F459827
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 529 | 317 | 510 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100130698|Ga0307408_1001306982 |
| Length | 160 |
| Sequence | VLTLRAAGATFGPMAKQIYVNLPVKDLKRSVDFFTALGFSFNPDYTDENATCMIINDDAFVMLLVEGFFKTFTSKSVADASGSTEAIMAYSVDSKEAVDDTVRKALAAGGTPSQEVQDYGFMYNHSFQDPDGHLWEVMWMDPAGPPAESTPAGDTETPAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 2 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 3 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 4 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 5 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 6 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 7 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 8 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 9 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 10 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 11 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 12 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 13 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 14 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 15 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 16 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 17 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 18 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 19 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 24 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 153 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 154 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 155 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 170 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 178 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 179 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 180 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 181 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 182 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 183 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 185 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 186 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 187 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 188 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 189 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 190 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 191 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 192 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 193 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 194 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 195 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 196 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 197 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 198 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 199 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 200 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 201 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 202 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 203 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 204 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 205 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 206 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 207 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 208 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 209 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 265 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 266 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 267 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 268 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 269 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 270 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 271 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 272 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 273 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 275 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 290 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 303 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 304 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 305 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 307 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 308 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 309 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 311 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 312 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 313 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 314 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 315 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 316 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 317 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.65 |
| Metatranscriptomes | 0.76 |
| Isolates | 3.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.86 |
| Nodule | 0.38 |
| Rhizoplane | 7.94 |
| Rhizosphere | 79.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c014348 | 3300000041 | Bacteria | 684 |
| 2 | ARcpr5yngRDRAFT_c013757 | 3300000043 | Bacteria | 679 |
| 3 | LJQas_1000389 | 3300000549 | Bacteria | 7419 |
| 4 | ARCol0yngRDRAFT_1005214 | 3300000652 | Unclassified | 934 |
| 5 | JGI24737J22298_10226061 | 3300001990 | Bacteria | 552 |
| 6 | rootH2_10203653 | 3300003320 | Bacteria | 2101 |
| 7 | rootL2_10239904 | 3300003322 | Bacteria | 1669 |
| 8 | rootH1_10135344 | 3300003323 | Bacteria | 4907 |
| 9 | JGI25407J50210_10061538 | 3300003373 | Archaea | 943 |
| 10 | Ga0006562J51391_1003923 | 3300003578 | Bacteria | 630 |
| 11 | Ga0055530_10001845 | 3300003791 | Bacteria | 14564 |
| 12 | Ga0055530_10004950 | 3300003791 | Bacteria | 6592 |
| 13 | Ga0055540_1000013 | 3300003792 | Bacteria | 262274 |
| 14 | Ga0055531_10009126 | 3300003794 | Bacteria | 5111 |
| 15 | Ga0065714_10011280 | 3300005288 | Bacteria | 3103 |
| 16 | Ga0065714_10114117 | 3300005288 | Bacteria | 1433 |
| 17 | Ga0065714_10520806 | 3300005288 | Bacteria | 513 |
| 18 | Ga0065704_10009070 | 3300005289 | Archaea | 2560 |
| 19 | Ga0065704_10072326 | 3300005289 | Bacteria | 8737 |
| 20 | Ga0065712_10269167 | 3300005290 | Bacteria | 919 |
| 21 | Ga0065712_10367915 | 3300005290 | Bacteria | 767 |
| 22 | Ga0065712_10432750 | 3300005290 | Bacteria | 701 |
| 23 | Ga0065715_10059131 | 3300005293 | Bacteria | 790 |
| 24 | Ga0065715_10490316 | 3300005293 | Bacteria | 789 |
| 25 | Ga0070676_10287671 | 3300005328 | Bacteria | 1110 |
| 26 | Ga0070676_10297269 | 3300005328 | Bacteria | 1093 |
| 27 | Ga0070683_100048048 | 3300005329 | Bacteria | 3945 |
| 28 | Ga0070690_100198762 | 3300005330 | Bacteria | 1394 |
| 29 | Ga0070670_100025407 | 3300005331 | Bacteria | 5096 |
| 30 | Ga0070670_100924713 | 3300005331 | Bacteria | 791 |
| 31 | Ga0070670_101180167 | 3300005331 | Bacteria | 699 |
| 32 | Ga0070677_10131296 | 3300005333 | Bacteria | 1144 |
| 33 | Ga0070666_10065650 | 3300005335 | Bacteria | 2462 |
| 34 | Ga0070660_100224564 | 3300005339 | Bacteria | 1527 |
| 35 | Ga0070689_100012167 | 3300005340 | Bacteria | 6189 |
| 36 | Ga0070689_100092805 | 3300005340 | Bacteria | 2382 |
| 37 | Ga0070689_100136231 | 3300005340 | Bacteria | 1972 |
| 38 | Ga0070691_10674487 | 3300005341 | Bacteria | 618 |
| 39 | Ga0070687_100242109 | 3300005343 | Bacteria | 1116 |
| 40 | Ga0070661_100067995 | 3300005344 | Bacteria | 2619 |
| 41 | Ga0070668_100272624 | 3300005347 | Bacteria | 1411 |
| 42 | Ga0070668_100398362 | 3300005347 | Unclassified | 1175 |
| 43 | Ga0070669_100005196 | 3300005353 | Bacteria | 9419 |
| 44 | Ga0070669_100006090 | 3300005353 | Bacteria | 8703 |
| 45 | Ga0070669_101069571 | 3300005353 | Bacteria | 694 |
| 46 | Ga0070675_100328286 | 3300005354 | Bacteria | 1352 |
| 47 | Ga0070671_100060533 | 3300005355 | Bacteria | 3152 |
| 48 | Ga0070671_100360839 | 3300005355 | Bacteria | 1241 |
| 49 | Ga0070674_101106302 | 3300005356 | Bacteria | 700 |
| 50 | Ga0070673_100069776 | 3300005364 | Bacteria | 2818 |
| 51 | Ga0070673_100261125 | 3300005364 | Bacteria | 1513 |
| 52 | Ga0070659_101335504 | 3300005366 | Bacteria | 636 |
| 53 | Ga0070667_100417672 | 3300005367 | Bacteria | 1222 |
| 54 | Ga0070710_10022516 | 3300005437 | Archaea | 3296 |
| 55 | Ga0070701_10041098 | 3300005438 | Bacteria | 2354 |
| 56 | Ga0070711_100433079 | 3300005439 | Archaea | 1074 |
| 57 | Ga0070711_100864923 | 3300005439 | Bacteria | 770 |
| 58 | Ga0070711_101648486 | 3300005439 | Bacteria | 561 |
| 59 | Ga0070700_100498985 | 3300005441 | Bacteria | 936 |
| 60 | Ga0070694_100012128 | 3300005444 | Bacteria | 5352 |
| 61 | Ga0070694_100167386 | 3300005444 | Bacteria | 1617 |
| 62 | Ga0070678_100211676 | 3300005456 | Bacteria | 1606 |
| 63 | Ga0070662_100688790 | 3300005457 | Bacteria | 864 |
| 64 | Ga0070685_10318830 | 3300005466 | Bacteria | 1053 |
| 65 | Ga0070706_100256364 | 3300005467 | Bacteria | 1633 |
| 66 | Ga0070698_100125614 | 3300005471 | Bacteria | 2523 |
| 67 | Ga0070698_100312863 | 3300005471 | Unclassified | 1501 |
| 68 | Ga0070699_100022700 | 3300005518 | Bacteria | 5408 |
| 69 | Ga0070699_101360583 | 3300005518 | Bacteria | 651 |
| 70 | Ga0070684_102340227 | 3300005535 | Bacteria | 504 |
| 71 | Ga0070697_100613372 | 3300005536 | Bacteria | 957 |
| 72 | Ga0070672_100695519 | 3300005543 | Bacteria | 890 |
