F459827

General Info

Members Datasets Scaffolds Average Seq Length
529 317 510 138

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100130698|Ga0307408_1001306982
Length 160
Sequence VLTLRAAGATFGPMAKQIYVNLPVKDLKRSVDFFTALGFSFNPDYTDENATCMIINDDAFVMLLVEGFFKTFTSKSVADASGSTEAIMAYSVDSKEAVDDTVRKALAAGGTPSQEVQDYGFMYNHSFQDPDGHLWEVMWMDPAGPPAESTPAGDTETPAT

Samples

Sample ID Description Type Environment
1 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
2 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
3 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
4 2842694124 Methylopila sp. R-72369 Isolate Unclassified
5 2842733646 Variovorax sp. R-72446 Isolate Unclassified
6 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
7 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
8 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
9 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
10 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
11 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
12 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
13 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
14 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
15 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
16 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
17 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
18 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
154 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
155 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
178 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
179 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
186 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
187 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
188 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
189 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
190 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
193 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
194 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
195 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
196 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
197 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
198 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
199 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
200 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
201 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
204 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
208 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
209 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
275 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
290 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
303 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
304 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
305 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
308 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
311 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
312 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
314 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
315 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
316 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
317 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 0.76
Isolates 3.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.86
Nodule 0.38
Rhizoplane 7.94
Rhizosphere 79.58
Stem 0
Stem Tuber 0
Unclassified 6.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c014348 3300000041 Bacteria 684
2 ARcpr5yngRDRAFT_c013757 3300000043 Bacteria 679
3 LJQas_1000389 3300000549 Bacteria 7419
4 ARCol0yngRDRAFT_1005214 3300000652 Unclassified 934
5 JGI24737J22298_10226061 3300001990 Bacteria 552
6 rootH2_10203653 3300003320 Bacteria 2101
7 rootL2_10239904 3300003322 Bacteria 1669
8 rootH1_10135344 3300003323 Bacteria 4907
9 JGI25407J50210_10061538 3300003373 Archaea 943
10 Ga0006562J51391_1003923 3300003578 Bacteria 630
11 Ga0055530_10001845 3300003791 Bacteria 14564
12 Ga0055530_10004950 3300003791 Bacteria 6592
13 Ga0055540_1000013 3300003792 Bacteria 262274
14 Ga0055531_10009126 3300003794 Bacteria 5111
15 Ga0065714_10011280 3300005288 Bacteria 3103
16 Ga0065714_10114117 3300005288 Bacteria 1433
17 Ga0065714_10520806 3300005288 Bacteria 513
18 Ga0065704_10009070 3300005289 Archaea 2560
19 Ga0065704_10072326 3300005289 Bacteria 8737
20 Ga0065712_10269167 3300005290 Bacteria 919
21 Ga0065712_10367915 3300005290 Bacteria 767
22 Ga0065712_10432750 3300005290 Bacteria 701
23 Ga0065715_10059131 3300005293 Bacteria 790
24 Ga0065715_10490316 3300005293 Bacteria 789
25 Ga0070676_10287671 3300005328 Bacteria 1110
26 Ga0070676_10297269 3300005328 Bacteria 1093
27 Ga0070683_100048048 3300005329 Bacteria 3945
28 Ga0070690_100198762 3300005330 Bacteria 1394
29 Ga0070670_100025407 3300005331 Bacteria 5096
30 Ga0070670_100924713 3300005331 Bacteria 791
31 Ga0070670_101180167 3300005331 Bacteria 699
32 Ga0070677_10131296 3300005333 Bacteria 1144
33 Ga0070666_10065650 3300005335 Bacteria 2462
34 Ga0070660_100224564 3300005339 Bacteria 1527
35 Ga0070689_100012167 3300005340 Bacteria 6189
36 Ga0070689_100092805 3300005340 Bacteria 2382
37 Ga0070689_100136231 3300005340 Bacteria 1972
38 Ga0070691_10674487 3300005341 Bacteria 618
39 Ga0070687_100242109 3300005343 Bacteria 1116
40 Ga0070661_100067995 3300005344 Bacteria 2619
41 Ga0070668_100272624 3300005347 Bacteria 1411
42 Ga0070668_100398362 3300005347 Unclassified 1175
43 Ga0070669_100005196 3300005353 Bacteria 9419
44 Ga0070669_100006090 3300005353 Bacteria 8703
45 Ga0070669_101069571 3300005353 Bacteria 694
46 Ga0070675_100328286 3300005354 Bacteria 1352
47 Ga0070671_100060533 3300005355 Bacteria 3152
48 Ga0070671_100360839 3300005355 Bacteria 1241
49 Ga0070674_101106302 3300005356 Bacteria 700
50 Ga0070673_100069776 3300005364 Bacteria 2818
51 Ga0070673_100261125 3300005364 Bacteria 1513
52 Ga0070659_101335504 3300005366 Bacteria 636
53 Ga0070667_100417672 3300005367 Bacteria 1222
54 Ga0070710_10022516 3300005437 Archaea 3296
55 Ga0070701_10041098 3300005438 Bacteria 2354
56 Ga0070711_100433079 3300005439 Archaea 1074
57 Ga0070711_100864923 3300005439 Bacteria 770
58 Ga0070711_101648486 3300005439 Bacteria 561
59 Ga0070700_100498985 3300005441 Bacteria 936
60 Ga0070694_100012128 3300005444 Bacteria 5352
61 Ga0070694_100167386 3300005444 Bacteria 1617
62 Ga0070678_100211676 3300005456 Bacteria 1606
63 Ga0070662_100688790 3300005457 Bacteria 864
64 Ga0070685_10318830 3300005466 Bacteria 1053
65 Ga0070706_100256364 3300005467 Bacteria 1633
66 Ga0070698_100125614 3300005471 Bacteria 2523
67 Ga0070698_100312863 3300005471 Unclassified 1501
68 Ga0070699_100022700 3300005518 Bacteria 5408
69 Ga0070699_101360583 3300005518 Bacteria 651
70 Ga0070684_102340227 3300005535 Bacteria 504
71 Ga0070697_100613372 3300005536 Bacteria 957
72 Ga0070672_100695519 3300005543 Bacteria 890
73 Ga0070686_100008218 3300005544 Bacteria 5841
74 Ga0070686_100094785 3300005544 Bacteria 2004
75 Ga0070686_101052246 3300005544 Unclassified 670
76 Ga0070695_100040840 3300005545 Bacteria 2939
77 Ga0070695_100191430 3300005545 Bacteria 1456
78 Ga0070695_100438659 3300005545 Bacteria 998
79 Ga0070665_100057510 3300005548 Bacteria 3898
80 Ga0070704_100225021 3300005549 Bacteria 1527
81 Ga0068857_100727712 3300005577 Bacteria 944
82 Ga0068854_101815052 3300005578 Unclassified 559
83 Ga0070702_100011357 3300005615 Bacteria 4428
84 Ga0068852_100295998 3300005616 Bacteria 1565
85 Ga0068859_100207311 3300005617 Bacteria 2046
86 Ga0068864_100043617 3300005618 Bacteria 3840
