 3300013308 Bacteria 1971
120 Ga0163163_10008395 3300014325 Bacteria 9173
121 Ga0163163_10041831 3300014325 Bacteria 4484
122 Ga0163163_10092487 3300014325 Bacteria 3040
123 Ga0163163_10145338 3300014325 Bacteria 2415
124 Ga0163163_10163368 3300014325 Bacteria 2273
125 Ga0163163_10179468 3300014325 Bacteria 2164
126 Ga0163163_10572141 3300014325 Bacteria 1193
127 Ga0157377_10192011 3300014745 Bacteria 1291
128 Ga0157379_10003580 3300014968 Bacteria 13164
129 Ga0157379_10024480 3300014968 Bacteria 5359
130 Ga0157379_10059719 3300014968 Bacteria 3410
131 Ga0157379_10152607 3300014968 Bacteria 2084
132 Ga0157376_10344179 3300014969 Bacteria 1425
133 Ga0213872_10008803 3300021361 Bacteria 4871
134 Ga0213872_10020485 3300021361 Bacteria 3048
135 Ga0213876_10000081 3300021384 Bacteria 108997
136 Ga0213876_10077415 3300021384 Bacteria 1757
137 Ga0209026_1001196 3300025250 Bacteria 12024
138 Ga0209148_1010595 3300025254 Bacteria 1742
139 Ga0209565_1000090 3300025263 Bacteria 146540
140 Ga0209673_1004907 3300025273 Bacteria 6967
141 Ga0209676_1000140 3300025292 Bacteria 176735
142 Ga0209676_1000257 3300025292 Bacteria 112662
143 Ga0209676_1001860 3300025292 Bacteria 17366
144 Ga0209676_1005474 3300025292 Bacteria 6626
145 Ga0209564_1015123 3300025295 Bacteria 3159
146 Ga0209758_1001380 3300025297 Bacteria 28958
147 Ga0209758_1002555 3300025297 Bacteria 18327
148 Ga0209050_1000053 3300025298 Bacteria 349521
149 Ga0209050_1003986 3300025298 Bacteria 10412
150 Ga0209050_1006790 3300025298 Bacteria 6668
151 Ga0209050_1012795 3300025298 Bacteria 3805
152 Ga0209256_1008640 3300025299 Bacteria 4667
153 Ga0209256_1026005 3300025299 Bacteria 1695
154 Ga0209256_1027974 3300025299 Bacteria 1598
155 Ga0209051_1000743 3300025303 Bacteria 35022
156 Ga0209257_1000292 3300025304 Bacteria 110440
157 Ga0209257_1000419 3300025304 Bacteria 81956
158 Ga0209257_1000624 3300025304 Bacteria 56974
159 Ga0209257_1003494 3300025304 Bacteria 13386
160 Ga0209257_1006554 3300025304 Bacteria 7426
161 Ga0207680_10020782 3300025903 Bacteria 3542
162 Ga0207680_10024436 3300025903 Bacteria 3316
163 Ga0207680_10041937 3300025903 Bacteria 2674
164 Ga0207705_10001195 3300025909 Bacteria 21043
165 Ga0207707_10237260 3300025912 Bacteria 1586
166 Ga0207695_10000269 3300025913 Bacteria 130183
167 Ga0207695_10000886 3300025913 Bacteria 54376
168 Ga0207695_10010613 3300025913 Bacteria 11257
169 Ga0207695_10057503 3300025913 Bacteria 4039
170 Ga0207695_10090094 3300025913 Bacteria 3083
171 Ga0207695_10291095 3300025913 Bacteria 1525
172 Ga0207671_10171187 3300025914 Bacteria 1686
173 Ga0207660_10007322 3300025917 Bacteria 7142
174 Ga0207657_10000235 3300025919 Bacteria 58394
175 Ga0207652_10083115 3300025921 Bacteria 2803
176 Ga0207681_10014772 3300025923 Bacteria 4861
177 Ga0207681_10094346 3300025923 Bacteria 2144
178 Ga0207694_10020782 3300025924 Bacteria 4969
179 Ga0207694_10065289 3300025924 Bacteria 2837
180 Ga0207694_10084995 3300025924 Bacteria 2489
181 Ga0207650_10000033 3300025925 Bacteria 226809
182 Ga0207650_10025851 3300025925 Bacteria 4184
183 Ga0207687_10125590 3300025927 Bacteria 1926
184 Ga0207644_10003812 3300025931 Bacteria 9764
185 Ga0207644_10016427 3300025931 Bacteria 4979
186 Ga0207644_10288034 3300025931 Bacteria 1320
187 Ga0207690_10000031 3300025932 Bacteria 154724
188 Ga0207690_10026967 3300025932 Bacteria 3626
189 Ga0207690_10072722 3300025932 Bacteria 2375
190 Ga0207706_10044166 3300025933 Bacteria 3950
191 Ga0207686_10190485 3300025934 Bacteria 1462
192 Ga0207711_10000331 3300025941 Bacteria 50472
193 Ga0207711_10000764 3300025941 Bacteria 31611
194 Ga0207711_10005910 3300025941 Bacteria 10337
195 Ga0207711_10099228 3300025941 Bacteria 2574
196 Ga0207711_10247650 3300025941 Bacteria 1635
197 Ga0207679_10073590 3300025945 Bacteria 2586
198 Ga0207679_10083989 3300025945 Bacteria 2443
199 Ga0207667_10006978 3300025949 Bacteria 13647
200 Ga0207667_10009903 3300025949 Bacteria 11181
201 Ga0207667_10009952 3300025949 Bacteria 11153
202 Ga0207667_10125857 3300025949 Bacteria 2640
203 Ga0207667_10164800 3300025949 Bacteria 2279
204 Ga0207667_10367531 3300025949 Bacteria 1466
205 Ga0207712_10001293 3300025961 Bacteria 17165
206 Ga0207712_10383893 3300025961 Bacteria 1176
207 Ga0207668_10000013 3300025972 Bacteria 167989
208 Ga0207668_10001021 3300025972 Bacteria 16758
209 Ga0207668_10002317 3300025972 Bacteria 11116
210 Ga0207668_10006177 3300025972 Bacteria 7068
211 Ga0207668_10018010 3300025972 Bacteria 4436
212 Ga0207668_10288338 3300025972 Bacteria 1349
213 Ga0207658_10000323 3300025986 Bacteria 48151
214 Ga0207658_10002054 3300025986 Bacteria 15002
215 Ga0207658_10055831 3300025986 Bacteria 2928
216 Ga0207658_10093017 3300025986 Bacteria 2343
217 Ga0207658_10318727 3300025986 Bacteria 1345
218 Ga0207703_10000027 3300026035 Bacteria 209608
219 Ga0207703_10006596 3300026035 Bacteria 9263
220 Ga0207703_10007679 3300026035 Bacteria 8547
221 Ga0207703_10038927 3300026035 Bacteria 3798
222 Ga0207703_10132568 3300026035 Bacteria 2154
223 Ga0207639_10034526 3300026041 Bacteria 3738
224 Ga0207702_10144845 3300026078 Bacteria 2155
225 Ga0207702_10344429 3300026078 Bacteria 1424
226 Ga0207702_10575389 3300026078 Bacteria 1104
227 Ga0207641_10000003 3300026088 Bacteria 496984
228 Ga0207641_10004327 3300026088 Bacteria 12331
229 Ga0207641_10005567 3300026088 Bacteria 10738
230 Ga0207641_10083996 3300026088 Bacteria 2771
231 Ga0207676_10000135 3300026095 Bacteria 64914
232 Ga0207676_10000203 3300026095 Bacteria 51550
233 Ga0207676_10087279 3300026095 Bacteria 2551
234 Ga0207674_10490161 3300026116 Bacteria 1188
235 Ga0209999_1000895 3300027543 Bacteria 4996
236 Ga0209983_1003347 3300027665 Bacteria 3436
237 Ga0209813_10031727 3300027866 Bacteria 1561
238 Ga0268266_10000003 3300028379 Bacteria 1701703
239 Ga0268266_10003032 3300028379 Bacteria 17238
240 Ga0268266_10021376 3300028379 Bacteria 5512
241 Ga0268266_10183772 3300028379 Bacteria 1905
242 Ga0268266_10658341 3300028379 Bacteria 1008
243 Ga0268265_10002897 3300028380 Bacteria 12605
244 Ga0268265_10063519 3300028380 Bacteria 2841
245 Ga0268265_10064068 3300028380 Bacteria 2830
246 Ga0268265_10303534 3300028380 Bacteria 1438
247 Ga0268264_10000113 3300028381 Bacteria 203262
248 Ga0268264_10000205 3300028381 Bacteria 120743
249 Ga0268264_10005653 3300028381 Bacteria 10596
250 Ga0268264_10339598 3300028381 Bacteria 1426
251 Ga0307517_10011953 3300028786 Bacteria 11980
252 Ga0307517_10024392 3300028786 Bacteria 7456