| 73 | Ga0070686_100008218 | 3300005544 | Bacteria | 5841 |
| 74 | Ga0070686_100094785 | 3300005544 | Bacteria | 2004 |
| 75 | Ga0070686_101052246 | 3300005544 | Unclassified | 670 |
| 76 | Ga0070695_100040840 | 3300005545 | Bacteria | 2939 |
| 77 | Ga0070695_100191430 | 3300005545 | Bacteria | 1456 |
| 78 | Ga0070695_100438659 | 3300005545 | Bacteria | 998 |
| 79 | Ga0070665_100057510 | 3300005548 | Bacteria | 3898 |
| 80 | Ga0070704_100225021 | 3300005549 | Bacteria | 1527 |
| 81 | Ga0068857_100727712 | 3300005577 | Bacteria | 944 |
| 82 | Ga0068854_101815052 | 3300005578 | Unclassified | 559 |
| 83 | Ga0070702_100011357 | 3300005615 | Bacteria | 4428 |
| 84 | Ga0068852_100295998 | 3300005616 | Bacteria | 1565 |
| 85 | Ga0068859_100207311 | 3300005617 | Bacteria | 2046 |
| 86 | Ga0068864_100043617 | 3300005618 | Bacteria | 3840 |
| 87 | Ga0068866_10315846 | 3300005718 | Bacteria | 981 |
| 88 | Ga0068861_100015198 | 3300005719 | Bacteria | 5418 |
| 89 | Ga0068861_100070619 | 3300005719 | Bacteria | 2705 |
| 90 | Ga0068863_101328711 | 3300005841 | Bacteria | 726 |
| 91 | Ga0068863_101366606 | 3300005841 | Bacteria | 716 |
| 92 | Ga0068860_100043352 | 3300005843 | Bacteria | 4292 |
| 93 | Ga0081538_10010987 | 3300005981 | Archaea | 7371 |
| 94 | Ga0075365_10021856 | 3300006038 | Bacteria | 3997 |
| 95 | Ga0075364_10744026 | 3300006051 | Bacteria | 669 |
| 96 | Ga0075432_10008524 | 3300006058 | Bacteria | 3497 |
| 97 | Ga0075432_10008617 | 3300006058 | Bacteria | 3481 |
| 98 | Ga0075367_10064648 | 3300006178 | Bacteria | 2189 |
| 99 | Ga0075430_100896345 | 3300006846 | Bacteria | 731 |
| 100 | Ga0075431_101515467 | 3300006847 | Bacteria | 629 |
| 101 | Ga0075434_100110936 | 3300006871 | Unclassified | 2753 |
| 102 | Ga0068865_100088405 | 3300006881 | Bacteria | 2242 |
| 103 | Ga0097620_100207310 | 3300006931 | Bacteria | 2046 |
| 104 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 105 | Ga0105251_10174457 | 3300009011 | Bacteria | 969 |
| 106 | Ga0111539_10132140 | 3300009094 | Bacteria | 2923 |
| 107 | Ga0111539_11008936 | 3300009094 | Bacteria | 968 |
| 108 | Ga0114129_10790682 | 3300009147 | Bacteria | 1211 |
| 109 | Ga0114129_10867695 | 3300009147 | Bacteria | 1146 |
| 110 | Ga0105243_10052356 | 3300009148 | Bacteria | 3233 |
| 111 | Ga0105243_10058878 | 3300009148 | Bacteria | 3063 |
| 112 | Ga0105242_10245871 | 3300009176 | Bacteria | 1610 |
| 113 | Ga0105242_10460144 | 3300009176 | Unclassified | 1201 |
| 114 | Ga0105248_12418326 | 3300009177 | Bacteria | 598 |
| 115 | Ga0105249_10434926 | 3300009553 | Unclassified | 1348 |
| 116 | Ga0105239_10575650 | 3300010375 | Bacteria | 1283 |
| 117 | Ga0105246_10033162 | 3300011119 | Bacteria | 3430 |
| 118 | Ga0105246_10135191 | 3300011119 | Bacteria | 1847 |
| 119 | Ga0157338_1003700 | 3300012515 | Unclassified | 1283 |
| 120 | Ga0157373_10023577 | 3300013100 | Bacteria | 4460 |
| 121 | Ga0157371_10773117 | 3300013102 | Bacteria | 722 |
| 122 | Ga0157374_10296706 | 3300013296 | Bacteria | 1598 |
| 123 | Ga0157374_11461872 | 3300013296 | Bacteria | 707 |
| 124 | Ga0157378_10023083 | 3300013297 | Bacteria | 5475 |
| 125 | Ga0157378_10125763 | 3300013297 | Bacteria | 2368 |
| 126 | Ga0157378_11069767 | 3300013297 | Bacteria | 843 |
| 127 | Ga0163162_10472428 | 3300013306 | Bacteria | 1385 |
| 128 | Ga0163162_10694013 | 3300013306 | Bacteria | 1140 |
| 129 | Ga0163162_11069588 | 3300013306 | Bacteria | 913 |
| 130 | Ga0157375_10820212 | 3300013308 | Bacteria | 1078 |
| 131 | Ga0157375_11991146 | 3300013308 | Bacteria | 690 |
| 132 | Ga0157380_10088284 | 3300014326 | Bacteria | 2551 |
| 133 | Ga0157380_11445980 | 3300014326 | Bacteria | 739 |
| 134 | Ga0182008_10008258 | 3300014497 | Bacteria | 5691 |
| 135 | Ga0157379_10997227 | 3300014968 | Bacteria | 798 |
| 136 | Ga0163161_10071251 | 3300017792 | Bacteria | 2543 |
| 137 | Ga0209147_100110 | 3300025229 | Bacteria | 146408 |
| 138 | Ga0209565_1026697 | 3300025263 | Bacteria | 1155 |
| 139 | Ga0209675_1017986 | 3300025291 | Bacteria | 1993 |
| 140 | Ga0209676_1000149 | 3300025292 | Bacteria | 167854 |
| 141 | Ga0209050_1000567 | 3300025298 | Bacteria | 60093 |
| 142 | Ga0209050_1007645 | 3300025298 | Bacteria | 5989 |
| 143 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 144 | Ga0209051_1000022 | 3300025303 | Bacteria | 474879 |
| 145 | Ga0209257_1000030 | 3300025304 | Bacteria | 689812 |
| 146 | Ga0207697_10158332 | 3300025315 | Bacteria | 987 |
| 147 | Ga0207655_1026217 | 3300025728 | Bacteria | 2804 |
| 148 | Ga0207713_1072135 | 3300025735 | Bacteria | 1272 |
| 149 | Ga0207682_10185591 | 3300025893 | Bacteria | 951 |
| 150 | Ga0207642_10194372 | 3300025899 | Bacteria | 1116 |
| 151 | Ga0207680_10068037 | 3300025903 | Bacteria | 2196 |
| 152 | Ga0207680_10527061 | 3300025903 | Bacteria | 842 |
| 153 | Ga0207645_10007732 | 3300025907 | Bacteria | 7568 |
| 154 | Ga0207684_11318542 | 3300025910 | Bacteria | 594 |
| 155 | Ga0207662_10112560 | 3300025918 | Bacteria | 1699 |
| 156 | Ga0207681_10030754 | 3300025923 | Bacteria | 3502 |
| 157 | Ga0207681_10299895 | 3300025923 | Bacteria | 1271 |
| 158 | Ga0207650_10008767 | 3300025925 | Bacteria | 6911 |
| 159 | Ga0207650_10009822 | 3300025925 | Bacteria | 6545 |
| 160 | Ga0207650_11103314 | 3300025925 | Bacteria | 675 |
| 161 | Ga0207650_11204142 | 3300025925 | Bacteria | 645 |
| 162 | Ga0207659_10073417 | 3300025926 | Bacteria | 2504 |
| 163 | Ga0207700_11280863 | 3300025928 | Archaea | 653 |
| 164 | Ga0207644_10038478 | 3300025931 | Bacteria | 3370 |
| 165 | Ga0207644_10096399 | 3300025931 | Bacteria | 2214 |
| 166 | Ga0207706_10044670 | 3300025933 | Bacteria | 3927 |
| 167 | Ga0207686_10698356 | 3300025934 | Bacteria | 806 |
| 168 | Ga0207670_10071419 | 3300025936 | Bacteria | 2401 |
| 169 | Ga0207670_10940604 | 3300025936 | Bacteria | 725 |
| 170 | Ga0207669_10305642 | 3300025937 | Bacteria | 1211 |
| 171 | Ga0207691_10000972 | 3300025940 | Bacteria | 28495 |
| 172 | Ga0207679_11610712 | 3300025945 | Bacteria | 595 |
| 173 | Ga0207651_10206577 | 3300025960 | Bacteria | 1578 |
| 174 | Ga0207712_10494440 | 3300025961 | Unclassified | 1045 |
| 175 | Ga0207668_10028901 | 3300025972 | Bacteria | 3630 |
| 176 | Ga0207668_11216732 | 3300025972 | Bacteria | 677 |
| 177 | Ga0207677_10354147 | 3300026023 | Bacteria | 1231 |
| 178 | Ga0207677_11499442 | 3300026023 | Bacteria | 623 |
| 179 | Ga0207708_10023115 | 3300026075 | Bacteria | 4697 |
| 180 | Ga0207708_10355132 | 3300026075 | Bacteria | 1203 |
| 181 | Ga0207641_10764567 | 3300026088 | Bacteria | 954 |
| 182 | Ga0207648_10342281 | 3300026089 | Bacteria | 1347 |
| 183 | Ga0207676_10158827 | 3300026095 | Bacteria | 1956 |
| 184 | Ga0207676_10256368 | 3300026095 | Bacteria | 1577 |
| 185 | Ga0207675_100002498 | 3300026118 | Bacteria | 18195 |
| 186 | Ga0207675_100091494 | 3300026118 | Bacteria | 2860 |
| 187 | Ga0207683_10005968 | 3300026121 | Bacteria | 10434 |
| 188 | Ga0207683_10571545 | 3300026121 | Bacteria | 1046 |
| 189 | Ga0207683_10579794 | 3300026121 | Bacteria | 1038 |
| 190 | Ga0209281_1000057 | 3300027111 | Bacteria | 307145 |
| 191 | Ga0207428_10007887 | 3300027907 | Bacteria | 9677 |
| 192 | Ga0268266_10225119 | 3300028379 | Bacteria | 1725 |
| 193 | Ga0268266_10404985 | 3300028379 | Bacteria | 1290 |
| 194 | Ga0268265_11560089 | 3300028380 | Bacteria | 665 |
| 195 | Ga0307515_10534557 | 3300028794 | Bacteria | 782 |
| 196 | Ga0316177_1002752 | 3300030731 | Bacteria | 2024 |
| 197 | Ga0314311_1152501 | 3300030733 | Bacteria | 1288 |
| 198 | Ga0316181_1148685 | 3300030744 | Bacteria | 726 |
| 199 | Ga0307513_10062477 | 3300031456 | Bacteria | 3936 |
| 200 | Ga0307513_10448919 | 3300031456 | Unclassified | 1014 |
| 201 | Ga0307408_100005441 | 3300031548 | Bacteria | 8524 |
| 202 | Ga0307408_100051596 | 3300031548 | Bacteria | 2963 |
| 203 | Ga0307408_100104586 | 3300031548 | Bacteria | 2163 |
| 204 | Ga0307408_100130698 | 3300031548 | Bacteria | 1958 |
| 205 | Ga0307408_100134221 | 3300031548 | Bacteria | 1934 |
| 206 | Ga0307408_100157485 | 3300031548 | Bacteria | 1800 |
| 207 | Ga0307408_100273745 | 3300031548 | Bacteria | 1403 |
| 208 | Ga0307408_100296870 | 3300031548 | Bacteria | 1352 |
| 209 | Ga0307408_100468637 | 3300031548 | Bacteria | 1096 |
| 210 | Ga0307408_100560914 | 3300031548 | Bacteria | 1009 |
| 211 | Ga0307405_10007056 | 3300031731 | Bacteria | 5585 |
| 212 | Ga0307405_10007826 | 3300031731 | Bacteria | 5379 |
| 213 | Ga0307405_10035631 | 3300031731 | Bacteria | 2974 |
| 214 | Ga0307405_10039154 | 3300031731 | Bacteria | 2863 |
| 215 | Ga0307405_10043458 | 3300031731 | Bacteria | 2742 |
| 216 | Ga0307405_10073778 | 3300031731 | Bacteria | 2204 |
| 217 | Ga0307405_10074644 | 3300031731 | Bacteria | 2193 |
| 218 | Ga0307405_10096829 | 3300031731 | Bacteria | 1968 |
| 219 | Ga0307405_10118491 | 3300031731 | Bacteria | 1807 |
| 220 | Ga0307405_10322901 | 3300031731 | Bacteria | 1180 |
| 221 | Ga0307405_10473298 | 3300031731 | Bacteria | 998 |
| 222 | Ga0307405_10538052 | 3300031731 | Bacteria | 943 |
| 223 | Ga0307413_10001948 | 3300031824 | Bacteria | 8201 |
| 224 | Ga0307413_10014659 | 3300031824 | Bacteria | 3990 |
| 225 | Ga0307413_10031868 | 3300031824 | Bacteria | 2980 |
| 226 | Ga0307413_10145041 | 3300031824 | Bacteria | 1646 |
| 227 | Ga0307413_10148139 | 3300031824 | Bacteria | 1632 |
| 228 | Ga0307413_10415420 | 3300031824 | Bacteria | 1058 |
| 229 | Ga0307413_11209034 | 3300031824 | Bacteria | 657 |