87 Ga0068866_10315846 3300005718 Bacteria 981
88 Ga0068861_100015198 3300005719 Bacteria 5418
89 Ga0068861_100070619 3300005719 Bacteria 2705
90 Ga0068863_101328711 3300005841 Bacteria 726
91 Ga0068863_101366606 3300005841 Bacteria 716
92 Ga0068860_100043352 3300005843 Bacteria 4292
93 Ga0081538_10010987 3300005981 Archaea 7371
94 Ga0075365_10021856 3300006038 Bacteria 3997
95 Ga0075364_10744026 3300006051 Bacteria 669
96 Ga0075432_10008524 3300006058 Bacteria 3497
97 Ga0075432_10008617 3300006058 Bacteria 3481
98 Ga0075367_10064648 3300006178 Bacteria 2189
99 Ga0075430_100896345 3300006846 Bacteria 731
100 Ga0075431_101515467 3300006847 Bacteria 629
101 Ga0075434_100110936 3300006871 Unclassified 2753
102 Ga0068865_100088405 3300006881 Bacteria 2242
103 Ga0097620_100207310 3300006931 Bacteria 2046
104 Ga0079104_1000001 3300006946 Bacteria 521847
105 Ga0105251_10174457 3300009011 Bacteria 969
106 Ga0111539_10132140 3300009094 Bacteria 2923
107 Ga0111539_11008936 3300009094 Bacteria 968
108 Ga0114129_10790682 3300009147 Bacteria 1211
109 Ga0114129_10867695 3300009147 Bacteria 1146
110 Ga0105243_10052356 3300009148 Bacteria 3233
111 Ga0105243_10058878 3300009148 Bacteria 3063
112 Ga0105242_10245871 3300009176 Bacteria 1610
113 Ga0105242_10460144 3300009176 Unclassified 1201
114 Ga0105248_12418326 3300009177 Bacteria 598
115 Ga0105249_10434926 3300009553 Unclassified 1348
116 Ga0105239_10575650 3300010375 Bacteria 1283
117 Ga0105246_10033162 3300011119 Bacteria 3430
118 Ga0105246_10135191 3300011119 Bacteria 1847
119 Ga0157338_1003700 3300012515 Unclassified 1283
120 Ga0157373_10023577 3300013100 Bacteria 4460
121 Ga0157371_10773117 3300013102 Bacteria 722
122 Ga0157374_10296706 3300013296 Bacteria 1598
123 Ga0157374_11461872 3300013296 Bacteria 707
124 Ga0157378_10023083 3300013297 Bacteria 5475
125 Ga0157378_10125763 3300013297 Bacteria 2368
126 Ga0157378_11069767 3300013297 Bacteria 843
127 Ga0163162_10472428 3300013306 Bacteria 1385
128 Ga0163162_10694013 3300013306 Bacteria 1140
129 Ga0163162_11069588 3300013306 Bacteria 913
130 Ga0157375_10820212 3300013308 Bacteria 1078
131 Ga0157375_11991146 3300013308 Bacteria 690
132 Ga0157380_10088284 3300014326 Bacteria 2551
133 Ga0157380_11445980 3300014326 Bacteria 739
134 Ga0182008_10008258 3300014497 Bacteria 5691
135 Ga0157379_10997227 3300014968 Bacteria 798
136 Ga0163161_10071251 3300017792 Bacteria 2543
137 Ga0209147_100110 3300025229 Bacteria 146408
138 Ga0209565_1026697 3300025263 Bacteria 1155
139 Ga0209675_1017986 3300025291 Bacteria 1993
140 Ga0209676_1000149 3300025292 Bacteria 167854
141 Ga0209050_1000567 3300025298 Bacteria 60093
142 Ga0209050_1007645 3300025298 Bacteria 5989
143 Ga0209256_1000015 3300025299 Bacteria 622953
144 Ga0209051_1000022 3300025303 Bacteria 474879
145 Ga0209257_1000030 3300025304 Bacteria 689812
146 Ga0207697_10158332 3300025315 Bacteria 987
147 Ga0207655_1026217 3300025728 Bacteria 2804
148 Ga0207713_1072135 3300025735 Bacteria 1272
149 Ga0207682_10185591 3300025893 Bacteria 951
150 Ga0207642_10194372 3300025899 Bacteria 1116
151 Ga0207680_10068037 3300025903 Bacteria 2196
152 Ga0207680_10527061 3300025903 Bacteria 842
153 Ga0207645_10007732 3300025907 Bacteria 7568
154 Ga0207684_11318542 3300025910 Bacteria 594
155 Ga0207662_10112560 3300025918 Bacteria 1699
156 Ga0207681_10030754 3300025923 Bacteria 3502
157 Ga0207681_10299895 3300025923 Bacteria 1271
158 Ga0207650_10008767 3300025925 Bacteria 6911
159 Ga0207650_10009822 3300025925 Bacteria 6545
160 Ga0207650_11103314 3300025925 Bacteria 675
161 Ga0207650_11204142 3300025925 Bacteria 645
162 Ga0207659_10073417 3300025926 Bacteria 2504
163 Ga0207700_11280863 3300025928 Archaea 653
164 Ga0207644_10038478 3300025931 Bacteria 3370
165 Ga0207644_10096399 3300025931 Bacteria 2214
166 Ga0207706_10044670 3300025933 Bacteria 3927
167 Ga0207686_10698356 3300025934 Bacteria 806
168 Ga0207670_10071419 3300025936 Bacteria 2401
169 Ga0207670_10940604 3300025936 Bacteria 725
170 Ga0207669_10305642 3300025937 Bacteria 1211
171 Ga0207691_10000972 3300025940 Bacteria 28495
172 Ga0207679_11610712 3300025945 Bacteria 595
173 Ga0207651_10206577 3300025960 Bacteria 1578
174 Ga0207712_10494440 3300025961 Unclassified 1045
175 Ga0207668_10028901 3300025972 Bacteria 3630
176 Ga0207668_11216732 3300025972 Bacteria 677
177 Ga0207677_10354147 3300026023 Bacteria 1231
178 Ga0207677_11499442 3300026023 Bacteria 623
179 Ga0207708_10023115 3300026075 Bacteria 4697
180 Ga0207708_10355132 3300026075 Bacteria 1203
181 Ga0207641_10764567 3300026088 Bacteria 954
182 Ga0207648_10342281 3300026089 Bacteria 1347
183 Ga0207676_10158827 3300026095 Bacteria 1956
184 Ga0207676_10256368 3300026095 Bacteria 1577
185 Ga0207675_100002498 3300026118 Bacteria 18195
186 Ga0207675_100091494 3300026118 Bacteria 2860
187 Ga0207683_10005968 3300026121 Bacteria 10434
188 Ga0207683_10571545 3300026121 Bacteria 1046
189 Ga0207683_10579794 3300026121 Bacteria 1038
190 Ga0209281_1000057 3300027111 Bacteria 307145
191 Ga0207428_10007887 3300027907 Bacteria 9677
192 Ga0268266_10225119 3300028379 Bacteria 1725
193 Ga0268266_10404985 3300028379 Bacteria 1290
194 Ga0268265_11560089 3300028380 Bacteria 665
195 Ga0307515_10534557 3300028794 Bacteria 782
196 Ga0316177_1002752 3300030731 Bacteria 2024
197 Ga0314311_1152501 3300030733 Bacteria 1288
198 Ga0316181_1148685 3300030744 Bacteria 726
199 Ga0307513_10062477 3300031456 Bacteria 3936
200 Ga0307513_10448919 3300031456 Unclassified 1014
201 Ga0307408_100005441 3300031548 Bacteria 8524
202 Ga0307408_100051596 3300031548 Bacteria 2963
203 Ga0307408_100104586 3300031548 Bacteria 2163
204 Ga0307408_100130698 3300031548 Bacteria 1958
205 Ga0307408_100134221 3300031548 Bacteria 1934
206 Ga0307408_100157485 3300031548 Bacteria 1800
207 Ga0307408_100273745 3300031548 Bacteria 1403
208 Ga0307408_100296870 3300031548 Bacteria 1352
209 Ga0307408_100468637 3300031548 Bacteria 1096
210 Ga0307408_100560914 3300031548 Bacteria 1009
211 Ga0307405_10007056 3300031731 Bacteria 5585
212 Ga0307405_10007826 3300031731 Bacteria 5379
213 Ga0307405_10035631 3300031731 Bacteria 2974
214 Ga0307405_10039154 3300031731 Bacteria 2863
215 Ga0307405_10043458 3300031731 Bacteria 2742
216 Ga0307405_10073778 3300031731 Bacteria 2204
217 Ga0307405_10074644 3300031731 Bacteria 2193
218 Ga0307405_10096829 3300031731 Bacteria 1968
219 Ga0307405_10118491 3300031731 Bacteria 1807
220 Ga0307405_10322901 3300031731 Bacteria 1180
221 Ga0307405_10473298 3300031731 Bacteria 998
222 Ga0307405_10538052 3300031731 Bacteria 943
223 Ga0307413_10001948 3300031824 Bacteria 8201
224 Ga0307413_10014659 3300031824 Bacteria 3990
225 Ga0307413_10031868 3300031824 Bacteria 2980
226 Ga0307413_10145041 3300031824 Bacteria 1646
227 Ga0307413_10148139 3300031824 Bacteria 1632
228 Ga0307413_10415420 3300031824 Bacteria 1058
229 Ga0307413_11209034 3300031824 Bacteria 657
230 Ga0307410_10053081 3300031852 Bacteria 2741
231 Ga0307410_10055460 3300031852 Bacteria 2690
232 Ga0307410_10058629 3300031852 Bacteria 2625
233 Ga0307410_10074805 3300031852 Bacteria 2360
234 Ga0307410_10143285 3300031852 Bacteria 1770
235 Ga0307410_10154155 3300031852 Bacteria 1714
236 Ga0307410_10326005 3300031852 Bacteria 1220
237 Ga0307410_10350443 3300031852 Bacteria 1179
238 Ga0307410_10970122 3300031852 Bacteria 731
239 Ga0307410_11020515 3300031852 Bacteria 714
240 Ga0307406_10048427 3300031901 Bacteria 2684
241 Ga0307406_10078742 3300031901 Bacteria 2184
242 Ga0307406_10277682 3300031901 Bacteria 1276
243 Ga0307406_10342908 3300031901 Bacteria 1164
244 Ga0307406_10543856 3300031901 Bacteria 949
245 Ga0307406_10681713 3300031901 Bacteria 856
246 Ga0307406_11147593 3300031901 Bacteria 673