253 Ga0307517_10078738 3300028786 Bacteria 2846
254 Ga0265338_10040359 3300028800 Bacteria 4385
255 Ga0265338_10047904 3300028800 Bacteria 3896
256 Ga0265338_10099439 3300028800 Bacteria 2376
257 Ga0265338_10142249 3300028800 Bacteria 1877
258 Ga0265338_10186049 3300028800 Bacteria 1579
259 Ga0265328_10000370 3300031239 Bacteria 20970
260 Ga0265328_10002129 3300031239 Bacteria 8937
261 Ga0265328_10034348 3300031239 Bacteria 1878
262 Ga0265331_10184466 3300031250 Bacteria 942
263 Ga0265327_10000331 3300031251 Bacteria 89636
264 Ga0265327_10001088 3300031251 Bacteria 37825
265 Ga0265327_10001225 3300031251 Bacteria 34433
266 Ga0307513_10000178 3300031456 Bacteria 91751
267 Ga0307513_10021691 3300031456 Bacteria 7576
268 Ga0307513_10027358 3300031456 Bacteria 6550
269 Ga0265314_10116665 3300031711 Bacteria 1688
270 Ga0307516_10000144 3300031730 Bacteria 87138
271 Ga0307413_10361626 3300031824 Bacteria 1124
272 Ga0307413_10393883 3300031824 Bacteria 1083
273 Ga0307410_10158181 3300031852 Bacteria 1695
274 Ga0307412_10002217 3300031911 Bacteria 10785
275 Ga0307414_10048083 3300032004 Bacteria 2940
276 Ga0307414_10051035 3300032004 Bacteria 2869
277 Ga0307414_10056959 3300032004 Bacteria 2744
278 Ga0307414_10068561 3300032004 Bacteria 2546
279 Ga0307414_10101841 3300032004 Bacteria 2163
280 Ga0307414_10200853 3300032004 Bacteria 1621
281 Ga0307414_10200925 3300032004 Bacteria 1621
282 Ga0307414_10455031 3300032004 Bacteria 1123
283 Ga0307415_100415475 3300032126 Bacteria 1153
284 Ga0307510_10012875 3300033180 Bacteria 9930
285 Ga0373926_0037853 3300035083 Bacteria 1717
286 Ga0373936_0004232 3300035113 Bacteria 5417
287 Ga0373927_0007778 3300035695 Bacteria 7249
288 Ga0373947_0319358 3300035725 Bacteria 1038
289 Ga0373937_0496997 3300036401 Bacteria 1159
290 Ga0373925_0000653 3300037068 Bacteria 32591
291 Ga0373925_0031244 3300037068 Bacteria 3913
292 Ga0395899_0000003 3300037312 Bacteria 1232684
293 Ga0395899_0002855 3300037312 Bacteria 13906
294 Ga0395900_0000002 3300037418 Bacteria 671103
295 Ga0395900_0091736 3300037418 Bacteria 3121
296 Ga0395900_0229711 3300037418 Bacteria 1866
297 Ga0395898_0022989 3300037466 Bacteria 6304
298 Ga0395898_0042939 3300037466 Bacteria 4458
299 Ga0395898_0054819 3300037466 Bacteria 3889
300 Ga0395905_0021654 3300037471 Bacteria 6080
301 Ga0395905_0027712 3300037471 Bacteria 5342
302 Ga0395905_0090233 3300037471 Bacteria 2873
303 Ga0395905_0351962 3300037471 Bacteria 1365
304 Ga0436364_0873267 3300037853 Bacteria 1512
305 Ga0395901_0000013 3300038443 Bacteria 375733
306 Ga0395901_0105328 3300038443 Bacteria 2960
307 Ga0395901_0341230 3300038443 Bacteria 1548
308 Ga0395901_0341761 3300038443 Bacteria 1546
309 Ga0436365_0187494 3300039437 Bacteria 67801
310 Ga0436365_1028735 3300039437 Bacteria 924
311 Ga0436361_0940191 3300039447 Bacteria 3365
312 Ga0436361_1069972 3300039447 Bacteria 36104
313 Ga0436362_0049463 3300039453 Bacteria 1501
314 Ga0439431_0027999 3300041997 Bacteria 1386
315 Ga0439445_0042828 3300042004 Bacteria 1207
316 Ga0453684_0117159 3300044712 Bacteria 3224
317 Ga0466959_0028432 3300045049 Bacteria 4146
318 Ga0495617_061434 3300046452 Bacteria 1242
319 Ga0495590_0000467 3300046457 Bacteria 20006
320 Ga0495629_0056529 3300046459 Bacteria 2743
321 Ga0495638_0000283 3300046460 Bacteria 67742
322 Ga0495638_0000292 3300046460 Bacteria 65766
323 Ga0495638_0000939 3300046460 Bacteria 29527
324 Ga0495638_0036419 3300046460 Bacteria 3135
325 Ga0495650_0000168 3300046471 Bacteria 145714
326 Ga0495585_0113098 3300046492 Bacteria 1442
327 Ga0495607_0017682 3300046501 Bacteria 4568
328 Ga0495583_0008671 3300046506 Bacteria 6185
329 Ga0495606_0003607 3300046507 Bacteria 16276
330 Ga0495610_0001080 3300046512 Bacteria 24952
331 Ga0495610_0004585 3300046512 Bacteria 10134
332 Ga0495610_0045762 3300046512 Bacteria 2163
333 Ga0495616_0001277 3300046513 Bacteria 17673
334 Ga0495616_0043246 3300046513 Bacteria 2289
335 Ga0495620_0019780 3300046515 Bacteria 3302
336 Ga0495628_0096218 3300046516 Bacteria 2287
337 Ga0495630_0037598 3300046517 Bacteria 3620
338 Ga0495631_0004826 3300046518 Bacteria 7106
339 Ga0495632_0004711 3300046519 Bacteria 9207
340 Ga0495637_0023266 3300046520 Bacteria 2818
341 Ga0495637_0062793 3300046520 Bacteria 1519
342 Ga0495643_0054919 3300046522 Bacteria 2130
343 Ga0495643_0060500 3300046522 Bacteria 2010
344 Ga0495644_0060242 3300046523 Bacteria 1427
345 Ga0495648_0000107 3300046524 Bacteria 104376
346 Ga0495642_0143425 3300046528 Bacteria 1031
347 Ga0495654_0000085 3300046530 Bacteria 107010
348 Ga0495598_0044498 3300046537 Bacteria 1312
349 Ga0495609_0020633 3300046538 Bacteria 3043
350 Ga0495597_0003622 3300046542 Bacteria 8887
351 Ga0495622_0012681 3300046557 Bacteria 3906
352 Ga0495633_0001477 3300046558 Bacteria 18231
353 Ga0495668_0003283 3300046616 Bacteria 12284
354 Ga0495668_0006744 3300046616 Bacteria 7468
355 Ga0495668_0042080 3300046616 Bacteria 2543
356 Ga0495668_0074955 3300046616 Bacteria 1858
357 Ga0495611_0004621 3300046648 Bacteria 5923
358 Ga0495625_0000034 3300046660 Bacteria 225120
359 Ga0495625_0005125 3300046660 Bacteria 12110
360 Ga0495625_0005802 3300046660 Bacteria 11152
361 Ga0495625_0100003 3300046660 Bacteria 1993
362 Ga0495625_0105456 3300046660 Bacteria 1930
363 Ga0495625_0112556 3300046660 Bacteria 1859
364 Ga0495669_0000007 3300046684 Bacteria 180797
365 Ga0495669_0000919 3300046684 Bacteria 12304
366 Ga0495669_0004238 3300046684 Bacteria 5907
367 Ga0495613_0103597 3300046689 Bacteria 2054
368 Ga0495670_0039294 3300046691 Bacteria 2360
369 Ga0495671_0023786 3300046692 Bacteria 3199
370 Ga0495649_0000171 3300046694 Bacteria 56672
371 Ga0495589_0001385 3300046794 Bacteria 14102
372 Ga0495672_0001097 3300047320 Bacteria 27486
373 Ga0495677_0061942 3300047445 Bacteria 1388
374 Ga0495673_0000492 3300047469 Bacteria 42153
375 Ga0495673_0000697 3300047469 Bacteria 32802
376 Ga0495673_0007360 3300047469 Bacteria 6343
377 Ga0495681_0043609 3300047470 Bacteria 2161
378 Ga0495686_0001488 3300047472 Bacteria 25389
379 Ga0495686_0004012 3300047472 Bacteria 12315
380 Ga0495686_0030422 3300047472 Bacteria 3506
381 Ga0495593_0033823 3300047673 Bacteria 2782
382 Ga0496101_0438544 3300048904 Bacteria 1030
383 Ga0496103_0178823 3300048906 Bacteria 1363
384 Ga0496106_0536480 3300048909 Bacteria 939
385 Ga0496107_0000085 3300048910 Bacteria 44306
386 Ga0496107_0453614 3300048910 Bacteria 952
387 Ga0496108_0337507 3300048911 Bacteria 1315
388 Ga0496109_0074039 3300048912 Bacteria 3130