| 230 | Ga0307410_10053081 | 3300031852 | Bacteria | 2741 |
| 231 | Ga0307410_10055460 | 3300031852 | Bacteria | 2690 |
| 232 | Ga0307410_10058629 | 3300031852 | Bacteria | 2625 |
| 233 | Ga0307410_10074805 | 3300031852 | Bacteria | 2360 |
| 234 | Ga0307410_10143285 | 3300031852 | Bacteria | 1770 |
| 235 | Ga0307410_10154155 | 3300031852 | Bacteria | 1714 |
| 236 | Ga0307410_10326005 | 3300031852 | Bacteria | 1220 |
| 237 | Ga0307410_10350443 | 3300031852 | Bacteria | 1179 |
| 238 | Ga0307410_10970122 | 3300031852 | Bacteria | 731 |
| 239 | Ga0307410_11020515 | 3300031852 | Bacteria | 714 |
| 240 | Ga0307406_10048427 | 3300031901 | Bacteria | 2684 |
| 241 | Ga0307406_10078742 | 3300031901 | Bacteria | 2184 |
| 242 | Ga0307406_10277682 | 3300031901 | Bacteria | 1276 |
| 243 | Ga0307406_10342908 | 3300031901 | Bacteria | 1164 |
| 244 | Ga0307406_10543856 | 3300031901 | Bacteria | 949 |
| 245 | Ga0307406_10681713 | 3300031901 | Bacteria | 856 |
| 246 | Ga0307406_11147593 | 3300031901 | Bacteria | 673 |
| 247 | Ga0307406_11732169 | 3300031901 | Bacteria | 554 |
| 248 | Ga0307407_10015990 | 3300031903 | Bacteria | 3726 |
| 249 | Ga0307407_10026176 | 3300031903 | Bacteria | 3086 |
| 250 | Ga0307407_10082787 | 3300031903 | Bacteria | 1946 |
| 251 | Ga0307407_10160248 | 3300031903 | Bacteria | 1472 |
| 252 | Ga0307407_10388252 | 3300031903 | Bacteria | 998 |
| 253 | Ga0307412_10003040 | 3300031911 | Bacteria | 9291 |
| 254 | Ga0307412_10028360 | 3300031911 | Bacteria | 3501 |
| 255 | Ga0307412_10043108 | 3300031911 | Bacteria | 2936 |
| 256 | Ga0307412_10140376 | 3300031911 | Bacteria | 1768 |
| 257 | Ga0307412_10151304 | 3300031911 | Bacteria | 1712 |
| 258 | Ga0307412_10496113 | 3300031911 | Bacteria | 1015 |
| 259 | Ga0307412_11045383 | 3300031911 | Bacteria | 724 |
| 260 | Ga0307409_100018657 | 3300031995 | Bacteria | 4672 |
| 261 | Ga0307409_100075115 | 3300031995 | Bacteria | 2704 |
| 262 | Ga0307409_100112570 | 3300031995 | Bacteria | 2285 |
| 263 | Ga0307409_100442578 | 3300031995 | Bacteria | 1252 |
| 264 | Ga0307409_100484245 | 3300031995 | Bacteria | 1201 |
| 265 | Ga0307409_101087662 | 3300031995 | Bacteria | 820 |
| 266 | Ga0307409_101463084 | 3300031995 | Bacteria | 710 |
| 267 | Ga0307416_100050474 | 3300032002 | Bacteria | 3316 |
| 268 | Ga0307416_100065713 | 3300032002 | Bacteria | 2982 |
| 269 | Ga0307416_100071746 | 3300032002 | Bacteria | 2878 |
| 270 | Ga0307416_100130013 | 3300032002 | Bacteria | 2264 |
| 271 | Ga0307416_100205145 | 3300032002 | Bacteria | 1874 |
| 272 | Ga0307416_100434199 | 3300032002 | Bacteria | 1361 |
| 273 | Ga0307416_100519627 | 3300032002 | Bacteria | 1258 |
| 274 | Ga0307416_100645295 | 3300032002 | Bacteria | 1143 |
| 275 | Ga0307416_101329575 | 3300032002 | Bacteria | 824 |
| 276 | Ga0307416_102431271 | 3300032002 | Bacteria | 623 |
| 277 | Ga0307414_10113227 | 3300032004 | Bacteria | 2070 |
| 278 | Ga0307414_10127416 | 3300032004 | Bacteria | 1970 |
| 279 | Ga0307414_10443380 | 3300032004 | Bacteria | 1137 |
| 280 | Ga0307414_11644519 | 3300032004 | Bacteria | 599 |
| 281 | Ga0307411_10046051 | 3300032005 | Bacteria | 2809 |
| 282 | Ga0307411_10057518 | 3300032005 | Bacteria | 2569 |
| 283 | Ga0307411_10116931 | 3300032005 | Bacteria | 1920 |
| 284 | Ga0307411_10906166 | 3300032005 | Bacteria | 784 |
| 285 | Ga0307415_100032569 | 3300032126 | Bacteria | 3372 |
| 286 | Ga0307415_100055942 | 3300032126 | Bacteria | 2702 |
| 287 | Ga0307415_100081580 | 3300032126 | Bacteria | 2311 |
| 288 | Ga0307415_100092139 | 3300032126 | Bacteria | 2197 |
| 289 | Ga0307415_100960594 | 3300032126 | Bacteria | 792 |
| 290 | Ga0307415_101758513 | 3300032126 | Bacteria | 599 |
| 291 | Ga0373927_0444366 | 3300035695 | Bacteria | 856 |
| 292 | Ga0373947_0506516 | 3300035725 | Bacteria | 820 |
| 293 | Ga0373937_1651333 | 3300036401 | Bacteria | 588 |
| 294 | Ga0395899_0019700 | 3300037312 | Bacteria | 5122 |
| 295 | Ga0395900_0128016 | 3300037418 | Bacteria | 2603 |
| 296 | Ga0395898_0180164 | 3300037466 | Bacteria | 2019 |
| 297 | Ga0395905_0163204 | 3300037471 | Bacteria | 2094 |
| 298 | Ga0395901_0048797 | 3300038443 | Bacteria | 4397 |
| 299 | Ga0439436_0000563 | 3300041404 | Bacteria | 9783 |
| 300 | Ga0439436_0031567 | 3300041404 | Bacteria | 1537 |
| 301 | Ga0439436_0046522 | 3300041404 | Bacteria | 1233 |
| 302 | Ga0439438_008981 | 3300041405 | Bacteria | 3267 |
| 303 | Ga0439438_031500 | 3300041405 | Bacteria | 1409 |
| 304 | Ga0439438_033782 | 3300041405 | Bacteria | 1350 |
| 305 | Ga0439439_0040457 | 3300041406 | Bacteria | 1207 |
| 306 | Ga0439461_0003944 | 3300041410 | Bacteria | 2461 |
| 307 | Ga0439466_0001999 | 3300041411 | Bacteria | 7995 |
| 308 | Ga0439466_0007916 | 3300041411 | Bacteria | 4008 |
| 309 | Ga0439466_0027672 | 3300041411 | Bacteria | 1963 |
| 310 | Ga0439465_0000895 | 3300041413 | Bacteria | 9433 |
| 311 | Ga0451802_1673852 | 3300041460 | Bacteria | 542 |
| 312 | Ga0451853_3854387 | 3300041512 | Bacteria | 1128 |
| 313 | Ga0451853_4055978 | 3300041512 | Bacteria | 1190 |
| 314 | Ga0439433_0000495 | 3300041999 | Bacteria | 7322 |
| 315 | Ga0439433_0001654 | 3300041999 | Bacteria | 4642 |
| 316 | Ga0439433_0030795 | 3300041999 | Bacteria | 1227 |
| 317 | Ga0439433_0109346 | 3300041999 | Bacteria | 691 |
| 318 | Ga0439437_001879 | 3300042000 | Archaea | 2230 |
| 319 | Ga0439442_000101 | 3300042002 | Bacteria | 20964 |
| 320 | Ga0439442_000116 | 3300042002 | Bacteria | 19928 |
| 321 | Ga0439442_005175 | 3300042002 | Bacteria | 2613 |
| 322 | Ga0439442_025517 | 3300042002 | Bacteria | 1229 |
| 323 | Ga0439443_000642 | 3300042003 | Archaea | 3315 |
| 324 | Ga0439432_004027 | 3300042006 | Bacteria | 5390 |
| 325 | Ga0439432_057062 | 3300042006 | Bacteria | 1209 |
| 326 | Ga0439449_0000200 | 3300042007 | Bacteria | 20897 |
| 327 | Ga0439449_0002805 | 3300042007 | Bacteria | 6772 |
| 328 | Ga0439449_0024067 | 3300042007 | Bacteria | 2277 |
| 329 | Ga0439449_0042567 | 3300042007 | Bacteria | 1687 |
| 330 | Ga0439449_0043128 | 3300042007 | Bacteria | 1675 |
| 331 | Ga0439449_0149697 | 3300042007 | Bacteria | 870 |
| 332 | Ga0439450_000531 | 3300042008 | Unclassified | 4988 |
| 333 | Ga0439451_000969 | 3300042009 | Archaea | 5547 |
| 334 | Ga0439452_003540 | 3300042010 | Bacteria | 5447 |
| 335 | Ga0439454_001086 | 3300042011 | Archaea | 2485 |
| 336 | Ga0439457_001987 | 3300042014 | Bacteria | 6011 |
| 337 | Ga0439457_022928 | 3300042014 | Bacteria | 1382 |
| 338 | Ga0439462_0021538 | 3300042015 | Bacteria | 1684 |
| 339 | Ga0439462_0053094 | 3300042015 | Bacteria | 1091 |
| 340 | Ga0439462_0079721 | 3300042015 | Bacteria | 894 |
| 341 | Ga0439463_005520 | 3300042016 | Archaea | 3142 |
| 342 | Ga0450912_001660 | 3300042116 | Archaea | 1398 |
| 343 | Ga0450920_004719 | 3300042122 | Bacteria | 2406 |
| 344 | Ga0450920_018084 | 3300042122 | Bacteria | 1348 |
| 345 | Ga0450920_020171 | 3300042122 | Bacteria | 1283 |
| 346 | Ga0450920_036891 | 3300042122 | Bacteria | 970 |
| 347 | Ga0450898_021182 | 3300042134 | Bacteria | 1144 |
| 348 | Ga0450907_000182 | 3300042146 | Bacteria | 23177 |
| 349 | Ga0439434_0000036 | 3300042435 | Bacteria | 32511 |
| 350 | Ga0439434_0013637 | 3300042435 | Bacteria | 2413 |
| 351 | Ga0439435_0000713 | 3300042436 | Archaea | 5546 |
| 352 | Ga0439459_0042063 | 3300042438 | Bacteria | 975 |
| 353 | Ga0439464_0072439 | 3300042439 | Bacteria | 1021 |
| 354 | Ga0439460_0101580 | 3300042461 | Bacteria | 924 |
| 355 | Ga0450918_004775 | 3300042531 | Bacteria | 2456 |
| 356 | Ga0450893_0005733 | 3300042532 | Archaea | 2000 |
| 357 | Ga0439440_0117781 | 3300042993 | Bacteria | 736 |
| 358 | Ga0466972_0000094 | 3300044658 | Bacteria | 78156 |
| 359 | Ga0466960_0206082 | 3300044901 | Bacteria | 1076 |
| 360 | Ga0495629_0212244 | 3300046459 | Bacteria | 1337 |
| 361 | Ga0495629_0567644 | 3300046459 | Bacteria | 761 |
| 362 | Ga0495580_0146549 | 3300046472 | Bacteria | 1636 |
| 363 | Ga0495605_0456561 | 3300046474 | Bacteria | 526 |
| 364 | Ga0495639_0002911 | 3300046475 | Bacteria | 7460 |
| 365 | Ga0495662_0014331 | 3300046476 | Bacteria | 3857 |
| 366 | Ga0495664_0084495 | 3300046477 | Bacteria | 1905 |
| 367 | Ga0495594_0083847 | 3300046499 | Bacteria | 1782 |
| 368 | Ga0495583_0207866 | 3300046506 | Bacteria | 794 |
| 369 | Ga0495630_0155096 | 3300046517 | Bacteria | 1743 |
| 370 | Ga0495631_0017869 | 3300046518 | Bacteria | 3347 |
| 371 | Ga0495643_0022892 | 3300046522 | Bacteria | 3558 |
| 372 | Ga0495642_0026870 | 3300046528 | Bacteria | 2288 |
| 373 | Ga0495654_0286497 | 3300046530 | Bacteria | 676 |
| 374 | Ga0495665_0017382 | 3300046531 | Bacteria | 3868 |
| 375 | Ga0495586_0029284 | 3300046535 | Bacteria | 2946 |
| 376 | Ga0495586_0064664 | 3300046535 | Bacteria | 1993 |
| 377 | Ga0495587_0016852 | 3300046536 | Bacteria | 4544 |
| 378 | Ga0495645_0002905 | 3300046543 | Bacteria | 11629 |
| 379 | Ga0495633_0054893 | 3300046558 | Bacteria | 1873 |
| 380 | Ga0495667_0007751 | 3300046559 | Bacteria | 7274 |
| 381 | Ga0495656_0000682 | 3300046615 | Bacteria | 10935 |
| 382 | Ga0495656_0096819 | 3300046615 | Bacteria | 1359 |
| 383 | Ga0495668_0144886 | 3300046616 | Bacteria | 1300 |
| 384 | Ga0495625_0025741 | 3300046660 | Bacteria | 4457 |
| 385 | Ga0495659_0083376 | 3300046664 | Bacteria | 1217 |
| 386 | Ga0495661_0012401 | 3300046665 | Bacteria | 5754 |
| 387 | Ga0495661_0109154 | 3300046665 | Bacteria | 1545 |
| 388 | Ga0495588_0004816 | 3300046674 | Bacteria | 5974 |