247 Ga0307406_11732169 3300031901 Bacteria 554
248 Ga0307407_10015990 3300031903 Bacteria 3726
249 Ga0307407_10026176 3300031903 Bacteria 3086
250 Ga0307407_10082787 3300031903 Bacteria 1946
251 Ga0307407_10160248 3300031903 Bacteria 1472
252 Ga0307407_10388252 3300031903 Bacteria 998
253 Ga0307412_10003040 3300031911 Bacteria 9291
254 Ga0307412_10028360 3300031911 Bacteria 3501
255 Ga0307412_10043108 3300031911 Bacteria 2936
256 Ga0307412_10140376 3300031911 Bacteria 1768
257 Ga0307412_10151304 3300031911 Bacteria 1712
258 Ga0307412_10496113 3300031911 Bacteria 1015
259 Ga0307412_11045383 3300031911 Bacteria 724
260 Ga0307409_100018657 3300031995 Bacteria 4672
261 Ga0307409_100075115 3300031995 Bacteria 2704
262 Ga0307409_100112570 3300031995 Bacteria 2285
263 Ga0307409_100442578 3300031995 Bacteria 1252
264 Ga0307409_100484245 3300031995 Bacteria 1201
265 Ga0307409_101087662 3300031995 Bacteria 820
266 Ga0307409_101463084 3300031995 Bacteria 710
267 Ga0307416_100050474 3300032002 Bacteria 3316
268 Ga0307416_100065713 3300032002 Bacteria 2982
269 Ga0307416_100071746 3300032002 Bacteria 2878
270 Ga0307416_100130013 3300032002 Bacteria 2264
271 Ga0307416_100205145 3300032002 Bacteria 1874
272 Ga0307416_100434199 3300032002 Bacteria 1361
273 Ga0307416_100519627 3300032002 Bacteria 1258
274 Ga0307416_100645295 3300032002 Bacteria 1143
275 Ga0307416_101329575 3300032002 Bacteria 824
276 Ga0307416_102431271 3300032002 Bacteria 623
277 Ga0307414_10113227 3300032004 Bacteria 2070
278 Ga0307414_10127416 3300032004 Bacteria 1970
279 Ga0307414_10443380 3300032004 Bacteria 1137
280 Ga0307414_11644519 3300032004 Bacteria 599
281 Ga0307411_10046051 3300032005 Bacteria 2809
282 Ga0307411_10057518 3300032005 Bacteria 2569
283 Ga0307411_10116931 3300032005 Bacteria 1920
284 Ga0307411_10906166 3300032005 Bacteria 784
285 Ga0307415_100032569 3300032126 Bacteria 3372
286 Ga0307415_100055942 3300032126 Bacteria 2702
287 Ga0307415_100081580 3300032126 Bacteria 2311
288 Ga0307415_100092139 3300032126 Bacteria 2197
289 Ga0307415_100960594 3300032126 Bacteria 792
290 Ga0307415_101758513 3300032126 Bacteria 599
291 Ga0373927_0444366 3300035695 Bacteria 856
292 Ga0373947_0506516 3300035725 Bacteria 820
293 Ga0373937_1651333 3300036401 Bacteria 588
294 Ga0395899_0019700 3300037312 Bacteria 5122
295 Ga0395900_0128016 3300037418 Bacteria 2603
296 Ga0395898_0180164 3300037466 Bacteria 2019
297 Ga0395905_0163204 3300037471 Bacteria 2094
298 Ga0395901_0048797 3300038443 Bacteria 4397
299 Ga0439436_0000563 3300041404 Bacteria 9783
300 Ga0439436_0031567 3300041404 Bacteria 1537
301 Ga0439436_0046522 3300041404 Bacteria 1233
302 Ga0439438_008981 3300041405 Bacteria 3267
303 Ga0439438_031500 3300041405 Bacteria 1409
304 Ga0439438_033782 3300041405 Bacteria 1350
305 Ga0439439_0040457 3300041406 Bacteria 1207
306 Ga0439461_0003944 3300041410 Bacteria 2461
307 Ga0439466_0001999 3300041411 Bacteria 7995
308 Ga0439466_0007916 3300041411 Bacteria 4008
309 Ga0439466_0027672 3300041411 Bacteria 1963
310 Ga0439465_0000895 3300041413 Bacteria 9433
311 Ga0451802_1673852 3300041460 Bacteria 542
312 Ga0451853_3854387 3300041512 Bacteria 1128
313 Ga0451853_4055978 3300041512 Bacteria 1190
314 Ga0439433_0000495 3300041999 Bacteria 7322
315 Ga0439433_0001654 3300041999 Bacteria 4642
316 Ga0439433_0030795 3300041999 Bacteria 1227
317 Ga0439433_0109346 3300041999 Bacteria 691
318 Ga0439437_001879 3300042000 Archaea 2230
319 Ga0439442_000101 3300042002 Bacteria 20964
320 Ga0439442_000116 3300042002 Bacteria 19928
321 Ga0439442_005175 3300042002 Bacteria 2613
322 Ga0439442_025517 3300042002 Bacteria 1229
323 Ga0439443_000642 3300042003 Archaea 3315
324 Ga0439432_004027 3300042006 Bacteria 5390
325 Ga0439432_057062 3300042006 Bacteria 1209
326 Ga0439449_0000200 3300042007 Bacteria 20897
327 Ga0439449_0002805 3300042007 Bacteria 6772
328 Ga0439449_0024067 3300042007 Bacteria 2277
329 Ga0439449_0042567 3300042007 Bacteria 1687
330 Ga0439449_0043128 3300042007 Bacteria 1675
331 Ga0439449_0149697 3300042007 Bacteria 870
332 Ga0439450_000531 3300042008 Unclassified 4988
333 Ga0439451_000969 3300042009 Archaea 5547
334 Ga0439452_003540 3300042010 Bacteria 5447
335 Ga0439454_001086 3300042011 Archaea 2485
336 Ga0439457_001987 3300042014 Bacteria 6011
337 Ga0439457_022928 3300042014 Bacteria 1382
338 Ga0439462_0021538 3300042015 Bacteria 1684
339 Ga0439462_0053094 3300042015 Bacteria 1091
340 Ga0439462_0079721 3300042015 Bacteria 894
341 Ga0439463_005520 3300042016 Archaea 3142
342 Ga0450912_001660 3300042116 Archaea 1398
343 Ga0450920_004719 3300042122 Bacteria 2406
344 Ga0450920_018084 3300042122 Bacteria 1348
345 Ga0450920_020171 3300042122 Bacteria 1283
346 Ga0450920_036891 3300042122 Bacteria 970
347 Ga0450898_021182 3300042134 Bacteria 1144
348 Ga0450907_000182 3300042146 Bacteria 23177
349 Ga0439434_0000036 3300042435 Bacteria 32511
350 Ga0439434_0013637 3300042435 Bacteria 2413
351 Ga0439435_0000713 3300042436 Archaea 5546
352 Ga0439459_0042063 3300042438 Bacteria 975
353 Ga0439464_0072439 3300042439 Bacteria 1021
354 Ga0439460_0101580 3300042461 Bacteria 924
355 Ga0450918_004775 3300042531 Bacteria 2456
356 Ga0450893_0005733 3300042532 Archaea 2000
357 Ga0439440_0117781 3300042993 Bacteria 736
358 Ga0466972_0000094 3300044658 Bacteria 78156
359 Ga0466960_0206082 3300044901 Bacteria 1076
360 Ga0495629_0212244 3300046459 Bacteria 1337
361 Ga0495629_0567644 3300046459 Bacteria 761
362 Ga0495580_0146549 3300046472 Bacteria 1636
363 Ga0495605_0456561 3300046474 Bacteria 526
364 Ga0495639_0002911 3300046475 Bacteria 7460
365 Ga0495662_0014331 3300046476 Bacteria 3857
366 Ga0495664_0084495 3300046477 Bacteria 1905
367 Ga0495594_0083847 3300046499 Bacteria 1782
368 Ga0495583_0207866 3300046506 Bacteria 794
369 Ga0495630_0155096 3300046517 Bacteria 1743
370 Ga0495631_0017869 3300046518 Bacteria 3347
371 Ga0495643_0022892 3300046522 Bacteria 3558
372 Ga0495642_0026870 3300046528 Bacteria 2288
373 Ga0495654_0286497 3300046530 Bacteria 676
374 Ga0495665_0017382 3300046531 Bacteria 3868
375 Ga0495586_0029284 3300046535 Bacteria 2946
376 Ga0495586_0064664 3300046535 Bacteria 1993
377 Ga0495587_0016852 3300046536 Bacteria 4544
378 Ga0495645_0002905 3300046543 Bacteria 11629
379 Ga0495633_0054893 3300046558 Bacteria 1873
380 Ga0495667_0007751 3300046559 Bacteria 7274
381 Ga0495656_0000682 3300046615 Bacteria 10935
382 Ga0495656_0096819 3300046615 Bacteria 1359
383 Ga0495668_0144886 3300046616 Bacteria 1300
384 Ga0495625_0025741 3300046660 Bacteria 4457
385 Ga0495659_0083376 3300046664 Bacteria 1217
386 Ga0495661_0012401 3300046665 Bacteria 5754
387 Ga0495661_0109154 3300046665 Bacteria 1545
388 Ga0495588_0004816 3300046674 Bacteria 5974
389 Ga0495588_0016464 3300046674 Bacteria 3573
390 Ga0495588_0017021 3300046674 Bacteria 3522
391 Ga0495588_0044889 3300046674 Bacteria 2264
392 Ga0495588_0664578 3300046674 Bacteria 545
393 Ga0495657_0016880 3300046675 Bacteria 5308
394 Ga0495623_0478156 3300046679 Bacteria 660
395 Ga0495669_0308626 3300046684 Bacteria 763
396 Ga0495670_0002876 3300046691 Bacteria 8495
397 Ga0495670_0149270 3300046691 Bacteria 1225
398 Ga0495670_0474549 3300046691 Bacteria 678
399 Ga0495600_0025629 3300046809 Bacteria 3800
400 Ga0495600_0176366 3300046809 Bacteria 1378
401 Ga0495581_0011671 3300047315 Bacteria 5084
402 Ga0495581_0040156 3300047315 Bacteria 2708
403 Ga0495581_0042820 3300047315 Bacteria 2620
404 Ga0495581_0336961 3300047315 Bacteria 880
405 Ga0495636_0006321 3300047318 Bacteria 4653
406 Ga0495636_0214893 3300047318 Bacteria 881
407 Ga0495674_1151035 3300047319 Bacteria 588
408 Ga0495680_0029620 3300047322 Bacteria 4481