389 Ga0496112_0073457 3300048915 Bacteria 3381
390 Ga0496115_0001891 3300048918 Bacteria 14988
391 Ga0496115_0003837 3300048918 Bacteria 10833
392 Ga0496115_0011589 3300048918 Bacteria 6612
393 Ga0496115_0033238 3300048918 Bacteria 4071
394 Ga0496115_0073234 3300048918 Bacteria 2780
395 Ga0496115_0608250 3300048918 Bacteria 868
396 Ga0496116_0030216 3300048919 Bacteria 3896
397 Ga0496118_0005332 3300048921 Bacteria 14647
398 Ga0496119_0106591 3300048922 Bacteria 1563
399 Ga0496121_0000042 3300048924 Bacteria 342304
400 Ga0496121_0034434 3300048924 Bacteria 4558
401 Ga0496121_0170224 3300048924 Bacteria 1583
402 Ga0496121_0267828 3300048924 Bacteria 1176
403 Ga0496122_0002925 3300048925 Bacteria 23284
404 Ga0496123_0219862 3300048926 Bacteria 959
405 Ga0496124_0031229 3300048927 Bacteria 4718
406 Ga0496124_0407712 3300048927 Bacteria 941
407 Ga0496125_0004796 3300048928 Bacteria 15397
408 Ga0496125_0010081 3300048928 Bacteria 9586
409 Ga0496125_0058254 3300048928 Bacteria 3122
410 Ga0496126_0004759 3300048929 Bacteria 15996
411 Ga0501032_0029180 3300049569 Bacteria 3788
412 Ga0501033_0002538 3300049570 Bacteria 15455
413 Ga0501033_0032648 3300049570 Bacteria 3910
414 Ga0501034_0294946 3300049571 Bacteria 1559
415 Ga0501037_0015263 3300049573 Bacteria 5651
416 Ga0501037_0165055 3300049573 Bacteria 1577
417 Ga0501047_0008331 3300049581 Bacteria 9785
418 Ga0501047_0059385 3300049581 Bacteria 3692
419 Ga0501047_0325418 3300049581 Bacteria 1376
420 Ga0501048_0160555 3300049582 Bacteria 1591
421 Ga0501035_0035106 3300049822 Bacteria 4553
422 Ga0501044_0005062 3300049823 Bacteria 14710
423 Ga0501044_0019605 3300049823 Bacteria 7231
424 nmdc:mga03683_133527_c1 3300050489 Bacteria 1112
425 nmdc:mga03n38_287812_c1 3300050490 Bacteria 879
426 nmdc:mga00v17_685_c1 3300050491 Bacteria 18642
427 nmdc:mga0k408_42736_c1 3300050493 Bacteria 2610
428 nmdc:mga04h51_6330_c1 3300050495 Bacteria 3064
429 nmdc:mga07m45_56608_c1 3300050496 Bacteria 2216
430 nmdc:mga07m45_8698_c1 3300050496 Bacteria 5230
431 nmdc:mga0sz30_2797_c1 3300050516 Bacteria 6229
432 Ga0500635_0000123 3300053080 Bacteria 45690
433 Ga0500643_000265 3300053087 Bacteria 46271
434 Ga0500643_002905 3300053087 Bacteria 8515
435 Ga0500643_004445 3300053087 Bacteria 6341
436 Ga0500643_005542 3300053087 Bacteria 5423
437 Ga0500643_011598 3300053087 Bacteria 3204
438 Ga0500644_0000124 3300053088 Bacteria 47262
439 Ga0500644_0001671 3300053088 Bacteria 5783
440 Ga0500646_0066997 3300053090 Bacteria 1069
441 Ga0500647_0001502 3300053091 Bacteria 8058
442 Ga0500583_0028302 3300053092 Bacteria 2429
443 Ga0500651_0002111 3300053093 Bacteria 10338
444 Ga0500651_0074942 3300053093 Bacteria 2103
445 Ga0500651_0079971 3300053093 Bacteria 2025
446 Ga0500566_0033378 3300053094 Bacteria 3000
447 Ga0500641_0000871 3300053096 Bacteria 10785
448 Ga0500641_0001351 3300053096 Bacteria 8719
449 Ga0500641_0194437 3300053096 Bacteria 867
450 Ga0500650_0032999 3300053098 Bacteria 2361
451 Ga0500554_047911 3300053102 Bacteria 1335
452 Ga0500555_013525 3300053103 Bacteria 2354
453 Ga0500555_014601 3300053103 Bacteria 2264
454 Ga0500556_0001023 3300053104 Bacteria 14627
455 Ga0500556_0037442 3300053104 Bacteria 1688
456 Ga0500562_002828 3300053108 Bacteria 4325
457 Ga0500562_003821 3300053108 Bacteria 3792
458 Ga0500562_004079 3300053108 Bacteria 3681
459 Ga0500569_002611 3300053109 Bacteria 3581
460 Ga0500572_002628 3300053111 Bacteria 4260
461 Ga0500593_033222 3300053117 Bacteria 2310
462 Ga0500595_002332 3300053119 Bacteria 9491
463 Ga0500595_008312 3300053119 Bacteria 4247
464 Ga0500595_009160 3300053119 Bacteria 4009
465 Ga0500597_097732 3300053120 Bacteria 1276
466 Ga0500607_205471 3300053121 Bacteria 840
467 Ga0500608_000011 3300053122 Bacteria 92215
468 Ga0500608_001751 3300053122 Bacteria 7757
469 Ga0500614_001062 3300053123 Bacteria 6832
470 Ga0500642_0018179 3300053130 Bacteria 2713
471 Ga0500655_025410 3300053133 Bacteria 1124
472 Ga0500658_0002725 3300053134 Bacteria 6792
473 Ga0500559_0000004 3300053136 Bacteria 241551
474 Ga0500559_0005404 3300053136 Bacteria 5884
475 Ga0500559_0014378 3300053136 Bacteria 3345
476 Ga0500559_0025335 3300053136 Bacteria 2524
477 Ga0500559_0127772 3300053136 Bacteria 1186
478 Ga0500564_000063 3300053138 Bacteria 28411
479 Ga0500577_0012108 3300053142 Bacteria 2597
480 Ga0500590_046523 3300053148 Bacteria 2217
481 Ga0500604_0023031 3300053151 Bacteria 1773
482 Ga0500616_0005230 3300053153 Bacteria 8876
483 Ga0500616_0044842 3300053153 Bacteria 2358
484 Ga0500619_004773 3300053154 Bacteria 2947
485 Ga0500622_0000643 3300053156 Bacteria 31235
486 Ga0500622_0005996 3300053156 Bacteria 7140
487 Ga0500622_0023760 3300053156 Bacteria 3246
488 Ga0500622_0042108 3300053156 Bacteria 2374
489 Ga0500622_0086872 3300053156 Bacteria 1558
490 Ga0500639_084571 3300053163 Bacteria 1592
491 Ga0500636_0003167 3300053177 Bacteria 9217
492 Ga0500637_0005271 3300053178 Bacteria 6247
493 Ga0500637_0098026 3300053178 Bacteria 1699
494 Ga0500576_041914 3300053725 Bacteria 2057
495 Ga0500645_001143 3300053730 Bacteria 14378
496 Ga0500645_001630 3300053730 Bacteria 11078
497 Ga0500645_013157 3300053730 Bacteria 2661
498 Ga0500645_091407 3300053730 Bacteria 863
499 Ga0500609_007218 3300053731 Bacteria 1500
500 Ga0500552_004704 3300053733 Bacteria 1453
501 Ga0500596_000393 3300053735 Bacteria 7980

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050489 nmdc:mga03683_133527_c1 nmdc:mga03683_133527_c1_11_727 238
2 3300003791 Ga0055530_10000313 Ga0055530_1000031331 245
3 3300003794 Ga0055531_10004699 Ga0055531_100046995 245
4 3300025297 Ga0209758_1001380 Ga0209758_100138029 245
5 3300025298 Ga0209050_1000053 Ga0209050_100005363 245
6 3300025304 Ga0209257_1000419 Ga0209257_100041985 245
7 3300031239 Ga0265328_10000370 Ga0265328_1000037015 245
8 3300031239 Ga0265328_10034348 Ga0265328_100343482 246
9 3300031239 Ga0265328_10002129 Ga0265328_100021292 247
10 iso_pu_bacteria 2891088606 2891093160 247
11 3300053731 Ga0500609_007218 Ga0500609_007218_711_1484 257
12 iso_pu_bacteria 2643221574 2643884549 260
13 iso_pu_bacteria 2643221699 2644549067 260
14 iso_pu_bacteria 2643221699 2644553203 260
15 iso_pu_bacteria 2928972540 2928974622 261
16 iso_pu_bacteria 2941485952 2941488065 261
17 iso_pu_bacteria 2977240413 2977243546 261
18 3300003781 Ga0055536_1009453 Ga0055536_10094531 264
19 3300025292 Ga0209676_1000140 Ga0209676_100014047 264
20 3300025292 Ga0209676_1001860 Ga0209676_10018608 264
21 3300025298 Ga0209050_1012795 Ga0209050_10127953 264