| 389 | Ga0495588_0016464 | 3300046674 | Bacteria | 3573 |
| 390 | Ga0495588_0017021 | 3300046674 | Bacteria | 3522 |
| 391 | Ga0495588_0044889 | 3300046674 | Bacteria | 2264 |
| 392 | Ga0495588_0664578 | 3300046674 | Bacteria | 545 |
| 393 | Ga0495657_0016880 | 3300046675 | Bacteria | 5308 |
| 394 | Ga0495623_0478156 | 3300046679 | Bacteria | 660 |
| 395 | Ga0495669_0308626 | 3300046684 | Bacteria | 763 |
| 396 | Ga0495670_0002876 | 3300046691 | Bacteria | 8495 |
| 397 | Ga0495670_0149270 | 3300046691 | Bacteria | 1225 |
| 398 | Ga0495670_0474549 | 3300046691 | Bacteria | 678 |
| 399 | Ga0495600_0025629 | 3300046809 | Bacteria | 3800 |
| 400 | Ga0495600_0176366 | 3300046809 | Bacteria | 1378 |
| 401 | Ga0495581_0011671 | 3300047315 | Bacteria | 5084 |
| 402 | Ga0495581_0040156 | 3300047315 | Bacteria | 2708 |
| 403 | Ga0495581_0042820 | 3300047315 | Bacteria | 2620 |
| 404 | Ga0495581_0336961 | 3300047315 | Bacteria | 880 |
| 405 | Ga0495636_0006321 | 3300047318 | Bacteria | 4653 |
| 406 | Ga0495636_0214893 | 3300047318 | Bacteria | 881 |
| 407 | Ga0495674_1151035 | 3300047319 | Bacteria | 588 |
| 408 | Ga0495680_0029620 | 3300047322 | Bacteria | 4481 |
| 409 | Ga0495680_0043309 | 3300047322 | Bacteria | 3566 |
| 410 | Ga0495675_0008270 | 3300047444 | Bacteria | 6438 |
| 411 | Ga0495593_0118406 | 3300047673 | Bacteria | 1349 |
| 412 | Ga0496100_0107256 | 3300048903 | Bacteria | 1935 |
| 413 | Ga0496100_0135285 | 3300048903 | Bacteria | 1740 |
| 414 | Ga0496100_0245545 | 3300048903 | Bacteria | 1322 |
| 415 | Ga0496101_0011864 | 3300048904 | Bacteria | 5800 |
| 416 | Ga0496101_0072106 | 3300048904 | Bacteria | 2534 |
| 417 | Ga0496101_0379824 | 3300048904 | Bacteria | 1111 |
| 418 | Ga0496102_0093191 | 3300048905 | Bacteria | 2790 |
| 419 | Ga0496102_0237272 | 3300048905 | Bacteria | 1719 |
| 420 | Ga0496102_0281827 | 3300048905 | Bacteria | 1566 |
| 421 | Ga0496102_0507159 | 3300048905 | Bacteria | 1128 |
| 422 | Ga0496103_0047437 | 3300048906 | Bacteria | 2654 |
| 423 | Ga0496104_0295449 | 3300048907 | Bacteria | 1532 |
| 424 | Ga0496105_0271082 | 3300048908 | Bacteria | 1370 |
| 425 | Ga0496105_1040340 | 3300048908 | Bacteria | 610 |
| 426 | Ga0496106_0114785 | 3300048909 | Bacteria | 2100 |
| 427 | Ga0496106_0519089 | 3300048909 | Bacteria | 956 |
| 428 | Ga0496107_0052727 | 3300048910 | Bacteria | 2933 |
| 429 | Ga0496107_0062322 | 3300048910 | Bacteria | 2701 |
| 430 | Ga0496108_0212465 | 3300048911 | Bacteria | 1680 |
| 431 | Ga0496108_0281963 | 3300048911 | Bacteria | 1446 |
| 432 | Ga0496108_0628370 | 3300048911 | Bacteria | 934 |
| 433 | Ga0496108_0818331 | 3300048911 | Bacteria | 803 |
| 434 | Ga0496109_0011004 | 3300048912 | Bacteria | 7754 |
| 435 | Ga0496109_0065184 | 3300048912 | Bacteria | 3335 |
| 436 | Ga0496109_0193793 | 3300048912 | Bacteria | 1909 |
| 437 | Ga0496110_0015013 | 3300048913 | Bacteria | 6441 |
| 438 | Ga0496110_0018205 | 3300048913 | Bacteria | 5886 |
| 439 | Ga0496110_0028849 | 3300048913 | Bacteria | 4769 |
| 440 | Ga0496110_0148060 | 3300048913 | Bacteria | 2124 |
| 441 | Ga0496110_0521758 | 3300048913 | Bacteria | 1081 |
| 442 | Ga0496111_0034828 | 3300048914 | Bacteria | 3596 |
| 443 | Ga0496111_0099630 | 3300048914 | Bacteria | 2134 |
| 444 | Ga0496111_0203458 | 3300048914 | Bacteria | 1471 |
| 445 | Ga0496112_0121464 | 3300048915 | Bacteria | 2582 |
| 446 | Ga0496112_1458854 | 3300048915 | Bacteria | 598 |
| 447 | Ga0496113_0023899 | 3300048916 | Bacteria | 4338 |
| 448 | Ga0496114_0002889 | 3300048917 | Bacteria | 13165 |
| 449 | Ga0496114_0024267 | 3300048917 | Bacteria | 4948 |
| 450 | Ga0496114_0173090 | 3300048917 | Bacteria | 1882 |
| 451 | Ga0496114_0201406 | 3300048917 | Bacteria | 1743 |
| 452 | Ga0496115_0884118 | 3300048918 | Bacteria | 690 |
| 453 | Ga0496116_0311325 | 3300048919 | Bacteria | 743 |
| 454 | Ga0496117_0115140 | 3300048920 | Bacteria | 1665 |
| 455 | Ga0496120_0178497 | 3300048923 | Bacteria | 1045 |
| 456 | Ga0496121_0061864 | 3300048924 | Bacteria | 3069 |
| 457 | Ga0496121_0252019 | 3300048924 | Bacteria | 1224 |
| 458 | Ga0496121_0488119 | 3300048924 | Unclassified | 785 |
| 459 | Ga0496122_0000039 | 3300048925 | Bacteria | 295352 |
| 460 | Ga0496123_0000026 | 3300048926 | Bacteria | 318040 |
| 461 | Ga0496124_0022429 | 3300048927 | Bacteria | 5787 |
| 462 | Ga0496124_0054539 | 3300048927 | Bacteria | 3383 |
| 463 | Ga0496124_0096990 | 3300048927 | Bacteria | 2394 |
| 464 | Ga0496125_0093140 | 3300048928 | Bacteria | 2250 |
| 465 | Ga0496126_0156083 | 3300048929 | Bacteria | 1953 |
| 466 | Ga0495678_050078 | 3300049459 | Bacteria | 1621 |
| 467 | Ga0501290_022825 | 3300049513 | Bacteria | 865 |
| 468 | Ga0501325_007719 | 3300049541 | Bacteria | 917 |
| 469 | Ga0501325_030772 | 3300049541 | Bacteria | 614 |
| 470 | Ga0501325_037795 | 3300049541 | Bacteria | 577 |
| 471 | Ga0501033_0276311 | 3300049570 | Bacteria | 1187 |
| 472 | Ga0501034_0000581 | 3300049571 | Bacteria | 57797 |
| 473 | Ga0501038_0030004 | 3300049574 | Bacteria | 4814 |
| 474 | Ga0501039_0229007 | 3300049575 | Bacteria | 1461 |
| 475 | Ga0501042_0352530 | 3300049578 | Unclassified | 1065 |
| 476 | Ga0501043_0059443 | 3300049579 | Bacteria | 3000 |
| 477 | Ga0501046_0214074 | 3300049580 | Bacteria | 1429 |
| 478 | Ga0501068_0014073 | 3300049584 | Bacteria | 4567 |
| 479 | Ga0501069_0645690 | 3300049585 | Bacteria | 637 |
| 480 | Ga0501070_0822101 | 3300049586 | Bacteria | 728 |
| 481 | Ga0501072_0011605 | 3300049588 | Bacteria | 6731 |
| 482 | Ga0501073_0094930 | 3300049589 | Bacteria | 2071 |
| 483 | Ga0501076_1073076 | 3300049592 | Bacteria | 663 |
| 484 | Ga0501217_174072 | 3300049661 | Bacteria | 657 |
| 485 | Ga0501227_097186 | 3300049665 | Bacteria | 781 |
| 486 | Ga0501080_0203314 | 3300049742 | Bacteria | 1818 |
| 487 | Ga0501083_0168285 | 3300049744 | Bacteria | 1433 |
| 488 | Ga0501279_004178 | 3300049775 | Bacteria | 1894 |
| 489 | nmdc:mga00v17_220350_c1 | 3300050491 | Bacteria | 1228 |
| 490 | nmdc:mga00v17_321618_c1 | 3300050491 | Unclassified | 1005 |
| 491 | nmdc:mga06z11_268635_c1 | 3300050494 | Bacteria | 1008 |
| 492 | nmdc:mga04h51_522754_c1 | 3300050495 | Bacteria | 509 |
| 493 | nmdc:mga05p37_999542_c1 | 3300050507 | Bacteria | 889 |
| 494 | nmdc:mga09592_1259289_c1 | 3300050508 | Bacteria | 609 |
| 495 | nmdc:mga0qj67_327406_c1 | 3300050509 | Bacteria | 1240 |
| 496 | nmdc:mga0qj67_891840_c1 | 3300050509 | Bacteria | 701 |
| 497 | nmdc:mga0n895_1074903_c1 | 3300050512 | Bacteria | 783 |
| 498 | nmdc:mga0a205_125026_c1 | 3300050515 | Unclassified | 2471 |
| 499 | Ga0500646_0155416 | 3300053090 | Bacteria | 760 |
| 500 | Ga0500594_0125053 | 3300053118 | Bacteria | 810 |
| 501 | Ga0500608_049475 | 3300053122 | Bacteria | 2021 |
| 502 | Ga0500618_026607 | 3300053125 | Bacteria | 1381 |
| 503 | Ga0500559_0007488 | 3300053136 | Bacteria | 4831 |
| 504 | Ga0500559_0197890 | 3300053136 | Bacteria | 947 |
| 505 | Ga0500573_0052103 | 3300053140 | Bacteria | 2353 |
| 506 | Ga0500588_0014962 | 3300053146 | Bacteria | 1977 |
| 507 | Ga0500616_0001274 | 3300053153 | Bacteria | 25179 |
| 508 | Ga0500611_002300 | 3300053727 | Bacteria | 2263 |
| 509 | Ga0500645_100124 | 3300053730 | Bacteria | 818 |
| 510 | Ga0590074_023902 | 3300059423 | Unclassified | 1061 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_101180167 | Ga0070670_1011801672 | 120 |
| 2 | 3300025925 | Ga0207650_11204142 | Ga0207650_112041421 | 120 |
| 3 | 3300048909 | Ga0496106_0114785 | Ga0496106_0114785_916_1341 | 120 |
| 4 | 3300048911 | Ga0496108_0818331 | Ga0496108_0818331_358_783 | 120 |
| 5 | 3300048912 | Ga0496109_0065184 | Ga0496109_0065184_2496_2921 | 120 |
| 6 | 3300048913 | Ga0496110_0521758 | Ga0496110_0521758_124_549 | 120 |
| 7 | 3300048915 | Ga0496112_1458854 | Ga0496112_1458854_89_514 | 120 |
| 8 | 3300048906 | Ga0496103_0047437 | Ga0496103_0047437_102_527 | 121 |
| 9 | 3300028379 | Ga0268266_10404985 | Ga0268266_104049851 | 125 |
| 10 | 3300005288 | Ga0065714_10011280 | Ga0065714_100112802 | 127 |
| 11 | 3300005290 | Ga0065712_10367915 | Ga0065712_103679151 | 127 |
| 12 | 3300005328 | Ga0070676_10287671 | Ga0070676_102876712 | 127 |
| 13 | 3300005331 | Ga0070670_100025407 | Ga0070670_1000254073 | 127 |
| 14 | 3300005333 | Ga0070677_10131296 | Ga0070677_101312962 | 127 |
| 15 | 3300005347 | Ga0070668_100272624 | Ga0070668_1002726242 | 127 |
| 16 | 3300005353 | Ga0070669_100006090 | Ga0070669_1000060902 | 127 |
| 17 | 3300005355 | Ga0070671_100060533 | Ga0070671_1000605332 | 127 |
| 18 | 3300005367 | Ga0070667_100417672 | Ga0070667_1004176722 | 127 |
| 19 | 3300005456 | Ga0070678_100211676 | Ga0070678_1002116762 | 127 |
| 20 | 3300014968 | Ga0157379_10997227 | Ga0157379_109972271 | 127 |
| 21 | 3300025735 | Ga0207713_1072135 | Ga0207713_10721352 | 127 |
| 22 | 3300025903 | Ga0207680_10068037 | Ga0207680_100680372 | 127 |
| 23 | 3300025923 | Ga0207681_10299895 | Ga0207681_102998952 | 127 |
| 24 | 3300025931 | Ga0207644_10038478 | Ga0207644_100384782 | 127 |
| 25 | 3300025960 | Ga0207651_10206577 | Ga0207651_102065772 | 127 |
| 26 | 3300025972 | Ga0207668_10028901 | Ga0207668_100289012 | 127 |
| 27 | 3300037418 | Ga0395900_0128016 | Ga0395900_0128016_1304_1714 | 127 |
| 28 | 3300037466 | Ga0395898_0180164 | Ga0395898_0180164_537_947 | 127 |
| 29 | 3300042000 | Ga0439437_001879 | Ga0439437_001879_1439_1873 | 127 |
| 30 | 3300048905 | Ga0496102_0507159 | Ga0496102_0507159_713_1111 | 127 |