409 Ga0495680_0043309 3300047322 Bacteria 3566
410 Ga0495675_0008270 3300047444 Bacteria 6438
411 Ga0495593_0118406 3300047673 Bacteria 1349
412 Ga0496100_0107256 3300048903 Bacteria 1935
413 Ga0496100_0135285 3300048903 Bacteria 1740
414 Ga0496100_0245545 3300048903 Bacteria 1322
415 Ga0496101_0011864 3300048904 Bacteria 5800
416 Ga0496101_0072106 3300048904 Bacteria 2534
417 Ga0496101_0379824 3300048904 Bacteria 1111
418 Ga0496102_0093191 3300048905 Bacteria 2790
419 Ga0496102_0237272 3300048905 Bacteria 1719
420 Ga0496102_0281827 3300048905 Bacteria 1566
421 Ga0496102_0507159 3300048905 Bacteria 1128
422 Ga0496103_0047437 3300048906 Bacteria 2654
423 Ga0496104_0295449 3300048907 Bacteria 1532
424 Ga0496105_0271082 3300048908 Bacteria 1370
425 Ga0496105_1040340 3300048908 Bacteria 610
426 Ga0496106_0114785 3300048909 Bacteria 2100
427 Ga0496106_0519089 3300048909 Bacteria 956
428 Ga0496107_0052727 3300048910 Bacteria 2933
429 Ga0496107_0062322 3300048910 Bacteria 2701
430 Ga0496108_0212465 3300048911 Bacteria 1680
431 Ga0496108_0281963 3300048911 Bacteria 1446
432 Ga0496108_0628370 3300048911 Bacteria 934
433 Ga0496108_0818331 3300048911 Bacteria 803
434 Ga0496109_0011004 3300048912 Bacteria 7754
435 Ga0496109_0065184 3300048912 Bacteria 3335
436 Ga0496109_0193793 3300048912 Bacteria 1909
437 Ga0496110_0015013 3300048913 Bacteria 6441
438 Ga0496110_0018205 3300048913 Bacteria 5886
439 Ga0496110_0028849 3300048913 Bacteria 4769
440 Ga0496110_0148060 3300048913 Bacteria 2124
441 Ga0496110_0521758 3300048913 Bacteria 1081
442 Ga0496111_0034828 3300048914 Bacteria 3596
443 Ga0496111_0099630 3300048914 Bacteria 2134
444 Ga0496111_0203458 3300048914 Bacteria 1471
445 Ga0496112_0121464 3300048915 Bacteria 2582
446 Ga0496112_1458854 3300048915 Bacteria 598
447 Ga0496113_0023899 3300048916 Bacteria 4338
448 Ga0496114_0002889 3300048917 Bacteria 13165
449 Ga0496114_0024267 3300048917 Bacteria 4948
450 Ga0496114_0173090 3300048917 Bacteria 1882
451 Ga0496114_0201406 3300048917 Bacteria 1743
452 Ga0496115_0884118 3300048918 Bacteria 690
453 Ga0496116_0311325 3300048919 Bacteria 743
454 Ga0496117_0115140 3300048920 Bacteria 1665
455 Ga0496120_0178497 3300048923 Bacteria 1045
456 Ga0496121_0061864 3300048924 Bacteria 3069
457 Ga0496121_0252019 3300048924 Bacteria 1224
458 Ga0496121_0488119 3300048924 Unclassified 785
459 Ga0496122_0000039 3300048925 Bacteria 295352
460 Ga0496123_0000026 3300048926 Bacteria 318040
461 Ga0496124_0022429 3300048927 Bacteria 5787
462 Ga0496124_0054539 3300048927 Bacteria 3383
463 Ga0496124_0096990 3300048927 Bacteria 2394
464 Ga0496125_0093140 3300048928 Bacteria 2250
465 Ga0496126_0156083 3300048929 Bacteria 1953
466 Ga0495678_050078 3300049459 Bacteria 1621
467 Ga0501290_022825 3300049513 Bacteria 865
468 Ga0501325_007719 3300049541 Bacteria 917
469 Ga0501325_030772 3300049541 Bacteria 614
470 Ga0501325_037795 3300049541 Bacteria 577
471 Ga0501033_0276311 3300049570 Bacteria 1187
472 Ga0501034_0000581 3300049571 Bacteria 57797
473 Ga0501038_0030004 3300049574 Bacteria 4814
474 Ga0501039_0229007 3300049575 Bacteria 1461
475 Ga0501042_0352530 3300049578 Unclassified 1065
476 Ga0501043_0059443 3300049579 Bacteria 3000
477 Ga0501046_0214074 3300049580 Bacteria 1429
478 Ga0501068_0014073 3300049584 Bacteria 4567
479 Ga0501069_0645690 3300049585 Bacteria 637
480 Ga0501070_0822101 3300049586 Bacteria 728
481 Ga0501072_0011605 3300049588 Bacteria 6731
482 Ga0501073_0094930 3300049589 Bacteria 2071
483 Ga0501076_1073076 3300049592 Bacteria 663
484 Ga0501217_174072 3300049661 Bacteria 657
485 Ga0501227_097186 3300049665 Bacteria 781
486 Ga0501080_0203314 3300049742 Bacteria 1818
487 Ga0501083_0168285 3300049744 Bacteria 1433
488 Ga0501279_004178 3300049775 Bacteria 1894
489 nmdc:mga00v17_220350_c1 3300050491 Bacteria 1228
490 nmdc:mga00v17_321618_c1 3300050491 Unclassified 1005
491 nmdc:mga06z11_268635_c1 3300050494 Bacteria 1008
492 nmdc:mga04h51_522754_c1 3300050495 Bacteria 509
493 nmdc:mga05p37_999542_c1 3300050507 Bacteria 889
494 nmdc:mga09592_1259289_c1 3300050508 Bacteria 609
495 nmdc:mga0qj67_327406_c1 3300050509 Bacteria 1240
496 nmdc:mga0qj67_891840_c1 3300050509 Bacteria 701
497 nmdc:mga0n895_1074903_c1 3300050512 Bacteria 783
498 nmdc:mga0a205_125026_c1 3300050515 Unclassified 2471
499 Ga0500646_0155416 3300053090 Bacteria 760
500 Ga0500594_0125053 3300053118 Bacteria 810
501 Ga0500608_049475 3300053122 Bacteria 2021
502 Ga0500618_026607 3300053125 Bacteria 1381
503 Ga0500559_0007488 3300053136 Bacteria 4831
504 Ga0500559_0197890 3300053136 Bacteria 947
505 Ga0500573_0052103 3300053140 Bacteria 2353
506 Ga0500588_0014962 3300053146 Bacteria 1977
507 Ga0500616_0001274 3300053153 Bacteria 25179
508 Ga0500611_002300 3300053727 Bacteria 2263
509 Ga0500645_100124 3300053730 Bacteria 818
510 Ga0590074_023902 3300059423 Unclassified 1061

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_101180167 Ga0070670_1011801672 120
2 3300025925 Ga0207650_11204142 Ga0207650_112041421 120
3 3300048909 Ga0496106_0114785 Ga0496106_0114785_916_1341 120
4 3300048911 Ga0496108_0818331 Ga0496108_0818331_358_783 120
5 3300048912 Ga0496109_0065184 Ga0496109_0065184_2496_2921 120
6 3300048913 Ga0496110_0521758 Ga0496110_0521758_124_549 120
7 3300048915 Ga0496112_1458854 Ga0496112_1458854_89_514 120
8 3300048906 Ga0496103_0047437 Ga0496103_0047437_102_527 121
9 3300028379 Ga0268266_10404985 Ga0268266_104049851 125
10 3300005288 Ga0065714_10011280 Ga0065714_100112802 127
11 3300005290 Ga0065712_10367915 Ga0065712_103679151 127
12 3300005328 Ga0070676_10287671 Ga0070676_102876712 127
13 3300005331 Ga0070670_100025407 Ga0070670_1000254073 127
14 3300005333 Ga0070677_10131296 Ga0070677_101312962 127
15 3300005347 Ga0070668_100272624 Ga0070668_1002726242 127
16 3300005353 Ga0070669_100006090 Ga0070669_1000060902 127
17 3300005355 Ga0070671_100060533 Ga0070671_1000605332 127
18 3300005367 Ga0070667_100417672 Ga0070667_1004176722 127
19 3300005456 Ga0070678_100211676 Ga0070678_1002116762 127
20 3300014968 Ga0157379_10997227 Ga0157379_109972271 127
21 3300025735 Ga0207713_1072135 Ga0207713_10721352 127
22 3300025903 Ga0207680_10068037 Ga0207680_100680372 127
23 3300025923 Ga0207681_10299895 Ga0207681_102998952 127
24 3300025931 Ga0207644_10038478 Ga0207644_100384782 127
25 3300025960 Ga0207651_10206577 Ga0207651_102065772 127
26 3300025972 Ga0207668_10028901 Ga0207668_100289012 127
27 3300037418 Ga0395900_0128016 Ga0395900_0128016_1304_1714 127
28 3300037466 Ga0395898_0180164 Ga0395898_0180164_537_947 127
29 3300042000 Ga0439437_001879 Ga0439437_001879_1439_1873 127
30 3300048905 Ga0496102_0507159 Ga0496102_0507159_713_1111 127
31 3300048907 Ga0496104_0295449 Ga0496104_0295449_18_416 127
32 3300048908 Ga0496105_0271082 Ga0496105_0271082_958_1356 127
33 3300048908 Ga0496105_1040340 Ga0496105_1040340_15_413 127
34 3300048909 Ga0496106_0519089 Ga0496106_0519089_15_413 127
35 3300048911 Ga0496108_0212465 Ga0496108_0212465_18_416 127
36 3300048911 Ga0496108_0628370 Ga0496108_0628370_18_416 127
37 3300049574 Ga0501038_0030004 Ga0501038_0030004_379_786 127
38 iso_pu_bacteria 2842694124 2842695714 128
39 iso_pu_bacteria 2863067949 2863072328 128
40 iso_pu_bacteria 8008485437 8008490014 128
41 iso_pu_bacteria 8025524527 8025529253 128
42 3300005544 Ga0070686_101052246 Ga0070686_1010522461 129
43 3300053730 Ga0500645_100124 Ga0500645_100124_153_551 129
44 iso_pu_bacteria 2690315906 2691513592 129
45 iso_pu_bacteria 2808606370 2808890778 129
46 iso_pu_bacteria 2842733646 2842737110 129
47 iso_pu_bacteria 2896085136 2896089845 129
48 iso_pu_bacteria 2919391150 2919393330 129
49 iso_pu_bacteria 2939598168 2939600157 129