22 3300025304 Ga0209257_1000292 Ga0209257_100029243 264
23 3300031911 Ga0307412_10002217 Ga0307412_100022178 264
24 3300032004 Ga0307414_10048083 Ga0307414_100480832 264
25 3300032004 Ga0307414_10056959 Ga0307414_100569592 264
26 3300032004 Ga0307414_10068561 Ga0307414_100685614 264
27 3300032004 Ga0307414_10200853 Ga0307414_102008532 264
28 3300032004 Ga0307414_10200925 Ga0307414_102009251 264
29 3300032004 Ga0307414_10455031 Ga0307414_104550312 264
30 3300048918 Ga0496115_0003837 Ga0496115_0003837_1712_2506 264
31 3300053088 Ga0500644_0001671 Ga0500644_0001671_718_1512 264
32 3300053093 Ga0500651_0002111 Ga0500651_0002111_8108_8902 264
33 3300053156 Ga0500622_0086872 Ga0500622_0086872_743_1537 264
34 iso_pu_bacteria 2582581279 2585149727 264
35 iso_pu_bacteria 2585428106 2587915781 264
36 iso_pu_bacteria 2643221545 2643750134 264
37 iso_pu_bacteria 2643221552 2643781786 264
38 iso_pu_bacteria 2643221583 2643922353 264
39 iso_pu_bacteria 2643221584 2643931976 264
40 iso_pu_bacteria 2643221598 2643999660 264
41 iso_pu_bacteria 2643221614 2644087646 264
42 iso_pu_bacteria 2643221640 2644223331 264
43 iso_pu_bacteria 2643221642 2644236399 264
44 iso_pu_bacteria 2643221661 2644344310 264
45 iso_pu_bacteria 2643221666 2644367005 264
46 iso_pu_bacteria 2643221691 2644507023 264
47 iso_pu_bacteria 2791355048 2792460853 264
48 iso_pu_bacteria 2843744320 2843745487 264
49 iso_pu_bacteria 2849560528 2849561101 264
50 iso_pu_bacteria 2849573788 2849578567 264
51 iso_pu_bacteria 2851153111 2851157137 264
52 iso_pu_bacteria 2857504554 2857505707 264
53 iso_pu_bacteria 2884960567 2884965523 264
54 iso_pu_bacteria 2898329390 2898332795 264
55 iso_pu_bacteria 2928531327 2928532190 264
56 3300013102 Ga0157371_10007280 Ga0157371_100072802 265
57 3300013104 Ga0157370_10019913 Ga0157370_100199133 265
58 3300013105 Ga0157369_10020217 Ga0157369_100202173 265
59 3300031824 Ga0307413_10393883 Ga0307413_103938831 265
60 3300032004 Ga0307414_10051035 Ga0307414_100510352 265
61 3300032004 Ga0307414_10101841 Ga0307414_101018412 265
62 3300046558 Ga0495633_0001477 Ga0495633_0001477_1103_1900 265
63 3300046694 Ga0495649_0000171 Ga0495649_0000171_12264_13061 265
64 3300048919 Ga0496116_0030216 Ga0496116_0030216_476_1279 265
65 3300048925 Ga0496122_0002925 Ga0496122_0002925_9764_10561 265
66 3300048926 Ga0496123_0219862 Ga0496123_0219862_135_932 265
67 3300048928 Ga0496125_0004796 Ga0496125_0004796_1436_2239 265
68 3300053093 Ga0500651_0074942 Ga0500651_0074942_175_972 265
69 3300009551 Ga0105238_10700525 Ga0105238_107005251 266
70 3300037853 Ga0436364_0873267 Ga0436364_0873267_435_1235 266
71 3300039437 Ga0436365_1028735 Ga0436365_1028735_98_898 266
72 3300046537 Ga0495598_0044498 Ga0495598_0044498_456_1256 266
73 3300003320 rootH2_10042095 rootH2_100420951 268
74 3300003775 Ga0055524_1011000 Ga0055524_10110002 268
75 3300003781 Ga0055536_1003526 Ga0055536_10035268 268
76 3300003781 Ga0055536_1008141 Ga0055536_10081413 268
77 3300003790 Ga0055528_1015927 Ga0055528_10159272 268
78 3300003791 Ga0055530_10002661 Ga0055530_1000266111 268
79 3300003791 Ga0055530_10006718 Ga0055530_100067183 268
80 3300003794 Ga0055531_10002220 Ga0055531_1000222013 268
81 3300005262 Ga0065165_1000583 Ga0065165_10005836 268
82 3300005327 Ga0070658_10219407 Ga0070658_102194072 268
83 3300005331 Ga0070670_100000007 Ga0070670_10000000713 268
84 3300005335 Ga0070666_10039451 Ga0070666_100394513 268
85 3300005335 Ga0070666_10071226 Ga0070666_100712262 268
86 3300005335 Ga0070666_10288247 Ga0070666_102882471 268
87 3300005336 Ga0070680_100169189 Ga0070680_1001691892 268
88 3300005347 Ga0070668_100000272 Ga0070668_1000002725 268
89 3300005347 Ga0070668_100005382 Ga0070668_1000053827 268
90 3300005347 Ga0070668_100010729 Ga0070668_1000107298 268
91 3300005347 Ga0070668_100044636 Ga0070668_1000446363 268
92 3300005347 Ga0070668_100117006 Ga0070668_1001170062 268
93 3300005353 Ga0070669_100001157 Ga0070669_10000115711 268
94 3300005353 Ga0070669_100009792 Ga0070669_1000097927 268
95 3300005355 Ga0070671_100001426 Ga0070671_10000142614 268
96 3300005355 Ga0070671_100168959 Ga0070671_1001689592 268
97 3300005366 Ga0070659_100002510 Ga0070659_10000251010 268
98 3300005366 Ga0070659_100012009 Ga0070659_1000120095 268
99 3300005366 Ga0070659_100041439 Ga0070659_1000414395 268
100 3300005367 Ga0070667_100000291 Ga0070667_10000029128 268
101 3300005367 Ga0070667_100004267 Ga0070667_10000426710 268
102 3300005367 Ga0070667_100006296 Ga0070667_1000062962 268
103 3300005367 Ga0070667_100010607 Ga0070667_1000106076 268
104 3300005458 Ga0070681_10042288 Ga0070681_100422884 268
105 3300005458 Ga0070681_10156607 Ga0070681_101566071 268
106 3300005530 Ga0070679_100141555 Ga0070679_1001415553 268
107 3300005539 Ga0068853_100029369 Ga0068853_1000293692 268
108 3300005539 Ga0068853_100179815 Ga0068853_1001798152 268
109 3300005548 Ga0070665_100000395 Ga0070665_10000039538 268
110 3300005548 Ga0070665_100002782 Ga0070665_10000278210 268
111 3300005548 Ga0070665_100017425 Ga0070665_1000174258 268
112 3300005548 Ga0070665_100155747 Ga0070665_1001557472 268
113 3300005563 Ga0068855_100034109 Ga0068855_1000341097 268
114 3300005563 Ga0068855_100156944 Ga0068855_1001569444 268
115 3300005563 Ga0068855_100394587 Ga0068855_1003945872 268
116 3300005563 Ga0068855_100422748 Ga0068855_1004227481 268
117 3300005564 Ga0070664_100011039 Ga0070664_1000110397 268
118 3300005564 Ga0070664_100097198 Ga0070664_1000971983 268
119 3300005578 Ga0068854_100311900 Ga0068854_1003119002 268
120 3300005614 Ga0068856_100096630 Ga0068856_1000966303 268
121 3300005614 Ga0068856_100726928 Ga0068856_1007269282 268
122 3300005616 Ga0068852_100258988 Ga0068852_1002589882 268
123 3300005617 Ga0068859_100001326 Ga0068859_1000013268 268
124 3300005617 Ga0068859_100001699 Ga0068859_10000169915 268
125 3300005618 Ga0068864_100002407 Ga0068864_1000024078 268
126 3300005618 Ga0068864_100003084 Ga0068864_10000308410 268
127 3300005618 Ga0068864_100086573 Ga0068864_1000865733 268
128 3300005618 Ga0068864_100167963 Ga0068864_1001679632 268
129 3300005618 Ga0068864_100365885 Ga0068864_1003658852 268
130 3300005841 Ga0068863_100000262 Ga0068863_10000026257 268
131 3300005841 Ga0068863_100003500 Ga0068863_10000350011 268
132 3300005841 Ga0068863_100003720 Ga0068863_10000372013 268
133 3300005841 Ga0068863_100044605 Ga0068863_1000446052 268
134 3300005841 Ga0068863_100602868 Ga0068863_1006028682 268
135 3300005842 Ga0068858_100001577 Ga0068858_10000157710 268