| 31 | 3300048907 | Ga0496104_0295449 | Ga0496104_0295449_18_416 | 127 |
| 32 | 3300048908 | Ga0496105_0271082 | Ga0496105_0271082_958_1356 | 127 |
| 33 | 3300048908 | Ga0496105_1040340 | Ga0496105_1040340_15_413 | 127 |
| 34 | 3300048909 | Ga0496106_0519089 | Ga0496106_0519089_15_413 | 127 |
| 35 | 3300048911 | Ga0496108_0212465 | Ga0496108_0212465_18_416 | 127 |
| 36 | 3300048911 | Ga0496108_0628370 | Ga0496108_0628370_18_416 | 127 |
| 37 | 3300049574 | Ga0501038_0030004 | Ga0501038_0030004_379_786 | 127 |
| 38 | iso_pu_bacteria | 2842694124 | 2842695714 | 128 |
| 39 | iso_pu_bacteria | 2863067949 | 2863072328 | 128 |
| 40 | iso_pu_bacteria | 8008485437 | 8008490014 | 128 |
| 41 | iso_pu_bacteria | 8025524527 | 8025529253 | 128 |
| 42 | 3300005544 | Ga0070686_101052246 | Ga0070686_1010522461 | 129 |
| 43 | 3300053730 | Ga0500645_100124 | Ga0500645_100124_153_551 | 129 |
| 44 | iso_pu_bacteria | 2690315906 | 2691513592 | 129 |
| 45 | iso_pu_bacteria | 2808606370 | 2808890778 | 129 |
| 46 | iso_pu_bacteria | 2842733646 | 2842737110 | 129 |
| 47 | iso_pu_bacteria | 2896085136 | 2896089845 | 129 |
| 48 | iso_pu_bacteria | 2919391150 | 2919393330 | 129 |
| 49 | iso_pu_bacteria | 2939598168 | 2939600157 | 129 |
| 50 | iso_pu_bacteria | 2945920336 | 2945920419 | 129 |
| 51 | iso_pu_bacteria | 2945941187 | 2945943641 | 129 |
| 52 | iso_pu_bacteria | 2945956166 | 2945958176 | 129 |
| 53 | iso_pu_bacteria | 2946037020 | 2946039615 | 129 |
| 54 | iso_pu_bacteria | 2953998280 | 2954000840 | 129 |
| 55 | iso_pu_bacteria | 8007375930 | 8007378760 | 129 |
| 56 | iso_pu_bacteria | 8054107350 | 8054111873 | 129 |
| 57 | 3300005536 | Ga0070697_100613372 | Ga0070697_1006133721 | 130 |
| 58 | 3300009147 | Ga0114129_10867695 | Ga0114129_108676952 | 130 |
| 59 | 3300013306 | Ga0163162_10694013 | Ga0163162_106940131 | 130 |
| 60 | 3300025292 | Ga0209676_1000149 | Ga0209676_1000149144 | 130 |
| 61 | 3300006051 | Ga0075364_10744026 | Ga0075364_107440262 | 131 |
| 62 | 3300006178 | Ga0075367_10064648 | Ga0075367_100646483 | 131 |
| 63 | 3300028794 | Ga0307515_10534557 | Ga0307515_105345572 | 131 |
| 64 | 3300049570 | Ga0501033_0276311 | Ga0501033_0276311_530_937 | 131 |
| 65 | 3300050494 | nmdc:mga06z11_268635_c1 | nmdc:mga06z11_268635_c1_398_802 | 131 |
| 66 | 3300001990 | JGI24737J22298_10226061 | JGI24737J22298_102260611 | 132 |
| 67 | 3300005290 | Ga0065712_10432750 | Ga0065712_104327502 | 132 |
| 68 | 3300005293 | Ga0065715_10490316 | Ga0065715_104903161 | 132 |
| 69 | 3300005329 | Ga0070683_100048048 | Ga0070683_1000480485 | 132 |
| 70 | 3300005330 | Ga0070690_100198762 | Ga0070690_1001987622 | 132 |
| 71 | 3300005340 | Ga0070689_100012167 | Ga0070689_1000121675 | 132 |
| 72 | 3300005340 | Ga0070689_100092805 | Ga0070689_1000928052 | 132 |
| 73 | 3300005340 | Ga0070689_100136231 | Ga0070689_1001362312 | 132 |
| 74 | 3300005341 | Ga0070691_10674487 | Ga0070691_106744871 | 132 |
| 75 | 3300005343 | Ga0070687_100242109 | Ga0070687_1002421091 | 132 |
| 76 | 3300005354 | Ga0070675_100328286 | Ga0070675_1003282862 | 132 |
| 77 | 3300005366 | Ga0070659_101335504 | Ga0070659_1013355042 | 132 |
| 78 | 3300005438 | Ga0070701_10041098 | Ga0070701_100410983 | 132 |
| 79 | 3300005439 | Ga0070711_101648486 | Ga0070711_1016484861 | 132 |
| 80 | 3300005441 | Ga0070700_100498985 | Ga0070700_1004989852 | 132 |
| 81 | 3300005444 | Ga0070694_100012128 | Ga0070694_1000121282 | 132 |
| 82 | 3300005466 | Ga0070685_10318830 | Ga0070685_103188302 | 132 |
| 83 | 3300005467 | Ga0070706_100256364 | Ga0070706_1002563643 | 132 |
| 84 | 3300005471 | Ga0070698_100312863 | Ga0070698_1003128632 | 132 |
| 85 | 3300005535 | Ga0070684_102340227 | Ga0070684_1023402271 | 132 |
| 86 | 3300005544 | Ga0070686_100008218 | Ga0070686_1000082184 | 132 |
| 87 | 3300005544 | Ga0070686_100094785 | Ga0070686_1000947853 | 132 |
| 88 | 3300005545 | Ga0070695_100040840 | Ga0070695_1000408402 | 132 |
| 89 | 3300005545 | Ga0070695_100438659 | Ga0070695_1004386591 | 132 |
| 90 | 3300005548 | Ga0070665_100057510 | Ga0070665_1000575103 | 132 |
| 91 | 3300005549 | Ga0070704_100225021 | Ga0070704_1002250211 | 132 |
| 92 | 3300005615 | Ga0070702_100011357 | Ga0070702_1000113573 | 132 |
| 93 | 3300005616 | Ga0068852_100295998 | Ga0068852_1002959982 | 132 |
| 94 | 3300005617 | Ga0068859_100207311 | Ga0068859_1002073112 | 132 |
| 95 | 3300005618 | Ga0068864_100043617 | Ga0068864_1000436173 | 132 |
| 96 | 3300005718 | Ga0068866_10315846 | Ga0068866_103158462 | 132 |
| 97 | 3300005719 | Ga0068861_100015198 | Ga0068861_1000151984 | 132 |
| 98 | 3300005719 | Ga0068861_100070619 | Ga0068861_1000706193 | 132 |
| 99 | 3300005843 | Ga0068860_100043352 | Ga0068860_1000433523 | 132 |
| 100 | 3300006038 | Ga0075365_10021856 | Ga0075365_100218565 | 132 |
| 101 | 3300006846 | Ga0075430_100896345 | Ga0075430_1008963452 | 132 |
| 102 | 3300006847 | Ga0075431_101515467 | Ga0075431_1015154672 | 132 |
| 103 | 3300006931 | Ga0097620_100207310 | Ga0097620_1002073103 | 132 |
| 104 | 3300009177 | Ga0105248_12418326 | Ga0105248_124183261 | 132 |
| 105 | 3300013296 | Ga0157374_11461872 | Ga0157374_114618722 | 132 |
| 106 | 3300013297 | Ga0157378_11069767 | Ga0157378_110697672 | 132 |
| 107 | 3300014326 | Ga0157380_10088284 | Ga0157380_100882842 | 132 |
| 108 | 3300014326 | Ga0157380_11445980 | Ga0157380_114459802 | 132 |
| 109 | 3300025899 | Ga0207642_10194372 | Ga0207642_101943722 | 132 |
| 110 | 3300025903 | Ga0207680_10527061 | Ga0207680_105270611 | 132 |
| 111 | 3300025910 | Ga0207684_11318542 | Ga0207684_113185422 | 132 |
| 112 | 3300025918 | Ga0207662_10112560 | Ga0207662_101125602 | 132 |
| 113 | 3300025936 | Ga0207670_10071419 | Ga0207670_100714192 | 132 |
| 114 | 3300025936 | Ga0207670_10940604 | Ga0207670_109406041 | 132 |
| 115 | 3300025945 | Ga0207679_11610712 | Ga0207679_116107122 | 132 |
| 116 | 3300025972 | Ga0207668_11216732 | Ga0207668_112167321 | 132 |
| 117 | 3300026023 | Ga0207677_11499442 | Ga0207677_114994421 | 132 |
| 118 | 3300026075 | Ga0207708_10023115 | Ga0207708_100231157 | 132 |
| 119 | 3300026075 | Ga0207708_10355132 | Ga0207708_103551322 | 132 |
| 120 | 3300026089 | Ga0207648_10342281 | Ga0207648_103422813 | 132 |
| 121 | 3300026095 | Ga0207676_10158827 | Ga0207676_101588273 | 132 |
| 122 | 3300026118 | Ga0207675_100002498 | Ga0207675_1000024988 | 132 |
| 123 | 3300026118 | Ga0207675_100091494 | Ga0207675_1000914943 | 132 |
| 124 | 3300026121 | Ga0207683_10571545 | Ga0207683_105715452 | 132 |
| 125 | 3300028379 | Ga0268266_10225119 | Ga0268266_102251193 | 132 |
| 126 | 3300030731 | Ga0316177_1002752 | Ga0316177_10027524 | 132 |
| 127 | 3300030733 | Ga0314311_1152501 | Ga0314311_11525013 | 132 |
| 128 | 3300031731 | Ga0307405_10538052 | Ga0307405_105380522 | 132 |
| 129 | 3300031824 | Ga0307413_10014659 | Ga0307413_100146594 | 132 |
| 130 | 3300031852 | Ga0307410_10058629 | Ga0307410_100586293 | 132 |
| 131 | 3300031901 | Ga0307406_10543856 | Ga0307406_105438562 | 132 |
| 132 | 3300031903 | Ga0307407_10388252 | Ga0307407_103882522 | 132 |
| 133 | 3300031995 | Ga0307409_100484245 | Ga0307409_1004842452 | 132 |
| 134 | 3300032005 | Ga0307411_10116931 | Ga0307411_101169313 | 132 |
| 135 | 3300032126 | Ga0307415_100092139 | Ga0307415_1000921392 | 132 |
| 136 | 3300042134 | Ga0450898_021182 | Ga0450898_021182_48_452 | 132 |
| 137 | 3300042438 | Ga0439459_0042063 | Ga0439459_0042063_520_921 | 132 |
| 138 | 3300044901 | Ga0466960_0206082 | Ga0466960_0206082_537_935 | 132 |
| 139 | 3300046474 | Ga0495605_0456561 | Ga0495605_0456561_98_496 | 132 |
| 140 | 3300046660 | Ga0495625_0025741 | Ga0495625_0025741_2047_2451 | 132 |
| 141 | 3300048903 | Ga0496100_0107256 | Ga0496100_0107256_1400_1807 | 132 |
| 142 | 3300048917 | Ga0496114_0173090 | Ga0496114_0173090_121_528 | 132 |
| 143 | 3300049571 | Ga0501034_0000581 | Ga0501034_0000581_45408_45815 | 132 |
| 144 | 3300049584 | Ga0501068_0014073 | Ga0501068_0014073_3664_4077 | 132 |
| 145 | 3300049585 | Ga0501069_0645690 | Ga0501069_0645690_163_576 | 132 |
| 146 | 3300049586 | Ga0501070_0822101 | Ga0501070_0822101_216_629 | 132 |
| 147 | 3300049588 | Ga0501072_0011605 | Ga0501072_0011605_2895_3302 | 132 |
| 148 | 3300049589 | Ga0501073_0094930 | Ga0501073_0094930_907_1320 | 132 |
| 149 | 3300049744 | Ga0501083_0168285 | Ga0501083_0168285_819_1232 | 132 |
| 150 | 3300050491 | nmdc:mga00v17_220350_c1 | nmdc:mga00v17_220350_c1_520_918 | 132 |
| 151 | 3300050491 | nmdc:mga00v17_321618_c1 | nmdc:mga00v17_321618_c1_140_556 | 132 |
| 152 | 3300050508 | nmdc:mga09592_1259289_c1 | nmdc:mga09592_1259289_c1_43_477 | 132 |
| 153 | 3300050509 | nmdc:mga0qj67_327406_c1 | nmdc:mga0qj67_327406_c1_532_936 | 132 |
| 154 | 3300050509 | nmdc:mga0qj67_891840_c1 | nmdc:mga0qj67_891840_c1_210_608 | 132 |
| 155 | 3300053727 | Ga0500611_002300 | Ga0500611_002300_906_1310 | 132 |
| 156 | iso_pu_bacteria | 2593339198 | 2595315763 | 132 |
| 157 | iso_pu_bacteria | 8033684223 | 8033684828 | 132 |
| 158 | 3300000041 | ARcpr5oldR_c014348 | ARcpr5oldR_0143482 | 133 |
| 159 | 3300000043 | ARcpr5yngRDRAFT_c013757 | ARcpr5yngRDRAFT_0137572 | 133 |
| 160 | 3300000549 | LJQas_1000389 | LJQas_10003894 | 133 |
| 161 | 3300000652 | ARCol0yngRDRAFT_1005214 | ARCol0yngRDRAFT_10052141 | 133 |
| 162 | 3300003320 | rootH2_10203653 | rootH2_102036533 | 133 |
| 163 | 3300003322 | rootL2_10239904 | rootL2_102399042 | 133 |
| 164 | 3300003323 | rootH1_10135344 | rootH1_101353446 | 133 |
| 165 | 3300003373 | JGI25407J50210_10061538 | JGI25407J50210_100615382 | 133 |