50 iso_pu_bacteria 2945920336 2945920419 129
51 iso_pu_bacteria 2945941187 2945943641 129
52 iso_pu_bacteria 2945956166 2945958176 129
53 iso_pu_bacteria 2946037020 2946039615 129
54 iso_pu_bacteria 2953998280 2954000840 129
55 iso_pu_bacteria 8007375930 8007378760 129
56 iso_pu_bacteria 8054107350 8054111873 129
57 3300005536 Ga0070697_100613372 Ga0070697_1006133721 130
58 3300009147 Ga0114129_10867695 Ga0114129_108676952 130
59 3300013306 Ga0163162_10694013 Ga0163162_106940131 130
60 3300025292 Ga0209676_1000149 Ga0209676_1000149144 130
61 3300006051 Ga0075364_10744026 Ga0075364_107440262 131
62 3300006178 Ga0075367_10064648 Ga0075367_100646483 131
63 3300028794 Ga0307515_10534557 Ga0307515_105345572 131
64 3300049570 Ga0501033_0276311 Ga0501033_0276311_530_937 131
65 3300050494 nmdc:mga06z11_268635_c1 nmdc:mga06z11_268635_c1_398_802 131
66 3300001990 JGI24737J22298_10226061 JGI24737J22298_102260611 132
67 3300005290 Ga0065712_10432750 Ga0065712_104327502 132
68 3300005293 Ga0065715_10490316 Ga0065715_104903161 132
69 3300005329 Ga0070683_100048048 Ga0070683_1000480485 132
70 3300005330 Ga0070690_100198762 Ga0070690_1001987622 132
71 3300005340 Ga0070689_100012167 Ga0070689_1000121675 132
72 3300005340 Ga0070689_100092805 Ga0070689_1000928052 132
73 3300005340 Ga0070689_100136231 Ga0070689_1001362312 132
74 3300005341 Ga0070691_10674487 Ga0070691_106744871 132
75 3300005343 Ga0070687_100242109 Ga0070687_1002421091 132
76 3300005354 Ga0070675_100328286 Ga0070675_1003282862 132
77 3300005366 Ga0070659_101335504 Ga0070659_1013355042 132
78 3300005438 Ga0070701_10041098 Ga0070701_100410983 132
79 3300005439 Ga0070711_101648486 Ga0070711_1016484861 132
80 3300005441 Ga0070700_100498985 Ga0070700_1004989852 132
81 3300005444 Ga0070694_100012128 Ga0070694_1000121282 132
82 3300005466 Ga0070685_10318830 Ga0070685_103188302 132
83 3300005467 Ga0070706_100256364 Ga0070706_1002563643 132
84 3300005471 Ga0070698_100312863 Ga0070698_1003128632 132
85 3300005535 Ga0070684_102340227 Ga0070684_1023402271 132
86 3300005544 Ga0070686_100008218 Ga0070686_1000082184 132
87 3300005544 Ga0070686_100094785 Ga0070686_1000947853 132
88 3300005545 Ga0070695_100040840 Ga0070695_1000408402 132
89 3300005545 Ga0070695_100438659 Ga0070695_1004386591 132
90 3300005548 Ga0070665_100057510 Ga0070665_1000575103 132
91 3300005549 Ga0070704_100225021 Ga0070704_1002250211 132
92 3300005615 Ga0070702_100011357 Ga0070702_1000113573 132
93 3300005616 Ga0068852_100295998 Ga0068852_1002959982 132
94 3300005617 Ga0068859_100207311 Ga0068859_1002073112 132
95 3300005618 Ga0068864_100043617 Ga0068864_1000436173 132
96 3300005718 Ga0068866_10315846 Ga0068866_103158462 132
97 3300005719 Ga0068861_100015198 Ga0068861_1000151984 132
98 3300005719 Ga0068861_100070619 Ga0068861_1000706193 132
99 3300005843 Ga0068860_100043352 Ga0068860_1000433523 132
100 3300006038 Ga0075365_10021856 Ga0075365_100218565 132
101 3300006846 Ga0075430_100896345 Ga0075430_1008963452 132
102 3300006847 Ga0075431_101515467 Ga0075431_1015154672 132
103 3300006931 Ga0097620_100207310 Ga0097620_1002073103 132
104 3300009177 Ga0105248_12418326 Ga0105248_124183261 132
105 3300013296 Ga0157374_11461872 Ga0157374_114618722 132
106 3300013297 Ga0157378_11069767 Ga0157378_110697672 132
107 3300014326 Ga0157380_10088284 Ga0157380_100882842 132
108 3300014326 Ga0157380_11445980 Ga0157380_114459802 132
109 3300025899 Ga0207642_10194372 Ga0207642_101943722 132
110 3300025903 Ga0207680_10527061 Ga0207680_105270611 132
111 3300025910 Ga0207684_11318542 Ga0207684_113185422 132
112 3300025918 Ga0207662_10112560 Ga0207662_101125602 132
113 3300025936 Ga0207670_10071419 Ga0207670_100714192 132
114 3300025936 Ga0207670_10940604 Ga0207670_109406041 132
115 3300025945 Ga0207679_11610712 Ga0207679_116107122 132
116 3300025972 Ga0207668_11216732 Ga0207668_112167321 132
117 3300026023 Ga0207677_11499442 Ga0207677_114994421 132
118 3300026075 Ga0207708_10023115 Ga0207708_100231157 132
119 3300026075 Ga0207708_10355132 Ga0207708_103551322 132
120 3300026089 Ga0207648_10342281 Ga0207648_103422813 132
121 3300026095 Ga0207676_10158827 Ga0207676_101588273 132
122 3300026118 Ga0207675_100002498 Ga0207675_1000024988 132
123 3300026118 Ga0207675_100091494 Ga0207675_1000914943 132
124 3300026121 Ga0207683_10571545 Ga0207683_105715452 132
125 3300028379 Ga0268266_10225119 Ga0268266_102251193 132
126 3300030731 Ga0316177_1002752 Ga0316177_10027524 132
127 3300030733 Ga0314311_1152501 Ga0314311_11525013 132
128 3300031731 Ga0307405_10538052 Ga0307405_105380522 132
129 3300031824 Ga0307413_10014659 Ga0307413_100146594 132
130 3300031852 Ga0307410_10058629 Ga0307410_100586293 132
131 3300031901 Ga0307406_10543856 Ga0307406_105438562 132
132 3300031903 Ga0307407_10388252 Ga0307407_103882522 132
133 3300031995 Ga0307409_100484245 Ga0307409_1004842452 132
134 3300032005 Ga0307411_10116931 Ga0307411_101169313 132
135 3300032126 Ga0307415_100092139 Ga0307415_1000921392 132
136 3300042134 Ga0450898_021182 Ga0450898_021182_48_452 132
137 3300042438 Ga0439459_0042063 Ga0439459_0042063_520_921 132
138 3300044901 Ga0466960_0206082 Ga0466960_0206082_537_935 132
139 3300046474 Ga0495605_0456561 Ga0495605_0456561_98_496 132
140 3300046660 Ga0495625_0025741 Ga0495625_0025741_2047_2451 132
141 3300048903 Ga0496100_0107256 Ga0496100_0107256_1400_1807 132
142 3300048917 Ga0496114_0173090 Ga0496114_0173090_121_528 132
143 3300049571 Ga0501034_0000581 Ga0501034_0000581_45408_45815 132
144 3300049584 Ga0501068_0014073 Ga0501068_0014073_3664_4077 132
145 3300049585 Ga0501069_0645690 Ga0501069_0645690_163_576 132
146 3300049586 Ga0501070_0822101 Ga0501070_0822101_216_629 132
147 3300049588 Ga0501072_0011605 Ga0501072_0011605_2895_3302 132
148 3300049589 Ga0501073_0094930 Ga0501073_0094930_907_1320 132
149 3300049744 Ga0501083_0168285 Ga0501083_0168285_819_1232 132
150 3300050491 nmdc:mga00v17_220350_c1 nmdc:mga00v17_220350_c1_520_918 132
151 3300050491 nmdc:mga00v17_321618_c1 nmdc:mga00v17_321618_c1_140_556 132
152 3300050508 nmdc:mga09592_1259289_c1 nmdc:mga09592_1259289_c1_43_477 132
153 3300050509 nmdc:mga0qj67_327406_c1 nmdc:mga0qj67_327406_c1_532_936 132
154 3300050509 nmdc:mga0qj67_891840_c1 nmdc:mga0qj67_891840_c1_210_608 132
155 3300053727 Ga0500611_002300 Ga0500611_002300_906_1310 132
156 iso_pu_bacteria 2593339198 2595315763 132
157 iso_pu_bacteria 8033684223 8033684828 132
158 3300000041 ARcpr5oldR_c014348 ARcpr5oldR_0143482 133
159 3300000043 ARcpr5yngRDRAFT_c013757 ARcpr5yngRDRAFT_0137572 133
160 3300000549 LJQas_1000389 LJQas_10003894 133
161 3300000652 ARCol0yngRDRAFT_1005214 ARCol0yngRDRAFT_10052141 133
162 3300003320 rootH2_10203653 rootH2_102036533 133
163 3300003322 rootL2_10239904 rootL2_102399042 133
164 3300003323 rootH1_10135344 rootH1_101353446 133
165 3300003373 JGI25407J50210_10061538 JGI25407J50210_100615382 133
166 3300003578 Ga0006562J51391_1003923 Ga0006562J51391_10039231 133
167 3300003791 Ga0055530_10001845 Ga0055530_100018453 133
168 3300003791 Ga0055530_10004950 Ga0055530_100049505 133
169 3300003792 Ga0055540_1000013 Ga0055540_1000013103 133
170 3300003794 Ga0055531_10009126 Ga0055531_100091263 133
171 3300005288 Ga0065714_10114117 Ga0065714_101141172 133
172 3300005288 Ga0065714_10520806 Ga0065714_105208061 133
173 3300005289 Ga0065704_10009070 Ga0065704_100090704 133
174 3300005289 Ga0065704_10072326 Ga0065704_100723268 133
175 3300005290 Ga0065712_10269167 Ga0065712_102691671 133
176 3300005293 Ga0065715_10059131 Ga0065715_100591311 133
177 3300005328 Ga0070676_10297269 Ga0070676_102972693 133
178 3300005331 Ga0070670_100924713 Ga0070670_1009247132 133