136 3300005842 Ga0068858_100011317 Ga0068858_1000113178 268
137 3300005842 Ga0068858_100074394 Ga0068858_1000743943 268
138 3300005843 Ga0068860_100000047 Ga0068860_10000004713 268
139 3300005843 Ga0068860_100002126 Ga0068860_10000212617 268
140 3300005843 Ga0068860_100003451 Ga0068860_1000034513 268
141 3300005844 Ga0068862_100004496 Ga0068862_1000044965 268
142 3300005844 Ga0068862_100035969 Ga0068862_1000359693 268
143 3300005844 Ga0068862_100062514 Ga0068862_1000625141 268
144 3300005844 Ga0068862_100096486 Ga0068862_1000964863 268
145 3300006051 Ga0075364_10000600 Ga0075364_1000060018 268
146 3300006178 Ga0075367_10053550 Ga0075367_100535502 268
147 3300006195 Ga0075366_10040517 Ga0075366_100405172 268
148 3300006353 Ga0075370_10027305 Ga0075370_100273054 268
149 3300006931 Ga0097620_100001326 Ga0097620_1000013268 268
150 3300006931 Ga0097620_100001698 Ga0097620_1000016988 268
151 3300009092 Ga0105250_10048171 Ga0105250_100481712 268
152 3300009093 Ga0105240_10003418 Ga0105240_1000341823 268
153 3300009093 Ga0105240_10004843 Ga0105240_100048437 268
154 3300009093 Ga0105240_10012284 Ga0105240_1001228412 268
155 3300009093 Ga0105240_10100147 Ga0105240_101001475 268
156 3300009093 Ga0105240_10163340 Ga0105240_101633404 268
157 3300009093 Ga0105240_10864653 Ga0105240_108646531 268
158 3300009098 Ga0105245_10146375 Ga0105245_101463752 268
159 3300009101 Ga0105247_10058669 Ga0105247_100586692 268
160 3300009177 Ga0105248_10000746 Ga0105248_100007463 268
161 3300009177 Ga0105248_10001254 Ga0105248_100012543 268
162 3300009177 Ga0105248_10001644 Ga0105248_1000164422 268
163 3300009177 Ga0105248_10010845 Ga0105248_100108452 268
164 3300009177 Ga0105248_10064392 Ga0105248_100643925 268
165 3300009177 Ga0105248_10363005 Ga0105248_103630051 268
166 3300009177 Ga0105248_10571402 Ga0105248_105714022 268
167 3300009545 Ga0105237_10246297 Ga0105237_102462972 268
168 3300009551 Ga0105238_10079187 Ga0105238_100791872 268
169 3300009551 Ga0105238_10107149 Ga0105238_101071494 268
170 3300009551 Ga0105238_10554103 Ga0105238_105541031 268
171 3300009553 Ga0105249_10002418 Ga0105249_100024188 268
172 3300009553 Ga0105249_10284569 Ga0105249_102845692 268
173 3300009553 Ga0105249_10444750 Ga0105249_104447502 268
174 3300009553 Ga0105249_10578067 Ga0105249_105780672 268
175 3300010375 Ga0105239_10071623 Ga0105239_100716234 268
176 3300010375 Ga0105239_10119796 Ga0105239_101197961 268
177 3300013100 Ga0157373_10000879 Ga0157373_1000087920 268
178 3300013100 Ga0157373_10002637 Ga0157373_100026373 268
179 3300013104 Ga0157370_10185989 Ga0157370_101859892 268
180 3300013105 Ga0157369_10170137 Ga0157369_101701373 268
181 3300013105 Ga0157369_10709319 Ga0157369_107093192 268
182 3300013306 Ga0163162_10153192 Ga0163162_101531922 268
183 3300013306 Ga0163162_11025038 Ga0163162_110250382 268
184 3300013308 Ga0157375_10240189 Ga0157375_102401893 268
185 3300014325 Ga0163163_10008395 Ga0163163_100083952 268
186 3300014325 Ga0163163_10041831 Ga0163163_100418314 268
187 3300014325 Ga0163163_10092487 Ga0163163_100924872 268
188 3300014325 Ga0163163_10145338 Ga0163163_101453384 268
189 3300014325 Ga0163163_10163368 Ga0163163_101633682 268
190 3300014325 Ga0163163_10179468 Ga0163163_101794683 268
191 3300014325 Ga0163163_10572141 Ga0163163_105721411 268
192 3300014745 Ga0157377_10192011 Ga0157377_101920112 268
193 3300014968 Ga0157379_10003580 Ga0157379_100035806 268
194 3300014968 Ga0157379_10024480 Ga0157379_100244801 268
195 3300014968 Ga0157379_10059719 Ga0157379_100597191 268
196 3300014968 Ga0157379_10152607 Ga0157379_101526072 268
197 3300014969 Ga0157376_10344179 Ga0157376_103441791 268
198 3300021361 Ga0213872_10008803 Ga0213872_100088037 268
199 3300021361 Ga0213872_10020485 Ga0213872_100204853 268
200 3300021384 Ga0213876_10000081 Ga0213876_1000008181 268
201 3300021384 Ga0213876_10077415 Ga0213876_100774152 268
202 3300025250 Ga0209026_1001196 Ga0209026_10011965 268
203 3300025254 Ga0209148_1010595 Ga0209148_10105952 268
204 3300025263 Ga0209565_1000090 Ga0209565_1000090138 268
205 3300025273 Ga0209673_1004907 Ga0209673_10049075 268
206 3300025292 Ga0209676_1000257 Ga0209676_10002574 268
207 3300025292 Ga0209676_1005474 Ga0209676_10054744 268
208 3300025295 Ga0209564_1015123 Ga0209564_10151232 268
209 3300025297 Ga0209758_1002555 Ga0209758_100255515 268
210 3300025298 Ga0209050_1003986 Ga0209050_10039863 268
211 3300025298 Ga0209050_1006790 Ga0209050_10067904 268
212 3300025299 Ga0209256_1008640 Ga0209256_10086404 268
213 3300025299 Ga0209256_1026005 Ga0209256_10260051 268
214 3300025299 Ga0209256_1027974 Ga0209256_10279741 268
215 3300025303 Ga0209051_1000743 Ga0209051_10007434 268
216 3300025304 Ga0209257_1000624 Ga0209257_100062412 268
217 3300025304 Ga0209257_1003494 Ga0209257_10034949 268
218 3300025304 Ga0209257_1006554 Ga0209257_10065544 268
219 3300025903 Ga0207680_10020782 Ga0207680_100207824 268
220 3300025903 Ga0207680_10024436 Ga0207680_100244363 268
221 3300025903 Ga0207680_10041937 Ga0207680_100419373 268
222 3300025909 Ga0207705_10001195 Ga0207705_1000119516 268
223 3300025912 Ga0207707_10237260 Ga0207707_102372602 268
224 3300025913 Ga0207695_10000269 Ga0207695_1000026967 268
225 3300025913 Ga0207695_10000886 Ga0207695_100008863 268
226 3300025913 Ga0207695_10010613 Ga0207695_100106138 268
227 3300025913 Ga0207695_10057503 Ga0207695_100575035 268
228 3300025913 Ga0207695_10090094 Ga0207695_100900943 268
229 3300025913 Ga0207695_10291095 Ga0207695_102910953 268
230 3300025914 Ga0207671_10171187 Ga0207671_101711872 268
231 3300025917 Ga0207660_10007322 Ga0207660_100073228 268
232 3300025919 Ga0207657_10000235 Ga0207657_1000023512 268
233 3300025921 Ga0207652_10083115 Ga0207652_100831155 268
234 3300025923 Ga0207681_10014772 Ga0207681_100147723 268
235 3300025923 Ga0207681_10094346 Ga0207681_100943463 268
236 3300025924 Ga0207694_10020782 Ga0207694_100207826 268
237 3300025924 Ga0207694_10065289 Ga0207694_100652892 268
238 3300025924 Ga0207694_10084995 Ga0207694_100849954 268
239 3300025925 Ga0207650_10000033 Ga0207650_1000003382 268
240 3300025925 Ga0207650_10025851 Ga0207650_100258513 268
241 3300025927 Ga0207687_10125590 Ga0207687_101255902 268
242 3300025931 Ga0207644_10003812 Ga0207644_100038125 268
243 3300025931 Ga0207644_10016427 Ga0207644_100164271 268
244 3300025931 Ga0207644_10288034 Ga0207644_102880341 268
245 3300025932 Ga0207690_10000031 Ga0207690_1000003175 268
246 3300025932 Ga0207690_10026967 Ga0207690_100269675 268