| 166 | 3300003578 | Ga0006562J51391_1003923 | Ga0006562J51391_10039231 | 133 |
| 167 | 3300003791 | Ga0055530_10001845 | Ga0055530_100018453 | 133 |
| 168 | 3300003791 | Ga0055530_10004950 | Ga0055530_100049505 | 133 |
| 169 | 3300003792 | Ga0055540_1000013 | Ga0055540_1000013103 | 133 |
| 170 | 3300003794 | Ga0055531_10009126 | Ga0055531_100091263 | 133 |
| 171 | 3300005288 | Ga0065714_10114117 | Ga0065714_101141172 | 133 |
| 172 | 3300005288 | Ga0065714_10520806 | Ga0065714_105208061 | 133 |
| 173 | 3300005289 | Ga0065704_10009070 | Ga0065704_100090704 | 133 |
| 174 | 3300005289 | Ga0065704_10072326 | Ga0065704_100723268 | 133 |
| 175 | 3300005290 | Ga0065712_10269167 | Ga0065712_102691671 | 133 |
| 176 | 3300005293 | Ga0065715_10059131 | Ga0065715_100591311 | 133 |
| 177 | 3300005328 | Ga0070676_10297269 | Ga0070676_102972693 | 133 |
| 178 | 3300005331 | Ga0070670_100924713 | Ga0070670_1009247132 | 133 |
| 179 | 3300005335 | Ga0070666_10065650 | Ga0070666_100656502 | 133 |
| 180 | 3300005339 | Ga0070660_100224564 | Ga0070660_1002245642 | 133 |
| 181 | 3300005344 | Ga0070661_100067995 | Ga0070661_1000679952 | 133 |
| 182 | 3300005347 | Ga0070668_100398362 | Ga0070668_1003983622 | 133 |
| 183 | 3300005353 | Ga0070669_100005196 | Ga0070669_10000519610 | 133 |
| 184 | 3300005353 | Ga0070669_101069571 | Ga0070669_1010695711 | 133 |
| 185 | 3300005355 | Ga0070671_100360839 | Ga0070671_1003608391 | 133 |
| 186 | 3300005356 | Ga0070674_101106302 | Ga0070674_1011063021 | 133 |
| 187 | 3300005364 | Ga0070673_100069776 | Ga0070673_1000697762 | 133 |
| 188 | 3300005364 | Ga0070673_100261125 | Ga0070673_1002611253 | 133 |
| 189 | 3300005437 | Ga0070710_10022516 | Ga0070710_100225164 | 133 |
| 190 | 3300005439 | Ga0070711_100433079 | Ga0070711_1004330791 | 133 |
| 191 | 3300005439 | Ga0070711_100864923 | Ga0070711_1008649232 | 133 |
| 192 | 3300005444 | Ga0070694_100167386 | Ga0070694_1001673862 | 133 |
| 193 | 3300005457 | Ga0070662_100688790 | Ga0070662_1006887902 | 133 |
| 194 | 3300005471 | Ga0070698_100125614 | Ga0070698_1001256142 | 133 |
| 195 | 3300005518 | Ga0070699_100022700 | Ga0070699_1000227003 | 133 |
| 196 | 3300005518 | Ga0070699_101360583 | Ga0070699_1013605831 | 133 |
| 197 | 3300005543 | Ga0070672_100695519 | Ga0070672_1006955192 | 133 |
| 198 | 3300005545 | Ga0070695_100191430 | Ga0070695_1001914302 | 133 |
| 199 | 3300005577 | Ga0068857_100727712 | Ga0068857_1007277122 | 133 |
| 200 | 3300005578 | Ga0068854_101815052 | Ga0068854_1018150521 | 133 |
| 201 | 3300005841 | Ga0068863_101328711 | Ga0068863_1013287111 | 133 |
| 202 | 3300005841 | Ga0068863_101366606 | Ga0068863_1013666062 | 133 |
| 203 | 3300005981 | Ga0081538_10010987 | Ga0081538_100109877 | 133 |
| 204 | 3300006058 | Ga0075432_10008524 | Ga0075432_100085242 | 133 |
| 205 | 3300006058 | Ga0075432_10008617 | Ga0075432_100086174 | 133 |
| 206 | 3300006871 | Ga0075434_100110936 | Ga0075434_1001109363 | 133 |
| 207 | 3300006881 | Ga0068865_100088405 | Ga0068865_1000884054 | 133 |
| 208 | 3300006946 | Ga0079104_1000001 | Ga0079104_100000142 | 133 |
| 209 | 3300009011 | Ga0105251_10174457 | Ga0105251_101744572 | 133 |
| 210 | 3300009094 | Ga0111539_10132140 | Ga0111539_101321402 | 133 |
| 211 | 3300009094 | Ga0111539_11008936 | Ga0111539_110089362 | 133 |
| 212 | 3300009147 | Ga0114129_10790682 | Ga0114129_107906822 | 133 |
| 213 | 3300009148 | Ga0105243_10052356 | Ga0105243_100523562 | 133 |
| 214 | 3300009148 | Ga0105243_10058878 | Ga0105243_100588782 | 133 |
| 215 | 3300009176 | Ga0105242_10245871 | Ga0105242_102458712 | 133 |
| 216 | 3300009176 | Ga0105242_10460144 | Ga0105242_104601442 | 133 |
| 217 | 3300009553 | Ga0105249_10434926 | Ga0105249_104349263 | 133 |
| 218 | 3300010375 | Ga0105239_10575650 | Ga0105239_105756503 | 133 |
| 219 | 3300011119 | Ga0105246_10033162 | Ga0105246_100331624 | 133 |
| 220 | 3300011119 | Ga0105246_10135191 | Ga0105246_101351912 | 133 |
| 221 | 3300012515 | Ga0157338_1003700 | Ga0157338_10037002 | 133 |
| 222 | 3300013100 | Ga0157373_10023577 | Ga0157373_100235772 | 133 |
| 223 | 3300013102 | Ga0157371_10773117 | Ga0157371_107731172 | 133 |
| 224 | 3300013296 | Ga0157374_10296706 | Ga0157374_102967062 | 133 |
| 225 | 3300013297 | Ga0157378_10023083 | Ga0157378_100230835 | 133 |
| 226 | 3300013297 | Ga0157378_10125763 | Ga0157378_101257632 | 133 |
| 227 | 3300013306 | Ga0163162_10472428 | Ga0163162_104724282 | 133 |
| 228 | 3300013306 | Ga0163162_11069588 | Ga0163162_110695882 | 133 |
| 229 | 3300013308 | Ga0157375_10820212 | Ga0157375_108202122 | 133 |
| 230 | 3300013308 | Ga0157375_11991146 | Ga0157375_119911462 | 133 |
| 231 | 3300014497 | Ga0182008_10008258 | Ga0182008_100082586 | 133 |
| 232 | 3300017792 | Ga0163161_10071251 | Ga0163161_100712514 | 133 |
| 233 | 3300025229 | Ga0209147_100110 | Ga0209147_10011061 | 133 |
| 234 | 3300025263 | Ga0209565_1026697 | Ga0209565_10266972 | 133 |
| 235 | 3300025291 | Ga0209675_1017986 | Ga0209675_10179862 | 133 |
| 236 | 3300025298 | Ga0209050_1000567 | Ga0209050_100056729 | 133 |
| 237 | 3300025298 | Ga0209050_1007645 | Ga0209050_10076456 | 133 |
| 238 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015243 | 133 |
| 239 | 3300025303 | Ga0209051_1000022 | Ga0209051_1000022164 | 133 |
| 240 | 3300025304 | Ga0209257_1000030 | Ga0209257_1000030362 | 133 |
| 241 | 3300025315 | Ga0207697_10158332 | Ga0207697_101583322 | 133 |
| 242 | 3300025728 | Ga0207655_1026217 | Ga0207655_10262175 | 133 |
| 243 | 3300025893 | Ga0207682_10185591 | Ga0207682_101855912 | 133 |
| 244 | 3300025907 | Ga0207645_10007732 | Ga0207645_100077327 | 133 |
| 245 | 3300025923 | Ga0207681_10030754 | Ga0207681_100307543 | 133 |
| 246 | 3300025925 | Ga0207650_10008767 | Ga0207650_100087674 | 133 |
| 247 | 3300025925 | Ga0207650_10009822 | Ga0207650_100098222 | 133 |
| 248 | 3300025925 | Ga0207650_11103314 | Ga0207650_111033141 | 133 |
| 249 | 3300025926 | Ga0207659_10073417 | Ga0207659_100734173 | 133 |
| 250 | 3300025928 | Ga0207700_11280863 | Ga0207700_112808631 | 133 |
| 251 | 3300025931 | Ga0207644_10096399 | Ga0207644_100963992 | 133 |
| 252 | 3300025933 | Ga0207706_10044670 | Ga0207706_100446702 | 133 |
| 253 | 3300025934 | Ga0207686_10698356 | Ga0207686_106983561 | 133 |
| 254 | 3300025937 | Ga0207669_10305642 | Ga0207669_103056422 | 133 |
| 255 | 3300025940 | Ga0207691_10000972 | Ga0207691_100009727 | 133 |
| 256 | 3300025961 | Ga0207712_10494440 | Ga0207712_104944402 | 133 |
| 257 | 3300026023 | Ga0207677_10354147 | Ga0207677_103541473 | 133 |
| 258 | 3300026088 | Ga0207641_10764567 | Ga0207641_107645673 | 133 |
| 259 | 3300026095 | Ga0207676_10256368 | Ga0207676_102563682 | 133 |
| 260 | 3300026121 | Ga0207683_10005968 | Ga0207683_1000596810 | 133 |
| 261 | 3300026121 | Ga0207683_10579794 | Ga0207683_105797943 | 133 |
| 262 | 3300027111 | Ga0209281_1000057 | Ga0209281_1000057272 | 133 |
| 263 | 3300027907 | Ga0207428_10007887 | Ga0207428_100078873 | 133 |
| 264 | 3300028380 | Ga0268265_11560089 | Ga0268265_115600892 | 133 |
| 265 | 3300030744 | Ga0316181_1148685 | Ga0316181_11486851 | 133 |
| 266 | 3300031456 | Ga0307513_10062477 | Ga0307513_100624773 | 133 |
| 267 | 3300031456 | Ga0307513_10448919 | Ga0307513_104489191 | 133 |
| 268 | 3300031548 | Ga0307408_100005441 | Ga0307408_1000054414 | 133 |
| 269 | 3300031548 | Ga0307408_100051596 | Ga0307408_1000515962 | 133 |
| 270 | 3300031548 | Ga0307408_100104586 | Ga0307408_1001045863 | 133 |
| 271 | 3300031548 | Ga0307408_100130698 | Ga0307408_1001306982 | 133 |
| 272 | 3300031548 | Ga0307408_100134221 | Ga0307408_1001342213 | 133 |
| 273 | 3300031548 | Ga0307408_100157485 | Ga0307408_1001574852 | 133 |
| 274 | 3300031548 | Ga0307408_100273745 | Ga0307408_1002737452 | 133 |
| 275 | 3300031548 | Ga0307408_100296870 | Ga0307408_1002968702 | 133 |
| 276 | 3300031548 | Ga0307408_100468637 | Ga0307408_1004686372 | 133 |
| 277 | 3300031548 | Ga0307408_100560914 | Ga0307408_1005609142 | 133 |
| 278 | 3300031731 | Ga0307405_10007056 | Ga0307405_100070564 | 133 |
| 279 | 3300031731 | Ga0307405_10007826 | Ga0307405_100078262 | 133 |
| 280 | 3300031731 | Ga0307405_10035631 | Ga0307405_100356312 | 133 |
| 281 | 3300031731 | Ga0307405_10039154 | Ga0307405_100391542 | 133 |
| 282 | 3300031731 | Ga0307405_10043458 | Ga0307405_100434582 | 133 |
| 283 | 3300031731 | Ga0307405_10073778 | Ga0307405_100737783 | 133 |
| 284 | 3300031731 | Ga0307405_10074644 | Ga0307405_100746442 | 133 |
| 285 | 3300031731 | Ga0307405_10096829 | Ga0307405_100968293 | 133 |
| 286 | 3300031731 | Ga0307405_10118491 | Ga0307405_101184912 | 133 |
| 287 | 3300031731 | Ga0307405_10322901 | Ga0307405_103229012 | 133 |
| 288 | 3300031731 | Ga0307405_10473298 | Ga0307405_104732982 | 133 |
| 289 | 3300031824 | Ga0307413_10001948 | Ga0307413_100019487 | 133 |
| 290 | 3300031824 | Ga0307413_10031868 | Ga0307413_100318682 | 133 |
| 291 | 3300031824 | Ga0307413_10145041 | Ga0307413_101450412 | 133 |
| 292 | 3300031824 | Ga0307413_10148139 | Ga0307413_101481392 | 133 |
| 293 | 3300031824 | Ga0307413_10415420 | Ga0307413_104154201 | 133 |
| 294 | 3300031824 | Ga0307413_11209034 | Ga0307413_112090342 | 133 |
| 295 | 3300031852 | Ga0307410_10053081 | Ga0307410_100530812 | 133 |
| 296 | 3300031852 | Ga0307410_10055460 | Ga0307410_100554601 | 133 |
| 297 | 3300031852 | Ga0307410_10074805 | Ga0307410_100748052 | 133 |
| 298 | 3300031852 | Ga0307410_10143285 | Ga0307410_101432853 | 133 |