179 3300005335 Ga0070666_10065650 Ga0070666_100656502 133
180 3300005339 Ga0070660_100224564 Ga0070660_1002245642 133
181 3300005344 Ga0070661_100067995 Ga0070661_1000679952 133
182 3300005347 Ga0070668_100398362 Ga0070668_1003983622 133
183 3300005353 Ga0070669_100005196 Ga0070669_10000519610 133
184 3300005353 Ga0070669_101069571 Ga0070669_1010695711 133
185 3300005355 Ga0070671_100360839 Ga0070671_1003608391 133
186 3300005356 Ga0070674_101106302 Ga0070674_1011063021 133
187 3300005364 Ga0070673_100069776 Ga0070673_1000697762 133
188 3300005364 Ga0070673_100261125 Ga0070673_1002611253 133
189 3300005437 Ga0070710_10022516 Ga0070710_100225164 133
190 3300005439 Ga0070711_100433079 Ga0070711_1004330791 133
191 3300005439 Ga0070711_100864923 Ga0070711_1008649232 133
192 3300005444 Ga0070694_100167386 Ga0070694_1001673862 133
193 3300005457 Ga0070662_100688790 Ga0070662_1006887902 133
194 3300005471 Ga0070698_100125614 Ga0070698_1001256142 133
195 3300005518 Ga0070699_100022700 Ga0070699_1000227003 133
196 3300005518 Ga0070699_101360583 Ga0070699_1013605831 133
197 3300005543 Ga0070672_100695519 Ga0070672_1006955192 133
198 3300005545 Ga0070695_100191430 Ga0070695_1001914302 133
199 3300005577 Ga0068857_100727712 Ga0068857_1007277122 133
200 3300005578 Ga0068854_101815052 Ga0068854_1018150521 133
201 3300005841 Ga0068863_101328711 Ga0068863_1013287111 133
202 3300005841 Ga0068863_101366606 Ga0068863_1013666062 133
203 3300005981 Ga0081538_10010987 Ga0081538_100109877 133
204 3300006058 Ga0075432_10008524 Ga0075432_100085242 133
205 3300006058 Ga0075432_10008617 Ga0075432_100086174 133
206 3300006871 Ga0075434_100110936 Ga0075434_1001109363 133
207 3300006881 Ga0068865_100088405 Ga0068865_1000884054 133
208 3300006946 Ga0079104_1000001 Ga0079104_100000142 133
209 3300009011 Ga0105251_10174457 Ga0105251_101744572 133
210 3300009094 Ga0111539_10132140 Ga0111539_101321402 133
211 3300009094 Ga0111539_11008936 Ga0111539_110089362 133
212 3300009147 Ga0114129_10790682 Ga0114129_107906822 133
213 3300009148 Ga0105243_10052356 Ga0105243_100523562 133
214 3300009148 Ga0105243_10058878 Ga0105243_100588782 133
215 3300009176 Ga0105242_10245871 Ga0105242_102458712 133
216 3300009176 Ga0105242_10460144 Ga0105242_104601442 133
217 3300009553 Ga0105249_10434926 Ga0105249_104349263 133
218 3300010375 Ga0105239_10575650 Ga0105239_105756503 133
219 3300011119 Ga0105246_10033162 Ga0105246_100331624 133
220 3300011119 Ga0105246_10135191 Ga0105246_101351912 133
221 3300012515 Ga0157338_1003700 Ga0157338_10037002 133
222 3300013100 Ga0157373_10023577 Ga0157373_100235772 133
223 3300013102 Ga0157371_10773117 Ga0157371_107731172 133
224 3300013296 Ga0157374_10296706 Ga0157374_102967062 133
225 3300013297 Ga0157378_10023083 Ga0157378_100230835 133
226 3300013297 Ga0157378_10125763 Ga0157378_101257632 133
227 3300013306 Ga0163162_10472428 Ga0163162_104724282 133
228 3300013306 Ga0163162_11069588 Ga0163162_110695882 133
229 3300013308 Ga0157375_10820212 Ga0157375_108202122 133
230 3300013308 Ga0157375_11991146 Ga0157375_119911462 133
231 3300014497 Ga0182008_10008258 Ga0182008_100082586 133
232 3300017792 Ga0163161_10071251 Ga0163161_100712514 133
233 3300025229 Ga0209147_100110 Ga0209147_10011061 133
234 3300025263 Ga0209565_1026697 Ga0209565_10266972 133
235 3300025291 Ga0209675_1017986 Ga0209675_10179862 133
236 3300025298 Ga0209050_1000567 Ga0209050_100056729 133
237 3300025298 Ga0209050_1007645 Ga0209050_10076456 133
238 3300025299 Ga0209256_1000015 Ga0209256_1000015243 133
239 3300025303 Ga0209051_1000022 Ga0209051_1000022164 133
240 3300025304 Ga0209257_1000030 Ga0209257_1000030362 133
241 3300025315 Ga0207697_10158332 Ga0207697_101583322 133
242 3300025728 Ga0207655_1026217 Ga0207655_10262175 133
243 3300025893 Ga0207682_10185591 Ga0207682_101855912 133
244 3300025907 Ga0207645_10007732 Ga0207645_100077327 133
245 3300025923 Ga0207681_10030754 Ga0207681_100307543 133
246 3300025925 Ga0207650_10008767 Ga0207650_100087674 133
247 3300025925 Ga0207650_10009822 Ga0207650_100098222 133
248 3300025925 Ga0207650_11103314 Ga0207650_111033141 133
249 3300025926 Ga0207659_10073417 Ga0207659_100734173 133
250 3300025928 Ga0207700_11280863 Ga0207700_112808631 133
251 3300025931 Ga0207644_10096399 Ga0207644_100963992 133
252 3300025933 Ga0207706_10044670 Ga0207706_100446702 133
253 3300025934 Ga0207686_10698356 Ga0207686_106983561 133
254 3300025937 Ga0207669_10305642 Ga0207669_103056422 133
255 3300025940 Ga0207691_10000972 Ga0207691_100009727 133
256 3300025961 Ga0207712_10494440 Ga0207712_104944402 133
257 3300026023 Ga0207677_10354147 Ga0207677_103541473 133
258 3300026088 Ga0207641_10764567 Ga0207641_107645673 133
259 3300026095 Ga0207676_10256368 Ga0207676_102563682 133
260 3300026121 Ga0207683_10005968 Ga0207683_1000596810 133
261 3300026121 Ga0207683_10579794 Ga0207683_105797943 133
262 3300027111 Ga0209281_1000057 Ga0209281_1000057272 133
263 3300027907 Ga0207428_10007887 Ga0207428_100078873 133
264 3300028380 Ga0268265_11560089 Ga0268265_115600892 133
265 3300030744 Ga0316181_1148685 Ga0316181_11486851 133
266 3300031456 Ga0307513_10062477 Ga0307513_100624773 133
267 3300031456 Ga0307513_10448919 Ga0307513_104489191 133
268 3300031548 Ga0307408_100005441 Ga0307408_1000054414 133
269 3300031548 Ga0307408_100051596 Ga0307408_1000515962 133
270 3300031548 Ga0307408_100104586 Ga0307408_1001045863 133
271 3300031548 Ga0307408_100130698 Ga0307408_1001306982 133
272 3300031548 Ga0307408_100134221 Ga0307408_1001342213 133
273 3300031548 Ga0307408_100157485 Ga0307408_1001574852 133
274 3300031548 Ga0307408_100273745 Ga0307408_1002737452 133
275 3300031548 Ga0307408_100296870 Ga0307408_1002968702 133
276 3300031548 Ga0307408_100468637 Ga0307408_1004686372 133
277 3300031548 Ga0307408_100560914 Ga0307408_1005609142 133
278 3300031731 Ga0307405_10007056 Ga0307405_100070564 133
279 3300031731 Ga0307405_10007826 Ga0307405_100078262 133
280 3300031731 Ga0307405_10035631 Ga0307405_100356312 133
281 3300031731 Ga0307405_10039154 Ga0307405_100391542 133
282 3300031731 Ga0307405_10043458 Ga0307405_100434582 133
283 3300031731 Ga0307405_10073778 Ga0307405_100737783 133
284 3300031731 Ga0307405_10074644 Ga0307405_100746442 133
285 3300031731 Ga0307405_10096829 Ga0307405_100968293 133
286 3300031731 Ga0307405_10118491 Ga0307405_101184912 133
287 3300031731 Ga0307405_10322901 Ga0307405_103229012 133
288 3300031731 Ga0307405_10473298 Ga0307405_104732982 133
289 3300031824 Ga0307413_10001948 Ga0307413_100019487 133
290 3300031824 Ga0307413_10031868 Ga0307413_100318682 133
291 3300031824 Ga0307413_10145041 Ga0307413_101450412 133
292 3300031824 Ga0307413_10148139 Ga0307413_101481392 133
293 3300031824 Ga0307413_10415420 Ga0307413_104154201 133
294 3300031824 Ga0307413_11209034 Ga0307413_112090342 133
295 3300031852 Ga0307410_10053081 Ga0307410_100530812 133
296 3300031852 Ga0307410_10055460 Ga0307410_100554601 133
297 3300031852 Ga0307410_10074805 Ga0307410_100748052 133
298 3300031852 Ga0307410_10143285 Ga0307410_101432853 133
299 3300031852 Ga0307410_10154155 Ga0307410_101541553 133
300 3300031852 Ga0307410_10326005 Ga0307410_103260052 133
301 3300031852 Ga0307410_10350443 Ga0307410_103504432 133
302 3300031852 Ga0307410_10970122 Ga0307410_109701222 133
303 3300031852 Ga0307410_11020515 Ga0307410_110205152 133
304 3300031901 Ga0307406_10048427 Ga0307406_100484272 133
305 3300031901 Ga0307406_10078742 Ga0307406_100787423 133
306 3300031901 Ga0307406_10277682 Ga0307406_102776822 133
307 3300031901 Ga0307406_10342908 Ga0307406_103429082 133
308 3300031901 Ga0307406_10681713 Ga0307406_106817132 133
309 3300031901 Ga0307406_11147593 Ga0307406_111475932 133
310 3300031901 Ga0307406_11732169 Ga0307406_117321691 133
311 3300031903 Ga0307407_10015990 Ga0307407_100159903 133
312 3300031903 Ga0307407_10026176 Ga0307407_100261762 133
313 3300031903 Ga0307407_10082787 Ga0307407_100827874 133
314 3300031903 Ga0307407_10160248 Ga0307407_101602482 133
315 3300031911 Ga0307412_10003040 Ga0307412_100030404 133
316 3300031911 Ga0307412_10028360 Ga0307412_100283602 133
317 3300031911 Ga0307412_10043108 Ga0307412_100431083 133
318 3300031911 Ga0307412_10140376 Ga0307412_101403762 133
319 3300031911 Ga0307412_10151304 Ga0307412_101513042 133
320 3300031911 Ga0307412_10496113 Ga0307412_104961131 133
321 3300031911 Ga0307412_11045383 Ga0307412_110453832 133
322 3300031995 Ga0307409_100018657 Ga0307409_1000186574 133
323 3300031995 Ga0307409_100075115 Ga0307409_1000751152 133
324 3300031995 Ga0307409_100112570 Ga0307409_1001125702 133
325 3300031995 Ga0307409_100442578 Ga0307409_1004425782 133
326 3300031995 Ga0307409_101087662 Ga0307409_1010876622 133
327 3300031995 Ga0307409_101463084 Ga0307409_1014630841 133
328 3300032002 Ga0307416_100050474 Ga0307416_1000504743 133
329 3300032002 Ga0307416_100065713 Ga0307416_1000657133 133
330 3300032002 Ga0307416_100071746 Ga0307416_1000717462 133
331 3300032002 Ga0307416_100130013 Ga0307416_1001300133 133
332 3300032002 Ga0307416_100205145 Ga0307416_1002051452 133
333 3300032002 Ga0307416_100434199 Ga0307416_1004341992 133
334 3300032002 Ga0307416_100519627 Ga0307416_1005196272 133
335 3300032002 Ga0307416_100645295 Ga0307416_1006452952 133
336 3300032002 Ga0307416_101329575 Ga0307416_1013295751 133
337 3300032002 Ga0307416_102431271 Ga0307416_1024312712 133
338 3300032004 Ga0307414_10113227 Ga0307414_101132272 133
339 3300032004 Ga0307414_10127416 Ga0307414_101274164 133
340 3300032004 Ga0307414_10443380 Ga0307414_104433802 133
341 3300032004 Ga0307414_11644519 Ga0307414_116445191 133
342 3300032005 Ga0307411_10046051 Ga0307411_100460514 133
343 3300032005 Ga0307411_10057518 Ga0307411_100575182 133
344 3300032005 Ga0307411_10906166 Ga0307411_109061662 133
345 3300032126 Ga0307415_100032569 Ga0307415_1000325692 133
346 3300032126 Ga0307415_100055942 Ga0307415_1000559422 133
347 3300032126 Ga0307415_100081580 Ga0307415_1000815803 133
348 3300032126 Ga0307415_100960594 Ga0307415_1009605942 133
349 3300032126 Ga0307415_101758513 Ga0307415_1017585131 133
350 3300035695 Ga0373927_0444366 Ga0373927_0444366_166_567 133
351 3300035725 Ga0373947_0506516 Ga0373947_0506516_296_697 133
352 3300036401 Ga0373937_1651333 Ga0373937_1651333_107_523 133
353 3300037312 Ga0395899_0019700 Ga0395899_0019700_1650_2078 133
354 3300037471 Ga0395905_0163204 Ga0395905_0163204_1061_1489 133
355 3300038443 Ga0395901_0048797 Ga0395901_0048797_3068_3496 133
356 3300041404 Ga0439436_0000563 Ga0439436_0000563_737_1156 133
357 3300041404 Ga0439436_0031567 Ga0439436_0031567_1012_1455 133
358 3300041404 Ga0439436_0046522 Ga0439436_0046522_512_919 133
359 3300041405 Ga0439438_008981 Ga0439438_008981_2687_3106 133
360 3300041405 Ga0439438_031500 Ga0439438_031500_731_1138 133
361 3300041405 Ga0439438_033782 Ga0439438_033782_595_1038 133
362 3300041406 Ga0439439_0040457 Ga0439439_0040457_658_1101 133
363 3300041410 Ga0439461_0003944 Ga0439461_0003944_264_671 133
364 3300041411 Ga0439466_0001999 Ga0439466_0001999_2287_2694 133
365 3300041411 Ga0439466_0007916 Ga0439466_0007916_3396_3815 133
366 3300041411 Ga0439466_0027672 Ga0439466_0027672_1253_1681 133
367 3300041413 Ga0439465_0000895 Ga0439465_0000895_4014_4421 133
368 3300041460 Ga0451802_1673852 Ga0451802_1673852_25_435 133
369 3300041512 Ga0451853_3854387 Ga0451853_3854387_364_765 133
370 3300041512 Ga0451853_4055978 Ga0451853_4055978_644_1051 133
371 3300041999 Ga0439433_0000495 Ga0439433_0000495_2481_2888 133
372 3300041999 Ga0439433_0001654 Ga0439433_0001654_1286_1705 133
373 3300041999 Ga0439433_0030795 Ga0439433_0030795_101_544 133
374 3300041999 Ga0439433_0109346 Ga0439433_0109346_27_455 133
375 3300042002 Ga0439442_000101 Ga0439442_000101_15017_15460 133
376 3300042002 Ga0439442_000116 Ga0439442_000116_204_647 133
377 3300042002 Ga0439442_005175 Ga0439442_005175_304_723 133
378 3300042002 Ga0439442_025517 Ga0439442_025517_170_577 133
379 3300042003 Ga0439443_000642 Ga0439443_000642_230_664 133
380 3300042006 Ga0439432_004027 Ga0439432_004027_232_639 133
381 3300042006 Ga0439432_057062 Ga0439432_057062_578_1021 133
382 3300042007 Ga0439449_0000200 Ga0439449_0000200_17445_17852 133
383 3300042007 Ga0439449_0002805 Ga0439449_0002805_1190_1618 133
384 3300042007 Ga0439449_0024067 Ga0439449_0024067_1502_1945 133
385 3300042007 Ga0439449_0042567 Ga0439449_0042567_188_622 133
386 3300042007 Ga0439449_0043128 Ga0439449_0043128_699_1142 133
387 3300042007 Ga0439449_0149697 Ga0439449_0149697_167_610 133
388 3300042008 Ga0439450_000531 Ga0439450_000531_171_575 133
389 3300042009 Ga0439451_000969 Ga0439451_000969_3706_4140 133
390 3300042010 Ga0439452_003540 Ga0439452_003540_4145_4552 133
391 3300042011 Ga0439454_001086 Ga0439454_001086_669_1103 133
392 3300042014 Ga0439457_001987 Ga0439457_001987_1543_1950 133
393 3300042014 Ga0439457_022928 Ga0439457_022928_171_614 133
394 3300042015 Ga0439462_0021538 Ga0439462_0021538_250_657 133
395 3300042015 Ga0439462_0053094 Ga0439462_0053094_576_1019 133
396 3300042015 Ga0439462_0079721 Ga0439462_0079721_59_487 133
397 3300042016 Ga0439463_005520 Ga0439463_005520_1011_1445 133
398 3300042116 Ga0450912_001660 Ga0450912_001660_485_919 133
399 3300042122 Ga0450920_004719 Ga0450920_004719_1663_2106 133
400 3300042122 Ga0450920_018084 Ga0450920_018084_301_744 133
401 3300042122 Ga0450920_020171 Ga0450920_020171_175_618 133
402 3300042122 Ga0450920_036891 Ga0450920_036891_188_631 133
403 3300042146 Ga0450907_000182 Ga0450907_000182_14539_14982 133
404 3300042435 Ga0439434_0000036 Ga0439434_0000036_6353_6796 133
405 3300042435 Ga0439434_0013637 Ga0439434_0013637_1000_1407 133
406 3300042436 Ga0439435_0000713 Ga0439435_0000713_1698_2132 133
407 3300042439 Ga0439464_0072439 Ga0439464_0072439_260_664 133
408 3300042461 Ga0439460_0101580 Ga0439460_0101580_282_686 133
409 3300042531 Ga0450918_004775 Ga0450918_004775_695_1138 133
410 3300042532 Ga0450893_0005733 Ga0450893_0005733_533_967 133
411 3300042993 Ga0439440_0117781 Ga0439440_0117781_260_694 133
412 3300044658 Ga0466972_0000094 Ga0466972_0000094_34533_34940 133
413 3300046459 Ga0495629_0212244 Ga0495629_0212244_739_1155 133
414 3300046459 Ga0495629_0567644 Ga0495629_0567644_225_641 133
415 3300046472 Ga0495580_0146549 Ga0495580_0146549_28_444 133
416 3300046475 Ga0495639_0002911 Ga0495639_0002911_5435_5851 133
417 3300046476 Ga0495662_0014331 Ga0495662_0014331_64_480 133
418 3300046477 Ga0495664_0084495 Ga0495664_0084495_1168_1584 133
419 3300046499 Ga0495594_0083847 Ga0495594_0083847_227_643 133
420 3300046506 Ga0495583_0207866 Ga0495583_0207866_291_698 133
421 3300046517 Ga0495630_0155096 Ga0495630_0155096_1055_1471 133
422 3300046518 Ga0495631_0017869 Ga0495631_0017869_629_1045 133
423 3300046522 Ga0495643_0022892 Ga0495643_0022892_1889_2305 133
424 3300046528 Ga0495642_0026870 Ga0495642_0026870_1265_1681 133
425 3300046530 Ga0495654_0286497 Ga0495654_0286497_142_549 133
426 3300046531 Ga0495665_0017382 Ga0495665_0017382_3403_3819 133
427 3300046535 Ga0495586_0029284 Ga0495586_0029284_1294_1710 133
428 3300046535 Ga0495586_0064664 Ga0495586_0064664_1279_1695 133
429 3300046536 Ga0495587_0016852 Ga0495587_0016852_3847_4263 133
430 3300046543 Ga0495645_0002905 Ga0495645_0002905_3533_3949 133
431 3300046558 Ga0495633_0054893 Ga0495633_0054893_15_431 133
432 3300046559 Ga0495667_0007751 Ga0495667_0007751_1500_1916 133
433 3300046615 Ga0495656_0000682 Ga0495656_0000682_2637_3053 133
434 3300046615 Ga0495656_0096819 Ga0495656_0096819_918_1334 133
435 3300046616 Ga0495668_0144886 Ga0495668_0144886_443_859 133
436 3300046664 Ga0495659_0083376 Ga0495659_0083376_203_619 133
437 3300046665 Ga0495661_0012401 Ga0495661_0012401_1649_2056 133
438 3300046665 Ga0495661_0109154 Ga0495661_0109154_731_1147 133
439 3300046674 Ga0495588_0004816 Ga0495588_0004816_5070_5486 133
440 3300046674 Ga0495588_0016464 Ga0495588_0016464_1163_1579 133
441 3300046674 Ga0495588_0017021 Ga0495588_0017021_1726_2142 133
442 3300046674 Ga0495588_0044889 Ga0495588_0044889_1807_2223 133
443 3300046674 Ga0495588_0664578 Ga0495588_0664578_118_534 133
444 3300046675 Ga0495657_0016880 Ga0495657_0016880_4535_4951 133
445 3300046679 Ga0495623_0478156 Ga0495623_0478156_19_435 133
446 3300046684 Ga0495669_0308626 Ga0495669_0308626_75_491 133
447 3300046691 Ga0495670_0002876 Ga0495670_0002876_4060_4476 133
448 3300046691 Ga0495670_0149270 Ga0495670_0149270_718_1134 133
449 3300046691 Ga0495670_0474549 Ga0495670_0474549_14_430 133
450 3300046809 Ga0495600_0025629 Ga0495600_0025629_195_611 133
451 3300046809 Ga0495600_0176366 Ga0495600_0176366_818_1234 133
452 3300047315 Ga0495581_0011671 Ga0495581_0011671_4335_4751 133
453 3300047315 Ga0495581_0040156 Ga0495581_0040156_1718_2134 133
454 3300047315 Ga0495581_0042820 Ga0495581_0042820_1832_2248 133
455 3300047315 Ga0495581_0336961 Ga0495581_0336961_366_782 133
456 3300047318 Ga0495636_0006321 Ga0495636_0006321_2633_3049 133
457 3300047318 Ga0495636_0214893 Ga0495636_0214893_390_791 133
458 3300047319 Ga0495674_1151035 Ga0495674_1151035_50_466 133
459 3300047322 Ga0495680_0029620 Ga0495680_0029620_3734_4150 133
460 3300047322 Ga0495680_0043309 Ga0495680_0043309_1217_1633 133
461 3300047444 Ga0495675_0008270 Ga0495675_0008270_1910_2326 133
462 3300047673 Ga0495593_0118406 Ga0495593_0118406_483_899 133
463 3300048903 Ga0496100_0135285 Ga0496100_0135285_308_724 133
464 3300048903 Ga0496100_0245545 Ga0496100_0245545_776_1192 133
465 3300048904 Ga0496101_0011864 Ga0496101_0011864_1498_1914 133
466 3300048904 Ga0496101_0072106 Ga0496101_0072106_628_1044 133
467 3300048904 Ga0496101_0379824 Ga0496101_0379824_152_568 133
468 3300048905 Ga0496102_0093191 Ga0496102_0093191_1219_1635 133
469 3300048905 Ga0496102_0237272 Ga0496102_0237272_316_732 133
470 3300048905 Ga0496102_0281827 Ga0496102_0281827_1104_1520 133
471 3300048910 Ga0496107_0052727 Ga0496107_0052727_2482_2898 133
472 3300048910 Ga0496107_0062322 Ga0496107_0062322_1523_1939 133
473 3300048911 Ga0496108_0281963 Ga0496108_0281963_121_537 133
474 3300048912 Ga0496109_0011004 Ga0496109_0011004_4709_5110 133
475 3300048912 Ga0496109_0193793 Ga0496109_0193793_794_1210 133
476 3300048913 Ga0496110_0015013 Ga0496110_0015013_3117_3533 133
477 3300048913 Ga0496110_0018205 Ga0496110_0018205_2547_3020 133
478 3300048913 Ga0496110_0028849 Ga0496110_0028849_990_1406 133
479 3300048913 Ga0496110_0148060 Ga0496110_0148060_486_902 133
480 3300048914 Ga0496111_0034828 Ga0496111_0034828_549_965 133
481 3300048914 Ga0496111_0099630 Ga0496111_0099630_746_1219 133
482 3300048914 Ga0496111_0203458 Ga0496111_0203458_226_642 133
483 3300048915 Ga0496112_0121464 Ga0496112_0121464_352_768 133
484 3300048916 Ga0496113_0023899 Ga0496113_0023899_2008_2424 133
485 3300048917 Ga0496114_0002889 Ga0496114_0002889_8967_9377 133
486 3300048917 Ga0496114_0024267 Ga0496114_0024267_1586_2002 133
487 3300048917 Ga0496114_0201406 Ga0496114_0201406_1317_1733 133
488 3300048918 Ga0496115_0884118 Ga0496115_0884118_251_667 133
489 3300048919 Ga0496116_0311325 Ga0496116_0311325_156_572 133
490 3300048920 Ga0496117_0115140 Ga0496117_0115140_883_1290 133
491 3300048923 Ga0496120_0178497 Ga0496120_0178497_560_976 133
492 3300048924 Ga0496121_0061864 Ga0496121_0061864_1190_1630 133
493 3300048924 Ga0496121_0252019 Ga0496121_0252019_760_1176 133
494 3300048924 Ga0496121_0488119 Ga0496121_0488119_243_659 133
495 3300048925 Ga0496122_0000039 Ga0496122_0000039_90109_90516 133
496 3300048926 Ga0496123_0000026 Ga0496123_0000026_90205_90612 133
497 3300048927 Ga0496124_0022429 Ga0496124_0022429_1660_2067 133
498 3300048927 Ga0496124_0054539 Ga0496124_0054539_1533_1973 133
499 3300048927 Ga0496124_0096990 Ga0496124_0096990_1314_1730 133
500 3300048928 Ga0496125_0093140 Ga0496125_0093140_641_1057 133
501 3300048929 Ga0496126_0156083 Ga0496126_0156083_471_878 133
502 3300049459 Ga0495678_050078 Ga0495678_050078_773_1180 133
503 3300049513 Ga0501290_022825 Ga0501290_022825_12_446 133
504 3300049541 Ga0501325_007719 Ga0501325_007719_266_700 133
505 3300049541 Ga0501325_030772 Ga0501325_030772_113_553 133
506 3300049541 Ga0501325_037795 Ga0501325_037795_127_552 133
507 3300049575 Ga0501039_0229007 Ga0501039_0229007_507_929 133
508 3300049578 Ga0501042_0352530 Ga0501042_0352530_425_832 133
509 3300049579 Ga0501043_0059443 Ga0501043_0059443_1147_1572 133
510 3300049580 Ga0501046_0214074 Ga0501046_0214074_36_440 133
511 3300049592 Ga0501076_1073076 Ga0501076_1073076_197_619 133
512 3300049661 Ga0501217_174072 Ga0501217_174072_24_464 133
513 3300049665 Ga0501227_097186 Ga0501227_097186_191_616 133
514 3300049742 Ga0501080_0203314 Ga0501080_0203314_259_681 133
515 3300049775 Ga0501279_004178 Ga0501279_004178_854_1294 133
516 3300050495 nmdc:mga04h51_522754_c1 nmdc:mga04h51_522754_c1_65_481 133
517 3300050507 nmdc:mga05p37_999542_c1 nmdc:mga05p37_999542_c1_98_505 133
518 3300050512 nmdc:mga0n895_1074903_c1 nmdc:mga0n895_1074903_c1_147_548 133
519 3300050515 nmdc:mga0a205_125026_c1 nmdc:mga0a205_125026_c1_1283_1684 133
520 3300053090 Ga0500646_0155416 Ga0500646_0155416_197_604 133
521 3300053118 Ga0500594_0125053 Ga0500594_0125053_369_776 133
522 3300053122 Ga0500608_049475 Ga0500608_049475_652_1059 133
523 3300053125 Ga0500618_026607 Ga0500618_026607_552_959 133
524 3300053136 Ga0500559_0007488 Ga0500559_0007488_3886_4293 133
525 3300053136 Ga0500559_0197890 Ga0500559_0197890_440_847 133
526 3300053140 Ga0500573_0052103 Ga0500573_0052103_1294_1701 133
527 3300053146 Ga0500588_0014962 Ga0500588_0014962_728_1135 133
528 3300053153 Ga0500616_0001274 Ga0500616_0001274_20313_20720 133
529 3300059423 Ga0590074_023902 Ga0590074_023902_574_978 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

16

56

0.93

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

137

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9688 1 132
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9606 1 133
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9547 1 132
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9536 1 133
4pav-assembly6.cif.gz_F structure of hypothetical protein sa1046 from s. aureus. 0.8753 1 126
ID Description Score Start End Superfamily
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9559 1 133 3.10.180.10
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9207 1 133 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.882 73 128 3.30.720.110
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8569 4 126 3.10.180.10
3bqxA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8562 1 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A519HRW6-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9972 1 127 GO:0051213
AF-A0A517S8P3-F1-model_v4 Glyoxalase-like domain protein 0.9964 1 128
AF-A0A495G2B3-F1-model_v4 deleted 0.9962 1 129
AF-A0A858X9F5-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9946 1 128 GO:0051213
AF-A0A261RVU8-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9929 1 129 GO:0051213

Feature Viewer

pLDDT pTM Quality
96.15 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map