247 3300025932 Ga0207690_10072722 Ga0207690_100727222 268
248 3300025933 Ga0207706_10044166 Ga0207706_100441662 268
249 3300025934 Ga0207686_10190485 Ga0207686_101904852 268
250 3300025941 Ga0207711_10000331 Ga0207711_1000033127 268
251 3300025941 Ga0207711_10000764 Ga0207711_1000076429 268
252 3300025941 Ga0207711_10005910 Ga0207711_1000591011 268
253 3300025941 Ga0207711_10099228 Ga0207711_100992283 268
254 3300025941 Ga0207711_10247650 Ga0207711_102476502 268
255 3300025945 Ga0207679_10073590 Ga0207679_100735902 268
256 3300025945 Ga0207679_10083989 Ga0207679_100839892 268
257 3300025949 Ga0207667_10006978 Ga0207667_100069784 268
258 3300025949 Ga0207667_10009903 Ga0207667_100099037 268
259 3300025949 Ga0207667_10009952 Ga0207667_1000995211 268
260 3300025949 Ga0207667_10125857 Ga0207667_101258573 268
261 3300025949 Ga0207667_10164800 Ga0207667_101648001 268
262 3300025949 Ga0207667_10367531 Ga0207667_103675313 268
263 3300025961 Ga0207712_10001293 Ga0207712_100012937 268
264 3300025961 Ga0207712_10383893 Ga0207712_103838931 268
265 3300025972 Ga0207668_10000013 Ga0207668_1000001371 268
266 3300025972 Ga0207668_10001021 Ga0207668_1000102116 268
267 3300025972 Ga0207668_10002317 Ga0207668_100023172 268
268 3300025972 Ga0207668_10006177 Ga0207668_100061773 268
269 3300025972 Ga0207668_10018010 Ga0207668_100180103 268
270 3300025972 Ga0207668_10288338 Ga0207668_102883382 268
271 3300025986 Ga0207658_10000323 Ga0207658_1000032346 268
272 3300025986 Ga0207658_10002054 Ga0207658_100020548 268
273 3300025986 Ga0207658_10055831 Ga0207658_100558312 268
274 3300025986 Ga0207658_10093017 Ga0207658_100930172 268
275 3300025986 Ga0207658_10318727 Ga0207658_103187272 268
276 3300026035 Ga0207703_10000027 Ga0207703_10000027191 268
277 3300026035 Ga0207703_10006596 Ga0207703_100065969 268
278 3300026035 Ga0207703_10007679 Ga0207703_100076795 268
279 3300026035 Ga0207703_10038927 Ga0207703_100389272 268
280 3300026035 Ga0207703_10132568 Ga0207703_101325682 268
281 3300026041 Ga0207639_10034526 Ga0207639_100345266 268
282 3300026078 Ga0207702_10144845 Ga0207702_101448453 268
283 3300026078 Ga0207702_10344429 Ga0207702_103444293 268
284 3300026078 Ga0207702_10575389 Ga0207702_105753892 268
285 3300026088 Ga0207641_10000003 Ga0207641_10000003177 268
286 3300026088 Ga0207641_10004327 Ga0207641_100043279 268
287 3300026088 Ga0207641_10005567 Ga0207641_1000556711 268
288 3300026088 Ga0207641_10083996 Ga0207641_100839961 268
289 3300026095 Ga0207676_10000135 Ga0207676_1000013513 268
290 3300026095 Ga0207676_10000203 Ga0207676_100002039 268
291 3300026095 Ga0207676_10087279 Ga0207676_100872793 268
292 3300026116 Ga0207674_10490161 Ga0207674_104901611 268
293 3300027543 Ga0209999_1000895 Ga0209999_10008951 268
294 3300027665 Ga0209983_1003347 Ga0209983_10033474 268
295 3300027866 Ga0209813_10031727 Ga0209813_100317272 268
296 3300028379 Ga0268266_10000003 Ga0268266_100000031463 268
297 3300028379 Ga0268266_10003032 Ga0268266_1000303211 268
298 3300028379 Ga0268266_10021376 Ga0268266_100213767 268
299 3300028379 Ga0268266_10183772 Ga0268266_101837722 268
300 3300028379 Ga0268266_10658341 Ga0268266_106583411 268
301 3300028380 Ga0268265_10002897 Ga0268265_100028978 268
302 3300028380 Ga0268265_10063519 Ga0268265_100635191 268
303 3300028380 Ga0268265_10064068 Ga0268265_100640684 268
304 3300028380 Ga0268265_10303534 Ga0268265_103035342 268
305 3300028381 Ga0268264_10000113 Ga0268264_10000113192 268
306 3300028381 Ga0268264_10000205 Ga0268264_100002053 268
307 3300028381 Ga0268264_10005653 Ga0268264_1000565310 268
308 3300028381 Ga0268264_10339598 Ga0268264_103395982 268
309 3300028786 Ga0307517_10011953 Ga0307517_100119534 268
310 3300028786 Ga0307517_10024392 Ga0307517_100243928 268
311 3300028786 Ga0307517_10078738 Ga0307517_100787384 268
312 3300028800 Ga0265338_10040359 Ga0265338_100403593 268
313 3300028800 Ga0265338_10047904 Ga0265338_100479043 268
314 3300028800 Ga0265338_10099439 Ga0265338_100994391 268
315 3300028800 Ga0265338_10142249 Ga0265338_101422491 268
316 3300028800 Ga0265338_10186049 Ga0265338_101860491 268
317 3300031250 Ga0265331_10184466 Ga0265331_101844661 268
318 3300031251 Ga0265327_10000331 Ga0265327_1000033176 268
319 3300031251 Ga0265327_10001088 Ga0265327_1000108821 268
320 3300031251 Ga0265327_10001225 Ga0265327_1000122510 268
321 3300031456 Ga0307513_10000178 Ga0307513_1000017861 268
322 3300031456 Ga0307513_10021691 Ga0307513_100216918 268
323 3300031456 Ga0307513_10027358 Ga0307513_100273582 268
324 3300031711 Ga0265314_10116665 Ga0265314_101166652 268
325 3300031730 Ga0307516_10000144 Ga0307516_1000014460 268
326 3300031824 Ga0307413_10361626 Ga0307413_103616262 268
327 3300031852 Ga0307410_10158181 Ga0307410_101581811 268
328 3300032126 Ga0307415_100415475 Ga0307415_1004154752 268
329 3300033180 Ga0307510_10012875 Ga0307510_1001287510 268
330 3300035083 Ga0373926_0037853 Ga0373926_0037853_450_1256 268
331 3300035113 Ga0373936_0004232 Ga0373936_0004232_2378_3184 268
332 3300035695 Ga0373927_0007778 Ga0373927_0007778_4090_4896 268
333 3300035725 Ga0373947_0319358 Ga0373947_0319358_19_825 268
334 3300036401 Ga0373937_0496997 Ga0373937_0496997_269_1075 268
335 3300037068 Ga0373925_0000653 Ga0373925_0000653_9503_10309 268
336 3300037068 Ga0373925_0031244 Ga0373925_0031244_406_1212 268
337 3300037312 Ga0395899_0000003 Ga0395899_0000003_1029905_1030711 268
338 3300037312 Ga0395899_0002855 Ga0395899_0002855_6749_7555 268
339 3300037418 Ga0395900_0000002 Ga0395900_0000002_345716_346522 268
340 3300037418 Ga0395900_0091736 Ga0395900_0091736_828_1634 268
341 3300037418 Ga0395900_0229711 Ga0395900_0229711_974_1780 268
342 3300037466 Ga0395898_0022989 Ga0395898_0022989_3947_4753 268
343 3300037466 Ga0395898_0042939 Ga0395898_0042939_3178_3984 268
344 3300037466 Ga0395898_0054819 Ga0395898_0054819_1792_2598 268
345 3300037471 Ga0395905_0021654 Ga0395905_0021654_4788_5594 268
346 3300037471 Ga0395905_0027712 Ga0395905_0027712_3901_4707 268
347 3300037471 Ga0395905_0090233 Ga0395905_0090233_1905_2711 268
348 3300037471 Ga0395905_0351962 Ga0395905_0351962_409_1215 268
349 3300038443 Ga0395901_0000013 Ga0395901_0000013_357263_358069 268
350 3300038443 Ga0395901_0105328 Ga0395901_0105328_1838_2644 268
351 3300038443 Ga0395901_0341230 Ga0395901_0341230_632_1438 268
352 3300038443 Ga0395901_0341761 Ga0395901_0341761_429_1235 268
353 3300039437 Ga0436365_0187494 Ga0436365_0187494_2017_2859 268
354 3300039447 Ga0436361_0940191 Ga0436361_0940191_1377_2183 268