| 299 | 3300031852 | Ga0307410_10154155 | Ga0307410_101541553 | 133 |
| 300 | 3300031852 | Ga0307410_10326005 | Ga0307410_103260052 | 133 |
| 301 | 3300031852 | Ga0307410_10350443 | Ga0307410_103504432 | 133 |
| 302 | 3300031852 | Ga0307410_10970122 | Ga0307410_109701222 | 133 |
| 303 | 3300031852 | Ga0307410_11020515 | Ga0307410_110205152 | 133 |
| 304 | 3300031901 | Ga0307406_10048427 | Ga0307406_100484272 | 133 |
| 305 | 3300031901 | Ga0307406_10078742 | Ga0307406_100787423 | 133 |
| 306 | 3300031901 | Ga0307406_10277682 | Ga0307406_102776822 | 133 |
| 307 | 3300031901 | Ga0307406_10342908 | Ga0307406_103429082 | 133 |
| 308 | 3300031901 | Ga0307406_10681713 | Ga0307406_106817132 | 133 |
| 309 | 3300031901 | Ga0307406_11147593 | Ga0307406_111475932 | 133 |
| 310 | 3300031901 | Ga0307406_11732169 | Ga0307406_117321691 | 133 |
| 311 | 3300031903 | Ga0307407_10015990 | Ga0307407_100159903 | 133 |
| 312 | 3300031903 | Ga0307407_10026176 | Ga0307407_100261762 | 133 |
| 313 | 3300031903 | Ga0307407_10082787 | Ga0307407_100827874 | 133 |
| 314 | 3300031903 | Ga0307407_10160248 | Ga0307407_101602482 | 133 |
| 315 | 3300031911 | Ga0307412_10003040 | Ga0307412_100030404 | 133 |
| 316 | 3300031911 | Ga0307412_10028360 | Ga0307412_100283602 | 133 |
| 317 | 3300031911 | Ga0307412_10043108 | Ga0307412_100431083 | 133 |
| 318 | 3300031911 | Ga0307412_10140376 | Ga0307412_101403762 | 133 |
| 319 | 3300031911 | Ga0307412_10151304 | Ga0307412_101513042 | 133 |
| 320 | 3300031911 | Ga0307412_10496113 | Ga0307412_104961131 | 133 |
| 321 | 3300031911 | Ga0307412_11045383 | Ga0307412_110453832 | 133 |
| 322 | 3300031995 | Ga0307409_100018657 | Ga0307409_1000186574 | 133 |
| 323 | 3300031995 | Ga0307409_100075115 | Ga0307409_1000751152 | 133 |
| 324 | 3300031995 | Ga0307409_100112570 | Ga0307409_1001125702 | 133 |
| 325 | 3300031995 | Ga0307409_100442578 | Ga0307409_1004425782 | 133 |
| 326 | 3300031995 | Ga0307409_101087662 | Ga0307409_1010876622 | 133 |
| 327 | 3300031995 | Ga0307409_101463084 | Ga0307409_1014630841 | 133 |
| 328 | 3300032002 | Ga0307416_100050474 | Ga0307416_1000504743 | 133 |
| 329 | 3300032002 | Ga0307416_100065713 | Ga0307416_1000657133 | 133 |
| 330 | 3300032002 | Ga0307416_100071746 | Ga0307416_1000717462 | 133 |
| 331 | 3300032002 | Ga0307416_100130013 | Ga0307416_1001300133 | 133 |
| 332 | 3300032002 | Ga0307416_100205145 | Ga0307416_1002051452 | 133 |
| 333 | 3300032002 | Ga0307416_100434199 | Ga0307416_1004341992 | 133 |
| 334 | 3300032002 | Ga0307416_100519627 | Ga0307416_1005196272 | 133 |
| 335 | 3300032002 | Ga0307416_100645295 | Ga0307416_1006452952 | 133 |
| 336 | 3300032002 | Ga0307416_101329575 | Ga0307416_1013295751 | 133 |
| 337 | 3300032002 | Ga0307416_102431271 | Ga0307416_1024312712 | 133 |
| 338 | 3300032004 | Ga0307414_10113227 | Ga0307414_101132272 | 133 |
| 339 | 3300032004 | Ga0307414_10127416 | Ga0307414_101274164 | 133 |
| 340 | 3300032004 | Ga0307414_10443380 | Ga0307414_104433802 | 133 |
| 341 | 3300032004 | Ga0307414_11644519 | Ga0307414_116445191 | 133 |
| 342 | 3300032005 | Ga0307411_10046051 | Ga0307411_100460514 | 133 |
| 343 | 3300032005 | Ga0307411_10057518 | Ga0307411_100575182 | 133 |
| 344 | 3300032005 | Ga0307411_10906166 | Ga0307411_109061662 | 133 |
| 345 | 3300032126 | Ga0307415_100032569 | Ga0307415_1000325692 | 133 |
| 346 | 3300032126 | Ga0307415_100055942 | Ga0307415_1000559422 | 133 |
| 347 | 3300032126 | Ga0307415_100081580 | Ga0307415_1000815803 | 133 |
| 348 | 3300032126 | Ga0307415_100960594 | Ga0307415_1009605942 | 133 |
| 349 | 3300032126 | Ga0307415_101758513 | Ga0307415_1017585131 | 133 |
| 350 | 3300035695 | Ga0373927_0444366 | Ga0373927_0444366_166_567 | 133 |
| 351 | 3300035725 | Ga0373947_0506516 | Ga0373947_0506516_296_697 | 133 |
| 352 | 3300036401 | Ga0373937_1651333 | Ga0373937_1651333_107_523 | 133 |
| 353 | 3300037312 | Ga0395899_0019700 | Ga0395899_0019700_1650_2078 | 133 |
| 354 | 3300037471 | Ga0395905_0163204 | Ga0395905_0163204_1061_1489 | 133 |
| 355 | 3300038443 | Ga0395901_0048797 | Ga0395901_0048797_3068_3496 | 133 |
| 356 | 3300041404 | Ga0439436_0000563 | Ga0439436_0000563_737_1156 | 133 |
| 357 | 3300041404 | Ga0439436_0031567 | Ga0439436_0031567_1012_1455 | 133 |
| 358 | 3300041404 | Ga0439436_0046522 | Ga0439436_0046522_512_919 | 133 |
| 359 | 3300041405 | Ga0439438_008981 | Ga0439438_008981_2687_3106 | 133 |
| 360 | 3300041405 | Ga0439438_031500 | Ga0439438_031500_731_1138 | 133 |
| 361 | 3300041405 | Ga0439438_033782 | Ga0439438_033782_595_1038 | 133 |
| 362 | 3300041406 | Ga0439439_0040457 | Ga0439439_0040457_658_1101 | 133 |
| 363 | 3300041410 | Ga0439461_0003944 | Ga0439461_0003944_264_671 | 133 |
| 364 | 3300041411 | Ga0439466_0001999 | Ga0439466_0001999_2287_2694 | 133 |
| 365 | 3300041411 | Ga0439466_0007916 | Ga0439466_0007916_3396_3815 | 133 |
| 366 | 3300041411 | Ga0439466_0027672 | Ga0439466_0027672_1253_1681 | 133 |
| 367 | 3300041413 | Ga0439465_0000895 | Ga0439465_0000895_4014_4421 | 133 |
| 368 | 3300041460 | Ga0451802_1673852 | Ga0451802_1673852_25_435 | 133 |
| 369 | 3300041512 | Ga0451853_3854387 | Ga0451853_3854387_364_765 | 133 |
| 370 | 3300041512 | Ga0451853_4055978 | Ga0451853_4055978_644_1051 | 133 |
| 371 | 3300041999 | Ga0439433_0000495 | Ga0439433_0000495_2481_2888 | 133 |
| 372 | 3300041999 | Ga0439433_0001654 | Ga0439433_0001654_1286_1705 | 133 |
| 373 | 3300041999 | Ga0439433_0030795 | Ga0439433_0030795_101_544 | 133 |
| 374 | 3300041999 | Ga0439433_0109346 | Ga0439433_0109346_27_455 | 133 |
| 375 | 3300042002 | Ga0439442_000101 | Ga0439442_000101_15017_15460 | 133 |
| 376 | 3300042002 | Ga0439442_000116 | Ga0439442_000116_204_647 | 133 |
| 377 | 3300042002 | Ga0439442_005175 | Ga0439442_005175_304_723 | 133 |
| 378 | 3300042002 | Ga0439442_025517 | Ga0439442_025517_170_577 | 133 |
| 379 | 3300042003 | Ga0439443_000642 | Ga0439443_000642_230_664 | 133 |
| 380 | 3300042006 | Ga0439432_004027 | Ga0439432_004027_232_639 | 133 |
| 381 | 3300042006 | Ga0439432_057062 | Ga0439432_057062_578_1021 | 133 |
| 382 | 3300042007 | Ga0439449_0000200 | Ga0439449_0000200_17445_17852 | 133 |
| 383 | 3300042007 | Ga0439449_0002805 | Ga0439449_0002805_1190_1618 | 133 |
| 384 | 3300042007 | Ga0439449_0024067 | Ga0439449_0024067_1502_1945 | 133 |
| 385 | 3300042007 | Ga0439449_0042567 | Ga0439449_0042567_188_622 | 133 |
| 386 | 3300042007 | Ga0439449_0043128 | Ga0439449_0043128_699_1142 | 133 |
| 387 | 3300042007 | Ga0439449_0149697 | Ga0439449_0149697_167_610 | 133 |
| 388 | 3300042008 | Ga0439450_000531 | Ga0439450_000531_171_575 | 133 |
| 389 | 3300042009 | Ga0439451_000969 | Ga0439451_000969_3706_4140 | 133 |
| 390 | 3300042010 | Ga0439452_003540 | Ga0439452_003540_4145_4552 | 133 |
| 391 | 3300042011 | Ga0439454_001086 | Ga0439454_001086_669_1103 | 133 |
| 392 | 3300042014 | Ga0439457_001987 | Ga0439457_001987_1543_1950 | 133 |
| 393 | 3300042014 | Ga0439457_022928 | Ga0439457_022928_171_614 | 133 |
| 394 | 3300042015 | Ga0439462_0021538 | Ga0439462_0021538_250_657 | 133 |
| 395 | 3300042015 | Ga0439462_0053094 | Ga0439462_0053094_576_1019 | 133 |
| 396 | 3300042015 | Ga0439462_0079721 | Ga0439462_0079721_59_487 | 133 |
| 397 | 3300042016 | Ga0439463_005520 | Ga0439463_005520_1011_1445 | 133 |
| 398 | 3300042116 | Ga0450912_001660 | Ga0450912_001660_485_919 | 133 |
| 399 | 3300042122 | Ga0450920_004719 | Ga0450920_004719_1663_2106 | 133 |
| 400 | 3300042122 | Ga0450920_018084 | Ga0450920_018084_301_744 | 133 |
| 401 | 3300042122 | Ga0450920_020171 | Ga0450920_020171_175_618 | 133 |
| 402 | 3300042122 | Ga0450920_036891 | Ga0450920_036891_188_631 | 133 |
| 403 | 3300042146 | Ga0450907_000182 | Ga0450907_000182_14539_14982 | 133 |
| 404 | 3300042435 | Ga0439434_0000036 | Ga0439434_0000036_6353_6796 | 133 |
| 405 | 3300042435 | Ga0439434_0013637 | Ga0439434_0013637_1000_1407 | 133 |
| 406 | 3300042436 | Ga0439435_0000713 | Ga0439435_0000713_1698_2132 | 133 |
| 407 | 3300042439 | Ga0439464_0072439 | Ga0439464_0072439_260_664 | 133 |
| 408 | 3300042461 | Ga0439460_0101580 | Ga0439460_0101580_282_686 | 133 |
| 409 | 3300042531 | Ga0450918_004775 | Ga0450918_004775_695_1138 | 133 |
| 410 | 3300042532 | Ga0450893_0005733 | Ga0450893_0005733_533_967 | 133 |
| 411 | 3300042993 | Ga0439440_0117781 | Ga0439440_0117781_260_694 | 133 |
| 412 | 3300044658 | Ga0466972_0000094 | Ga0466972_0000094_34533_34940 | 133 |
| 413 | 3300046459 | Ga0495629_0212244 | Ga0495629_0212244_739_1155 | 133 |
| 414 | 3300046459 | Ga0495629_0567644 | Ga0495629_0567644_225_641 | 133 |
| 415 | 3300046472 | Ga0495580_0146549 | Ga0495580_0146549_28_444 | 133 |
| 416 | 3300046475 | Ga0495639_0002911 | Ga0495639_0002911_5435_5851 | 133 |
| 417 | 3300046476 | Ga0495662_0014331 | Ga0495662_0014331_64_480 | 133 |
| 418 | 3300046477 | Ga0495664_0084495 | Ga0495664_0084495_1168_1584 | 133 |
| 419 | 3300046499 | Ga0495594_0083847 | Ga0495594_0083847_227_643 | 133 |
| 420 | 3300046506 | Ga0495583_0207866 | Ga0495583_0207866_291_698 | 133 |
| 421 | 3300046517 | Ga0495630_0155096 | Ga0495630_0155096_1055_1471 | 133 |
| 422 | 3300046518 | Ga0495631_0017869 | Ga0495631_0017869_629_1045 | 133 |
| 423 | 3300046522 | Ga0495643_0022892 | Ga0495643_0022892_1889_2305 | 133 |
| 424 | 3300046528 | Ga0495642_0026870 | Ga0495642_0026870_1265_1681 | 133 |
| 425 | 3300046530 | Ga0495654_0286497 | Ga0495654_0286497_142_549 | 133 |
| 426 | 3300046531 | Ga0495665_0017382 | Ga0495665_0017382_3403_3819 | 133 |