355 3300039447 Ga0436361_1069972 Ga0436361_1069972_20889_21695 268
356 3300039453 Ga0436362_0049463 Ga0436362_0049463_610_1416 268
357 3300041997 Ga0439431_0027999 Ga0439431_0027999_198_1004 268
358 3300042004 Ga0439445_0042828 Ga0439445_0042828_24_830 268
359 3300044712 Ga0453684_0117159 Ga0453684_0117159_919_1725 268
360 3300045049 Ga0466959_0028432 Ga0466959_0028432_2765_3571 268
361 3300046452 Ga0495617_061434 Ga0495617_061434_79_885 268
362 3300046457 Ga0495590_0000467 Ga0495590_0000467_14501_15307 268
363 3300046459 Ga0495629_0056529 Ga0495629_0056529_894_1700 268
364 3300046460 Ga0495638_0000283 Ga0495638_0000283_57227_58033 268
365 3300046460 Ga0495638_0000292 Ga0495638_0000292_9573_10379 268
366 3300046460 Ga0495638_0000939 Ga0495638_0000939_26930_27736 268
367 3300046460 Ga0495638_0036419 Ga0495638_0036419_1097_1903 268
368 3300046471 Ga0495650_0000168 Ga0495650_0000168_72047_72853 268
369 3300046492 Ga0495585_0113098 Ga0495585_0113098_137_943 268
370 3300046501 Ga0495607_0017682 Ga0495607_0017682_1621_2427 268
371 3300046506 Ga0495583_0008671 Ga0495583_0008671_3481_4287 268
372 3300046507 Ga0495606_0003607 Ga0495606_0003607_2092_2898 268
373 3300046512 Ga0495610_0001080 Ga0495610_0001080_21897_22703 268
374 3300046512 Ga0495610_0004585 Ga0495610_0004585_9288_10094 268
375 3300046512 Ga0495610_0045762 Ga0495610_0045762_226_1032 268
376 3300046513 Ga0495616_0001277 Ga0495616_0001277_7236_8042 268
377 3300046513 Ga0495616_0043246 Ga0495616_0043246_181_987 268
378 3300046515 Ga0495620_0019780 Ga0495620_0019780_1688_2494 268
379 3300046516 Ga0495628_0096218 Ga0495628_0096218_412_1218 268
380 3300046517 Ga0495630_0037598 Ga0495630_0037598_1416_2222 268
381 3300046518 Ga0495631_0004826 Ga0495631_0004826_4717_5523 268
382 3300046519 Ga0495632_0004711 Ga0495632_0004711_2046_2852 268
383 3300046520 Ga0495637_0023266 Ga0495637_0023266_1933_2739 268
384 3300046520 Ga0495637_0062793 Ga0495637_0062793_330_1136 268
385 3300046522 Ga0495643_0054919 Ga0495643_0054919_205_1011 268
386 3300046522 Ga0495643_0060500 Ga0495643_0060500_1066_1872 268
387 3300046523 Ga0495644_0060242 Ga0495644_0060242_355_1161 268
388 3300046524 Ga0495648_0000107 Ga0495648_0000107_1681_2487 268
389 3300046528 Ga0495642_0143425 Ga0495642_0143425_18_824 268
390 3300046530 Ga0495654_0000085 Ga0495654_0000085_69240_70046 268
391 3300046538 Ga0495609_0020633 Ga0495609_0020633_817_1623 268
392 3300046542 Ga0495597_0003622 Ga0495597_0003622_3016_3822 268
393 3300046557 Ga0495622_0012681 Ga0495622_0012681_944_1750 268
394 3300046616 Ga0495668_0003283 Ga0495668_0003283_2146_2952 268
395 3300046616 Ga0495668_0006744 Ga0495668_0006744_1531_2337 268
396 3300046616 Ga0495668_0042080 Ga0495668_0042080_591_1397 268
397 3300046616 Ga0495668_0074955 Ga0495668_0074955_158_964 268
398 3300046648 Ga0495611_0004621 Ga0495611_0004621_3305_4111 268
399 3300046660 Ga0495625_0000034 Ga0495625_0000034_213514_214320 268
400 3300046660 Ga0495625_0005125 Ga0495625_0005125_2139_2945 268
401 3300046660 Ga0495625_0005802 Ga0495625_0005802_2262_3068 268
402 3300046660 Ga0495625_0100003 Ga0495625_0100003_592_1398 268
403 3300046660 Ga0495625_0105456 Ga0495625_0105456_25_831 268
404 3300046660 Ga0495625_0112556 Ga0495625_0112556_203_1009 268
405 3300046684 Ga0495669_0000007 Ga0495669_0000007_135631_136437 268
406 3300046684 Ga0495669_0000919 Ga0495669_0000919_7758_8564 268
407 3300046684 Ga0495669_0004238 Ga0495669_0004238_1003_1809 268
408 3300046689 Ga0495613_0103597 Ga0495613_0103597_421_1227 268
409 3300046691 Ga0495670_0039294 Ga0495670_0039294_707_1513 268
410 3300046692 Ga0495671_0023786 Ga0495671_0023786_947_1753 268
411 3300046794 Ga0495589_0001385 Ga0495589_0001385_3212_4018 268
412 3300047320 Ga0495672_0001097 Ga0495672_0001097_9562_10368 268
413 3300047445 Ga0495677_0061942 Ga0495677_0061942_268_1074 268
414 3300047469 Ga0495673_0000492 Ga0495673_0000492_120_926 268
415 3300047469 Ga0495673_0000697 Ga0495673_0000697_887_1693 268
416 3300047469 Ga0495673_0007360 Ga0495673_0007360_5466_6272 268
417 3300047470 Ga0495681_0043609 Ga0495681_0043609_1133_1939 268
418 3300047472 Ga0495686_0001488 Ga0495686_0001488_730_1536 268
419 3300047472 Ga0495686_0004012 Ga0495686_0004012_10472_11278 268
420 3300047472 Ga0495686_0030422 Ga0495686_0030422_663_1469 268
421 3300047673 Ga0495593_0033823 Ga0495593_0033823_1749_2555 268
422 3300048904 Ga0496101_0438544 Ga0496101_0438544_191_997 268
423 3300048906 Ga0496103_0178823 Ga0496103_0178823_407_1213 268
424 3300048909 Ga0496106_0536480 Ga0496106_0536480_71_877 268
425 3300048910 Ga0496107_0000085 Ga0496107_0000085_10464_11270 268
426 3300048910 Ga0496107_0453614 Ga0496107_0453614_118_924 268
427 3300048911 Ga0496108_0337507 Ga0496108_0337507_212_1018 268
428 3300048912 Ga0496109_0074039 Ga0496109_0074039_1322_2128 268
429 3300048915 Ga0496112_0073457 Ga0496112_0073457_297_1103 268
430 3300048918 Ga0496115_0001891 Ga0496115_0001891_1912_2718 268
431 3300048918 Ga0496115_0011589 Ga0496115_0011589_1097_1903 268
432 3300048918 Ga0496115_0033238 Ga0496115_0033238_559_1365 268
433 3300048918 Ga0496115_0073234 Ga0496115_0073234_1019_1825 268
434 3300048918 Ga0496115_0608250 Ga0496115_0608250_49_855 268
435 3300048921 Ga0496118_0005332 Ga0496118_0005332_3837_4643 268
436 3300048922 Ga0496119_0106591 Ga0496119_0106591_153_959 268
437 3300048924 Ga0496121_0000042 Ga0496121_0000042_304196_305002 268
438 3300048924 Ga0496121_0034434 Ga0496121_0034434_2846_3652 268
439 3300048924 Ga0496121_0170224 Ga0496121_0170224_17_823 268
440 3300048924 Ga0496121_0267828 Ga0496121_0267828_262_1071 268
441 3300048927 Ga0496124_0031229 Ga0496124_0031229_2310_3116 268
442 3300048927 Ga0496124_0407712 Ga0496124_0407712_89_895 268
443 3300048928 Ga0496125_0010081 Ga0496125_0010081_1098_1904 268
444 3300048928 Ga0496125_0058254 Ga0496125_0058254_1364_2170 268
445 3300048929 Ga0496126_0004759 Ga0496126_0004759_7463_8269 268
446 3300049569 Ga0501032_0029180 Ga0501032_0029180_1209_2015 268
447 3300049570 Ga0501033_0002538 Ga0501033_0002538_14156_14962 268
448 3300049570 Ga0501033_0032648 Ga0501033_0032648_296_1102 268
449 3300049571 Ga0501034_0294946 Ga0501034_0294946_240_1046 268
450 3300049573 Ga0501037_0015263 Ga0501037_0015263_186_992 268
451 3300049573 Ga0501037_0165055 Ga0501037_0165055_401_1207 268
452 3300049581 Ga0501047_0008331 Ga0501047_0008331_2102_2908 268
453 3300049581 Ga0501047_0059385 Ga0501047_0059385_2684_3490 268
454 3300049581 Ga0501047_0325418 Ga0501047_0325418_550_1356 268
455 3300049582 Ga0501048_0160555 Ga0501048_0160555_45_851 268
456 3300049822 Ga0501035_0035106 Ga0501035_0035106_1340_2146 268
457 3300049823 Ga0501044_0005062 Ga0501044_0005062_4315_5121 268
458 3300049823 Ga0501044_0019605 Ga0501044_0019605_1235_2041 268
459 3300050490 nmdc:mga03n38_287812_c1 nmdc:mga03n38_287812_c1_41_847 268
460 3300050491 nmdc:mga00v17_685_c1 nmdc:mga00v17_685_c1_14647_15453 268
461 3300050493 nmdc:mga0k408_42736_c1 nmdc:mga0k408_42736_c1_448_1254 268
462 3300050495 nmdc:mga04h51_6330_c1 nmdc:mga04h51_6330_c1_736_1542 268
463 3300050496 nmdc:mga07m45_56608_c1 nmdc:mga07m45_56608_c1_619_1425 268
464 3300050496 nmdc:mga07m45_8698_c1 nmdc:mga07m45_8698_c1_3729_4535 268
465 3300050516 nmdc:mga0sz30_2797_c1 nmdc:mga0sz30_2797_c1_518_1324 268
466 3300053080 Ga0500635_0000123 Ga0500635_0000123_12261_13067 268
467 3300053087 Ga0500643_000265 Ga0500643_000265_32472_33278 268
468 3300053087 Ga0500643_002905 Ga0500643_002905_6530_7336 268
469 3300053087 Ga0500643_004445 Ga0500643_004445_1804_2610 268
470 3300053087 Ga0500643_005542 Ga0500643_005542_864_1670 268
471 3300053087 Ga0500643_011598 Ga0500643_011598_1002_1808 268
472 3300053088 Ga0500644_0000124 Ga0500644_0000124_1088_1894 268
473 3300053090 Ga0500646_0066997 Ga0500646_0066997_214_1020 268
474 3300053091 Ga0500647_0001502 Ga0500647_0001502_4236_5042 268
475 3300053092 Ga0500583_0028302 Ga0500583_0028302_879_1685 268
476 3300053093 Ga0500651_0079971 Ga0500651_0079971_1175_1981 268
477 3300053094 Ga0500566_0033378 Ga0500566_0033378_2151_2957 268
478 3300053096 Ga0500641_0000871 Ga0500641_0000871_9923_10729 268
479 3300053096 Ga0500641_0001351 Ga0500641_0001351_2915_3721 268
480 3300053096 Ga0500641_0194437 Ga0500641_0194437_38_844 268
481 3300053098 Ga0500650_0032999 Ga0500650_0032999_1154_1960 268
482 3300053102 Ga0500554_047911 Ga0500554_047911_24_830 268
483 3300053103 Ga0500555_013525 Ga0500555_013525_695_1501 268
484 3300053103 Ga0500555_014601 Ga0500555_014601_94_900 268
485 3300053104 Ga0500556_0001023 Ga0500556_0001023_10956_11762 268
486 3300053104 Ga0500556_0037442 Ga0500556_0037442_435_1241 268
487 3300053108 Ga0500562_002828 Ga0500562_002828_84_890 268
488 3300053108 Ga0500562_003821 Ga0500562_003821_2968_3774 268
489 3300053108 Ga0500562_004079 Ga0500562_004079_631_1440 268
490 3300053109 Ga0500569_002611 Ga0500569_002611_1873_2679 268
491 3300053111 Ga0500572_002628 Ga0500572_002628_1867_2673 268
492 3300053117 Ga0500593_033222 Ga0500593_033222_763_1572 268
493 3300053119 Ga0500595_002332 Ga0500595_002332_5789_6595 268
494 3300053119 Ga0500595_008312 Ga0500595_008312_3205_4017 268
495 3300053119 Ga0500595_009160 Ga0500595_009160_1528_2334 268
496 3300053120 Ga0500597_097732 Ga0500597_097732_359_1165 268
497 3300053121 Ga0500607_205471 Ga0500607_205471_17_823 268
498 3300053122 Ga0500608_000011 Ga0500608_000011_11369_12175 268
499 3300053122 Ga0500608_001751 Ga0500608_001751_3844_4650 268
500 3300053123 Ga0500614_001062 Ga0500614_001062_4242_5048 268
501 3300053130 Ga0500642_0018179 Ga0500642_0018179_271_1077 268
502 3300053133 Ga0500655_025410 Ga0500655_025410_60_866 268
503 3300053134 Ga0500658_0002725 Ga0500658_0002725_2469_3275 268
504 3300053136 Ga0500559_0000004 Ga0500559_0000004_223495_224301 268
505 3300053136 Ga0500559_0005404 Ga0500559_0005404_2896_3702 268
506 3300053136 Ga0500559_0014378 Ga0500559_0014378_1654_2460 268
507 3300053136 Ga0500559_0025335 Ga0500559_0025335_895_1701 268
508 3300053136 Ga0500559_0127772 Ga0500559_0127772_120_926 268
509 3300053138 Ga0500564_000063 Ga0500564_000063_27590_28396 268
510 3300053142 Ga0500577_0012108 Ga0500577_0012108_788_1594 268
511 3300053148 Ga0500590_046523 Ga0500590_046523_513_1319 268
512 3300053151 Ga0500604_0023031 Ga0500604_0023031_886_1692 268
513 3300053153 Ga0500616_0005230 Ga0500616_0005230_1113_1919 268
514 3300053153 Ga0500616_0044842 Ga0500616_0044842_273_1079 268
515 3300053154 Ga0500619_004773 Ga0500619_004773_735_1541 268
516 3300053156 Ga0500622_0000643 Ga0500622_0000643_20142_20948 268
517 3300053156 Ga0500622_0005996 Ga0500622_0005996_1821_2630 268
518 3300053156 Ga0500622_0023760 Ga0500622_0023760_1323_2129 268
519 3300053156 Ga0500622_0042108 Ga0500622_0042108_1019_1825 268
520 3300053163 Ga0500639_084571 Ga0500639_084571_44_850 268
521 3300053177 Ga0500636_0003167 Ga0500636_0003167_8081_8887 268
522 3300053178 Ga0500637_0005271 Ga0500637_0005271_5067_5873 268
523 3300053178 Ga0500637_0098026 Ga0500637_0098026_602_1408 268
524 3300053725 Ga0500576_041914 Ga0500576_041914_464_1270 268
525 3300053730 Ga0500645_001143 Ga0500645_001143_4508_5317 268
526 3300053730 Ga0500645_001630 Ga0500645_001630_2329_3135 268
527 3300053730 Ga0500645_013157 Ga0500645_013157_1362_2168 268
528 3300053730 Ga0500645_091407 Ga0500645_091407_21_830 268
529 3300053733 Ga0500552_004704 Ga0500552_004704_136_942 268
530 3300053735 Ga0500596_000393 Ga0500596_000393_5988_6794 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

34

287

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9342 3 268
2voa-assembly1.cif.gz_B structure of an ap endonuclease from archaeoglobus fulgidus 0.9272 3 268
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9178 3 266
6fke-assembly1.cif.gz_A structure of 3' phosphatase nexo (d146n) from neisseria bound to product dna hairpin 0.9041 3 266
2jc4-assembly1.cif.gz_A 3'-5' exonuclease (nexo) from neisseria meningitidis 0.9037 3 268
ID Description Score Start End Superfamily
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9318 3 268 3.60.10.10
2voaB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9248 3 268 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9102 3 266 3.60.10.10
6fk4A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8966 3 266 3.60.10.10
af_P09030_1_268_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.8762 3 268 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A354EQZ5-F1-model_v4 Exodeoxyribonuclease III 0.9933 1 174 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A0V2F737-F1-model_v4 deleted 0.9912 1 268
AF-A0A4Q3SZN9-F1-model_v4 Exodeoxyribonuclease III 0.991 1 144 GO:0003677
GO:0004519
GO:0006281
GO:0008311
AF-A0A258DE36-F1-model_v4 Exodeoxyribonuclease III 0.9884 29 268 GO:0003677
GO:0004519
GO:0006281
GO:0008311
GO:0046872
AF-A0A4Q3SZN9-F1-model_v4 Exodeoxyribonuclease III 0.9842 1 144 GO:0003677
GO:0004519
GO:0006281
GO:0008311

Feature Viewer

pLDDT pTM Quality
95.68 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map