| 427 | 3300046535 | Ga0495586_0029284 | Ga0495586_0029284_1294_1710 | 133 |
| 428 | 3300046535 | Ga0495586_0064664 | Ga0495586_0064664_1279_1695 | 133 |
| 429 | 3300046536 | Ga0495587_0016852 | Ga0495587_0016852_3847_4263 | 133 |
| 430 | 3300046543 | Ga0495645_0002905 | Ga0495645_0002905_3533_3949 | 133 |
| 431 | 3300046558 | Ga0495633_0054893 | Ga0495633_0054893_15_431 | 133 |
| 432 | 3300046559 | Ga0495667_0007751 | Ga0495667_0007751_1500_1916 | 133 |
| 433 | 3300046615 | Ga0495656_0000682 | Ga0495656_0000682_2637_3053 | 133 |
| 434 | 3300046615 | Ga0495656_0096819 | Ga0495656_0096819_918_1334 | 133 |
| 435 | 3300046616 | Ga0495668_0144886 | Ga0495668_0144886_443_859 | 133 |
| 436 | 3300046664 | Ga0495659_0083376 | Ga0495659_0083376_203_619 | 133 |
| 437 | 3300046665 | Ga0495661_0012401 | Ga0495661_0012401_1649_2056 | 133 |
| 438 | 3300046665 | Ga0495661_0109154 | Ga0495661_0109154_731_1147 | 133 |
| 439 | 3300046674 | Ga0495588_0004816 | Ga0495588_0004816_5070_5486 | 133 |
| 440 | 3300046674 | Ga0495588_0016464 | Ga0495588_0016464_1163_1579 | 133 |
| 441 | 3300046674 | Ga0495588_0017021 | Ga0495588_0017021_1726_2142 | 133 |
| 442 | 3300046674 | Ga0495588_0044889 | Ga0495588_0044889_1807_2223 | 133 |
| 443 | 3300046674 | Ga0495588_0664578 | Ga0495588_0664578_118_534 | 133 |
| 444 | 3300046675 | Ga0495657_0016880 | Ga0495657_0016880_4535_4951 | 133 |
| 445 | 3300046679 | Ga0495623_0478156 | Ga0495623_0478156_19_435 | 133 |
| 446 | 3300046684 | Ga0495669_0308626 | Ga0495669_0308626_75_491 | 133 |
| 447 | 3300046691 | Ga0495670_0002876 | Ga0495670_0002876_4060_4476 | 133 |
| 448 | 3300046691 | Ga0495670_0149270 | Ga0495670_0149270_718_1134 | 133 |
| 449 | 3300046691 | Ga0495670_0474549 | Ga0495670_0474549_14_430 | 133 |
| 450 | 3300046809 | Ga0495600_0025629 | Ga0495600_0025629_195_611 | 133 |
| 451 | 3300046809 | Ga0495600_0176366 | Ga0495600_0176366_818_1234 | 133 |
| 452 | 3300047315 | Ga0495581_0011671 | Ga0495581_0011671_4335_4751 | 133 |
| 453 | 3300047315 | Ga0495581_0040156 | Ga0495581_0040156_1718_2134 | 133 |
| 454 | 3300047315 | Ga0495581_0042820 | Ga0495581_0042820_1832_2248 | 133 |
| 455 | 3300047315 | Ga0495581_0336961 | Ga0495581_0336961_366_782 | 133 |
| 456 | 3300047318 | Ga0495636_0006321 | Ga0495636_0006321_2633_3049 | 133 |
| 457 | 3300047318 | Ga0495636_0214893 | Ga0495636_0214893_390_791 | 133 |
| 458 | 3300047319 | Ga0495674_1151035 | Ga0495674_1151035_50_466 | 133 |
| 459 | 3300047322 | Ga0495680_0029620 | Ga0495680_0029620_3734_4150 | 133 |
| 460 | 3300047322 | Ga0495680_0043309 | Ga0495680_0043309_1217_1633 | 133 |
| 461 | 3300047444 | Ga0495675_0008270 | Ga0495675_0008270_1910_2326 | 133 |
| 462 | 3300047673 | Ga0495593_0118406 | Ga0495593_0118406_483_899 | 133 |
| 463 | 3300048903 | Ga0496100_0135285 | Ga0496100_0135285_308_724 | 133 |
| 464 | 3300048903 | Ga0496100_0245545 | Ga0496100_0245545_776_1192 | 133 |
| 465 | 3300048904 | Ga0496101_0011864 | Ga0496101_0011864_1498_1914 | 133 |
| 466 | 3300048904 | Ga0496101_0072106 | Ga0496101_0072106_628_1044 | 133 |
| 467 | 3300048904 | Ga0496101_0379824 | Ga0496101_0379824_152_568 | 133 |
| 468 | 3300048905 | Ga0496102_0093191 | Ga0496102_0093191_1219_1635 | 133 |
| 469 | 3300048905 | Ga0496102_0237272 | Ga0496102_0237272_316_732 | 133 |
| 470 | 3300048905 | Ga0496102_0281827 | Ga0496102_0281827_1104_1520 | 133 |
| 471 | 3300048910 | Ga0496107_0052727 | Ga0496107_0052727_2482_2898 | 133 |
| 472 | 3300048910 | Ga0496107_0062322 | Ga0496107_0062322_1523_1939 | 133 |
| 473 | 3300048911 | Ga0496108_0281963 | Ga0496108_0281963_121_537 | 133 |
| 474 | 3300048912 | Ga0496109_0011004 | Ga0496109_0011004_4709_5110 | 133 |
| 475 | 3300048912 | Ga0496109_0193793 | Ga0496109_0193793_794_1210 | 133 |
| 476 | 3300048913 | Ga0496110_0015013 | Ga0496110_0015013_3117_3533 | 133 |
| 477 | 3300048913 | Ga0496110_0018205 | Ga0496110_0018205_2547_3020 | 133 |
| 478 | 3300048913 | Ga0496110_0028849 | Ga0496110_0028849_990_1406 | 133 |
| 479 | 3300048913 | Ga0496110_0148060 | Ga0496110_0148060_486_902 | 133 |
| 480 | 3300048914 | Ga0496111_0034828 | Ga0496111_0034828_549_965 | 133 |
| 481 | 3300048914 | Ga0496111_0099630 | Ga0496111_0099630_746_1219 | 133 |
| 482 | 3300048914 | Ga0496111_0203458 | Ga0496111_0203458_226_642 | 133 |
| 483 | 3300048915 | Ga0496112_0121464 | Ga0496112_0121464_352_768 | 133 |
| 484 | 3300048916 | Ga0496113_0023899 | Ga0496113_0023899_2008_2424 | 133 |
| 485 | 3300048917 | Ga0496114_0002889 | Ga0496114_0002889_8967_9377 | 133 |
| 486 | 3300048917 | Ga0496114_0024267 | Ga0496114_0024267_1586_2002 | 133 |
| 487 | 3300048917 | Ga0496114_0201406 | Ga0496114_0201406_1317_1733 | 133 |
| 488 | 3300048918 | Ga0496115_0884118 | Ga0496115_0884118_251_667 | 133 |
| 489 | 3300048919 | Ga0496116_0311325 | Ga0496116_0311325_156_572 | 133 |
| 490 | 3300048920 | Ga0496117_0115140 | Ga0496117_0115140_883_1290 | 133 |
| 491 | 3300048923 | Ga0496120_0178497 | Ga0496120_0178497_560_976 | 133 |
| 492 | 3300048924 | Ga0496121_0061864 | Ga0496121_0061864_1190_1630 | 133 |
| 493 | 3300048924 | Ga0496121_0252019 | Ga0496121_0252019_760_1176 | 133 |
| 494 | 3300048924 | Ga0496121_0488119 | Ga0496121_0488119_243_659 | 133 |
| 495 | 3300048925 | Ga0496122_0000039 | Ga0496122_0000039_90109_90516 | 133 |
| 496 | 3300048926 | Ga0496123_0000026 | Ga0496123_0000026_90205_90612 | 133 |
| 497 | 3300048927 | Ga0496124_0022429 | Ga0496124_0022429_1660_2067 | 133 |
| 498 | 3300048927 | Ga0496124_0054539 | Ga0496124_0054539_1533_1973 | 133 |
| 499 | 3300048927 | Ga0496124_0096990 | Ga0496124_0096990_1314_1730 | 133 |
| 500 | 3300048928 | Ga0496125_0093140 | Ga0496125_0093140_641_1057 | 133 |
| 501 | 3300048929 | Ga0496126_0156083 | Ga0496126_0156083_471_878 | 133 |
| 502 | 3300049459 | Ga0495678_050078 | Ga0495678_050078_773_1180 | 133 |
| 503 | 3300049513 | Ga0501290_022825 | Ga0501290_022825_12_446 | 133 |
| 504 | 3300049541 | Ga0501325_007719 | Ga0501325_007719_266_700 | 133 |
| 505 | 3300049541 | Ga0501325_030772 | Ga0501325_030772_113_553 | 133 |
| 506 | 3300049541 | Ga0501325_037795 | Ga0501325_037795_127_552 | 133 |
| 507 | 3300049575 | Ga0501039_0229007 | Ga0501039_0229007_507_929 | 133 |
| 508 | 3300049578 | Ga0501042_0352530 | Ga0501042_0352530_425_832 | 133 |
| 509 | 3300049579 | Ga0501043_0059443 | Ga0501043_0059443_1147_1572 | 133 |
| 510 | 3300049580 | Ga0501046_0214074 | Ga0501046_0214074_36_440 | 133 |
| 511 | 3300049592 | Ga0501076_1073076 | Ga0501076_1073076_197_619 | 133 |
| 512 | 3300049661 | Ga0501217_174072 | Ga0501217_174072_24_464 | 133 |
| 513 | 3300049665 | Ga0501227_097186 | Ga0501227_097186_191_616 | 133 |
| 514 | 3300049742 | Ga0501080_0203314 | Ga0501080_0203314_259_681 | 133 |
| 515 | 3300049775 | Ga0501279_004178 | Ga0501279_004178_854_1294 | 133 |
| 516 | 3300050495 | nmdc:mga04h51_522754_c1 | nmdc:mga04h51_522754_c1_65_481 | 133 |
| 517 | 3300050507 | nmdc:mga05p37_999542_c1 | nmdc:mga05p37_999542_c1_98_505 | 133 |
| 518 | 3300050512 | nmdc:mga0n895_1074903_c1 | nmdc:mga0n895_1074903_c1_147_548 | 133 |
| 519 | 3300050515 | nmdc:mga0a205_125026_c1 | nmdc:mga0a205_125026_c1_1283_1684 | 133 |
| 520 | 3300053090 | Ga0500646_0155416 | Ga0500646_0155416_197_604 | 133 |
| 521 | 3300053118 | Ga0500594_0125053 | Ga0500594_0125053_369_776 | 133 |
| 522 | 3300053122 | Ga0500608_049475 | Ga0500608_049475_652_1059 | 133 |
| 523 | 3300053125 | Ga0500618_026607 | Ga0500618_026607_552_959 | 133 |
| 524 | 3300053136 | Ga0500559_0007488 | Ga0500559_0007488_3886_4293 | 133 |
| 525 | 3300053136 | Ga0500559_0197890 | Ga0500559_0197890_440_847 | 133 |
| 526 | 3300053140 | Ga0500573_0052103 | Ga0500573_0052103_1294_1701 | 133 |
| 527 | 3300053146 | Ga0500588_0014962 | Ga0500588_0014962_728_1135 | 133 |
| 528 | 3300053153 | Ga0500616_0001274 | Ga0500616_0001274_20313_20720 | 133 |
| 529 | 3300059423 | Ga0590074_023902 | Ga0590074_023902_574_978 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gym-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9688 | 1 | 132 |
| 4gym-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9606 | 1 | 133 |
| 4gym-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9547 | 1 | 132 |
| 4gym-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9536 | 1 | 133 |
| 4pav-assembly6.cif.gz_F | structure of hypothetical protein sa1046 from s. aureus. | 0.8753 | 1 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4gymA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9559 | 1 | 133 | 3.10.180.10 |
| 4gymA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9207 | 1 | 133 | 3.10.180.10 |
| 2kjzB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.882 | 73 | 128 | 3.30.720.110 |
| 4pavD00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8569 | 4 | 126 | 3.10.180.10 |
| 3bqxA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8562 | 1 | 126 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519HRW6-F1-model_v4 | Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein | 0.9972 | 1 | 127 |
GO:0051213
|
| AF-A0A517S8P3-F1-model_v4 | Glyoxalase-like domain protein | 0.9964 | 1 | 128 |
|
| AF-A0A495G2B3-F1-model_v4 | deleted | 0.9962 | 1 | 129 |
|
| AF-A0A858X9F5-F1-model_v4 | Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein | 0.9946 | 1 | 128 |
GO:0051213
|
| AF-A0A261RVU8-F1-model_v4 | Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein | 0.9929 | 1 | 129 |
GO:0051213
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar