F459724

General Info

Members Datasets Scaffolds Average Seq Length
528 307 522 155

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0106625|Ga0496102_0106625_543_1067
Length 174
Sequence MRAIVQSPALCTEVNLMSGHDYHAGIRWERAGAVFTDNRYSRGHSWHFDGGVVVPASSSPHTVRVPLSVEAAVDPEEALVAALASCHMLWFLSLAAGARWCVDDYGDDAVGSMGRNAAGKIAMLSVTLRPRVRFCGERVPGREEILQLHERAHEECFIANSVTTTVHIEPVFDA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
3 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
4 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
5 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
6 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
7 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
8 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
202 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
221 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
302 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0.38
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.22
Nodule 0
Rhizoplane 7.39
Rhizosphere 85.8
Stem 0
Stem Tuber 0.57
Unclassified 3.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6351538 2162886012 Unclassified 1114
2 JGI26129J50193_1001905 3300003349 Unclassified 1451
3 Ga0006562J51391_1054345 3300003578 Bacteria 5760
4 Ga0006562J51391_1054347 3300003578 Bacteria 9000
5 JGI25404J52841_10025162 3300003659 Bacteria 1282
6 Ga0055536_1025293 3300003781 Bacteria 1695
7 Ga0055530_10000280 3300003791 Bacteria 46300
8 Ga0055531_10000272 3300003794 Bacteria 53837
9 JGI25405J52794_10018288 3300003911 Bacteria 1398
10 Ga0065715_10766435 3300005293 Unclassified 592
11 Ga0070676_10350093 3300005328 Bacteria 1015
12 Ga0070683_100032711 3300005329 Bacteria 4738
13 Ga0070690_100011991 3300005330 Bacteria 5086
14 Ga0070690_100380155 3300005330 Bacteria 1032
15 Ga0070690_101588097 3300005330 Bacteria 530
16 Ga0070670_100120173 3300005331 Bacteria 2266
17 Ga0068869_100468805 3300005334 Bacteria 1047
18 Ga0070680_100002362 3300005336 Bacteria 13942
19 Ga0070680_100235256 3300005336 Bacteria 1547
20 Ga0070680_100396896 3300005336 Unclassified 1175
21 Ga0068868_100014188 3300005338 Bacteria 5867
22 Ga0070689_100000011 3300005340 Bacteria 218327
23 Ga0070689_100107570 3300005340 Bacteria 2214
24 Ga0070689_100200873 3300005340 Bacteria 1628
25 Ga0070689_101416228 3300005340 Bacteria 628
26 Ga0070691_10005070 3300005341 Bacteria 5986
27 Ga0070691_10006759 3300005341 Bacteria 5249
28 Ga0070691_10112410 3300005341 Bacteria 1364
29 Ga0070687_100059099 3300005343 Bacteria 2017
30 Ga0070692_10157318 3300005345 Bacteria 1299
31 Ga0070668_100648964 3300005347 Bacteria 927
32 Ga0070669_100388621 3300005353 Bacteria 1139
33 Ga0070675_100199744 3300005354 Bacteria 1735
34 Ga0070675_100338777 3300005354 Bacteria 1332
35 Ga0070671_100111835 3300005355 Bacteria 2294
36 Ga0070674_100402103 3300005356 Bacteria 1119
37 Ga0070673_100032086 3300005364 Bacteria 3950
38 Ga0070688_101320073 3300005365 Bacteria 583
39 Ga0070667_100083577 3300005367 Bacteria 2735
40 Ga0070703_10000733 3300005406 Bacteria 10968
41 Ga0070703_10014361 3300005406 Bacteria 2256
42 Ga0070709_10009350 3300005434 Bacteria 5404
43 Ga0070709_10021319 3300005434 Bacteria 3772
44 Ga0070714_100117083 3300005435 Bacteria 2366
45 Ga0070713_100017059 3300005436 Bacteria 5479
46 Ga0070713_100091569 3300005436 Bacteria 2616
47 Ga0070710_10030501 3300005437 Bacteria 2901
48 Ga0070701_10032368 3300005438 Bacteria 2603
49 Ga0070701_10470786 3300005438 Bacteria 810
50 Ga0070711_100009992 3300005439 Bacteria 5855
51 Ga0070711_100120916 3300005439 Bacteria 1937
52 Ga0070705_100000284 3300005440 Bacteria 30207
53 Ga0070700_100033576 3300005441 Bacteria 3091
54 Ga0070700_100048885 3300005441 Bacteria 2623
55 Ga0070700_100301653 3300005441 Bacteria 1169
56 Ga0070694_100036925 3300005444 Bacteria 3238
57 Ga0070694_100092843 3300005444 Bacteria 2121
58 Ga0070694_100484218 3300005444 Bacteria 982
59 Ga0070708_100018075 3300005445 Bacteria 5897
60 Ga0070708_100051172 3300005445 Bacteria 3659
61 Ga0070663_100005804 3300005455 Bacteria 7374
62 Ga0070663_100992992 3300005455 Unclassified 729
63 Ga0070678_100517354 3300005456 Bacteria 1055
64 Ga0070681_10063222 3300005458 Bacteria 3674
65 Ga0068867_100181206 3300005459 Bacteria 1675
66 Ga0070706_100296292 3300005467 Bacteria 1509
67 Ga0070706_100793944 3300005467 Bacteria 876
68 Ga0070707_100370675 3300005468 Bacteria 1391
69 Ga0070707_100548255 3300005468 Bacteria 1118
70 Ga0070698_100086413 3300005471 Bacteria 3122
71 Ga0070698_100149590 3300005471 Bacteria 2283
72 Ga0070699_100000768 3300005518 Bacteria 29617
73 Ga0070679_100482240 3300005530 Bacteria 1184
74 Ga0070697_100047248 3300005536 Bacteria 3491
75 Ga0068853_100177179 3300005539 Bacteria 1932
76 Ga0070695_100001812 3300005545 Bacteria 12065
77 Ga0070695_100010490 3300005545 Bacteria 5532
78 Ga0070695_100217039 3300005545 Bacteria 1376
79 Ga0070695_100366258 3300005545 Bacteria 1084
80 Ga0070696_100000069 3300005546 Bacteria 49879
81 Ga0070696_100709605 3300005546 Bacteria 821
82 Ga0070693_100005191 3300005547 Bacteria 6231
83 Ga0070693_100472286 3300005547 Bacteria 884
84 Ga0070665_100054884 3300005548 Bacteria 3995
85 Ga0070665_100875280 3300005548 Bacteria 911
86 Ga0070704_100000106 3300005549 Bacteria 29134
87 Ga0070704_100013495 3300005549 Bacteria 5070
88 Ga0070704_100082585 3300005549 Bacteria 2369
89 Ga0070704_100266865 3300005549 Bacteria 1412
90 Ga0070704_101046474 3300005549 Bacteria 740
91 Ga0068855_100000841 3300005563 Bacteria 38036
92 Ga0068855_101004420 3300005563 Bacteria 876
93 Ga0068857_100089742 3300005577 Bacteria 2750
94 Ga0068854_100516717 3300005578 Bacteria 1008
95 Ga0068856_100007946 3300005614 Bacteria 10358
96 Ga0068856_100564914 3300005614 Bacteria 1159
97 Ga0070702_100045769 3300005615 Bacteria 2477
98 Ga0070702_101242140 3300005615 Bacteria 602
99 Ga0068859_100006391 3300005617 Bacteria 11957
100 Ga0068859_100166573 3300005617 Bacteria 2284
101 Ga0068864_101080053 3300005618 Bacteria 798
102 Ga0068866_10006416 3300005718 Bacteria 4899
103 Ga0068861_100031033 3300005719 Bacteria 3921
104 Ga0068861_100056703 3300005719 Bacteria 2991
105 Ga0068861_100150729 3300005719 Bacteria 1908
106 Ga0068861_100495113 3300005719 Bacteria 1104
107 Ga0068851_10646043 3300005834 Bacteria 647
108 Ga0068863_100037461 3300005841 Bacteria 4618
109 Ga0068863_100787484 3300005841 Bacteria 948
110 Ga0068858_100006896 3300005842 Bacteria 11045
111 Ga0068858_100871162 3300005842 Unclassified 880
112 Ga0068860_100027650 3300005843 Bacteria 5461
113 Ga0068860_100121452 3300005843 Bacteria 2502
114 Ga0068862_100007239 3300005844 Bacteria 9213
115 Ga0068862_100055700 3300005844 Bacteria 3387
116 Ga0081455_10000073 3300005937 Bacteria 107386
117 Ga0081455_10249840 3300005937 Bacteria 1298
118 Ga0081455_10329614 3300005937 Bacteria 1084
119 Ga0081540_1000012 3300005983 Bacteria 189939
120 Ga0070717_10165908 3300006028 Bacteria 1918
121 Ga0070717_10773786 3300006028 Bacteria 873
122 Ga0070715_10003085 3300006163 Bacteria 5225
123 Ga0070716_100002028 3300006173 Bacteria 9253
124 Ga0070716_100018496 3300006173 Bacteria 3632
125 Ga0070716_100086486 3300006173 Bacteria 1886
126 Ga0070712_100131203 3300006175 Bacteria 1899
127 Ga0097621_100150981 3300006237 Bacteria 1992
128 Ga0075370_10105462 3300006353 Bacteria 1634
129 Ga0068871_100033343 3300006358 Bacteria 4077
130 Ga0075428_100025030 3300006844 Bacteria 6603
131 Ga0075428_100032484 3300006844 Bacteria 5765
132 Ga0075428_100034965 3300006844 Bacteria 5539
133 Ga0075430_100096586 3300006846 Bacteria 2469
134 Ga0075433_10002093 3300006852 Bacteria 15108
135 Ga0075433_10187301 3300006852 Bacteria 1841
136 Ga0075434_100010143 3300006871 Bacteria 8824
137 Ga0075429_100045458 3300006880 Bacteria 3820
138 Ga0075429_100074337 3300006880 Unclassified 2960
139 Ga0075429_100100565 3300006880 Bacteria 2524
140 Ga0068865_100002839 3300006881 Bacteria 10317
141 Ga0068865_100184968 3300006881 Bacteria 1607
142 Ga0075436_100399717 3300006914 Bacteria 995
143 Ga0075436_100862035 3300006914 Bacteria 676
144 Ga0097620_100006391 3300006931 Bacteria 11957
145 Ga0097620_100166582 3300006931 Bacteria 2284
146 Ga0075435_100067092 3300007076 Bacteria 2921
147 Ga0075435_101124345 3300007076 Bacteria 687
148 Ga0099795_10044358 3300007788 Bacteria 1594
149 Ga0105240_10002990 3300009093 Bacteria 26593
150 Ga0105240_10035330 3300009093 Bacteria 6442
151 Ga0105240_10148984 3300009093 Bacteria 2789
152 Ga0111539_10002283 3300009094 Bacteria 25507
153 Ga0111539_10034157 3300009094 Bacteria 6171
154 Ga0111539_10045732 3300009094 Bacteria 5239
155 Ga0111539_10116944 3300009094 Bacteria 3126
156 Ga0111539_10533926 3300009094 Unclassified 1367
157 Ga0111539_11501496 3300009094 Bacteria 781
158 Ga0105245_10180079 3300009098 Bacteria 2019
159 Ga0105245_11055753 3300009098 Unclassified 858
160 Ga0114129_10043906 3300009147 Bacteria 6289
161 Ga0114129_10294858 3300009147 Bacteria 2163
162 Ga0114129_10344904 3300009147 Bacteria 1974
163 Ga0105243_10348467 3300009148 Bacteria 1359
164 Ga0105241_10015195 3300009174 Bacteria 5638
165 Ga0105241_10550368 3300009174 Bacteria 1036
166 Ga0105242_10003054 3300009176 Bacteria 13084
167 Ga0105242_11217696 3300009176 Bacteria 773
168 Ga0105248_10068030 3300009177 Bacteria 3999
169 Ga0105248_10427077 3300009177 Bacteria 1492
170 Ga0105248_11691988 3300009177 Unclassified 717
171 Ga0105237_10015924 3300009545 Bacteria 7818
172 Ga0105237_10058478 3300009545 Bacteria 3858
173 Ga0105237_10192883 3300009545 Bacteria 2037
174 Ga0105237_10594966 3300009545 Bacteria 1113
175 Ga0105238_11047208 3300009551 Bacteria 838
176 Ga0105238_11107305 3300009551 Bacteria 815
177 Ga0105249_10006176 3300009553 Bacteria 10393
178 Ga0105249_11507958 3300009553 Unclassified 745
179 Ga0105239_10017734 3300010375 Bacteria 7877
180 Ga0105246_10082098 3300011119 Bacteria 2300
181 Ga0157371_10005714 3300013102 Bacteria 10429
182 Ga0157370_10025208 3300013104 Bacteria 5887
183 Ga0157370_10393895 3300013104 Bacteria 1275
184 Ga0157369_10028764 3300013105 Bacteria 6147
185 Ga0157369_11026174 3300013105 Bacteria 844
186 Ga0157374_10013397 3300013296 Bacteria 7159
187 Ga0157374_10165413 3300013296 Unclassified 2155
188 Ga0157374_11156383 3300013296 Unclassified 795
189 Ga0157378_10010285 3300013297 Bacteria 8169
190 Ga0157378_10063482 3300013297 Bacteria 3300
191 Ga0163162_10223584 3300013306 Bacteria 2012
192 Ga0163162_10585067 3300013306 Bacteria 1243
193 Ga0163162_10857573 3300013306 Bacteria 1023
194 Ga0157372_10148341 3300013307 Bacteria 2705
195 Ga0157372_10569764 3300013307 Bacteria 1320
196 Ga0157375_10010032 3300013308 Bacteria 8326
197 Ga0157375_10930122 3300013308 Bacteria 1012
198 Ga0163163_10022026 3300014325 Bacteria 6025
199 Ga0163163_10940511 3300014325 Bacteria 928
200 Ga0157380_10000142 3300014326 Bacteria 40538
201 Ga0157380_10003693 3300014326 Bacteria 10530
202 Ga0157380_10130561 3300014326 Bacteria 2142
203 Ga0157380_11278847 3300014326 Bacteria 780
204 Ga0157379_10021504 3300014968 Bacteria 5710
205 Ga0157376_11592602 3300014969 Unclassified 687
206 Ga0213872_10271585 3300021361 Bacteria 710
207 Ga0213874_10045308 3300021377 Bacteria 1331
208 Ga0213876_10399662 3300021384 Bacteria 731
209 Ga0209676_1003926 3300025292 Bacteria 8618
210 Ga0209676_1005157 3300025292 Bacteria 6948
211 Ga0209050_1000017 3300025298 Bacteria 728928
212 Ga0209257_1000104 3300025304 Bacteria 245648
213 Ga0207653_10001256 3300025885 Bacteria 8267
214 Ga0207692_10638421 3300025898 Bacteria 687
215 Ga0207642_10016203 3300025899 Bacteria 2801
216 Ga0207685_10004502 3300025905 Bacteria 3554
217 Ga0207685_10087978 3300025905 Bacteria 1301
218 Ga0207685_10241103 3300025905 Bacteria 870
219 Ga0207699_10004243 3300025906 Bacteria 6860
220 Ga0207699_10010634 3300025906 Bacteria 4627
221 Ga0207645_10737792 3300025907 Unclassified 670
222 Ga0207643_10472168 3300025908 Bacteria 800
223 Ga0207684_10164992 3300025910 Bacteria 1908
224 Ga0207654_10207002 3300025911 Bacteria 1295
225 Ga0207707_10035970 3300025912 Bacteria 4330
226 Ga0207695_10000337 3300025913 Bacteria 110325
227 Ga0207695_10008085 3300025913 Bacteria 13232
228 Ga0207695_10293343 3300025913 Bacteria 1518
229 Ga0207671_10010144 3300025914 Bacteria 7805
230 Ga0207671_10154662 3300025914 Bacteria 1773
231 Ga0207693_10000021 3300025915 Bacteria 128800
232 Ga0207693_10034274 3300025915 Bacteria 4005
233 Ga0207693_10258163 3300025915 Bacteria 1366
234 Ga0207663_10120603 3300025916 Bacteria 1795
235 Ga0207663_10942570 3300025916 Bacteria 691
236 Ga0207660_10012476 3300025917 Bacteria 5561
237 Ga0207660_10184384 3300025917 Bacteria 1622
238 Ga0207662_10111162 3300025918 Bacteria 1708
239 Ga0207652_10421141 3300025921 Bacteria 1204
240 Ga0207646_10123114 3300025922 Bacteria 2331
241 Ga0207646_10199377 3300025922 Bacteria 1808
242 Ga0207659_10293970 3300025926 Bacteria 1332
243 Ga0207687_10889820 3300025927 Bacteria 762
244 Ga0207700_10003126 3300025928 Bacteria 9560
245 Ga0207700_10176409 3300025928 Bacteria 1786
246 Ga0207700_10414223 3300025928 Bacteria 1183
247 Ga0207664_10118208 3300025929 Bacteria 2214
248 Ga0207706_10790118 3300025933 Bacteria 807
249 Ga0207686_10017032 3300025934 Bacteria 4086
250 Ga0207709_10150875 3300025935 Bacteria 1609
251 Ga0207670_10000005 3300025936 Bacteria 431451
252 Ga0207669_11957301 3300025937 Bacteria 501
253 Ga0207704_10070409 3300025938 Bacteria 2214
254 Ga0207704_10242607 3300025938 Bacteria 1347
255 Ga0207704_10421037 3300025938 Bacteria 1059
256 Ga0207665_10003946 3300025939 Bacteria 9930
257 Ga0207665_10007972 3300025939 Bacteria 6992
258 Ga0207665_10018176 3300025939 Bacteria 4620
259 Ga0207665_10455296 3300025939 Bacteria 983
260 Ga0207691_10910085 3300025940 Unclassified 736
261 Ga0207711_10080886 3300025941 Bacteria 2838
262 Ga0207689_10043467 3300025942 Bacteria 3714
263 Ga0207689_10088670 3300025942 Bacteria 2541
264 Ga0207689_10647758 3300025942 Unclassified 890
265 Ga0207667_10000839 3300025949 Bacteria 39670
266 Ga0207667_10157339 3300025949 Bacteria 2338
267 Ga0207712_10006325 3300025961 Bacteria 7469
268 Ga0207668_11420122 3300025972 Bacteria 626
269 Ga0207640_10613645 3300025981 Bacteria 922
270 Ga0207658_10206398 3300025986 Bacteria 1644
271 Ga0207677_10024915 3300026023 Bacteria 3725
272 Ga0207677_11523605 3300026023 Unclassified 618
273 Ga0207678_10009050 3300026067 Bacteria 8768
274 Ga0207678_10595335 3300026067 Unclassified 969
275 Ga0207708_10013400 3300026075 Bacteria 6127
276 Ga0207708_10044894 3300026075 Bacteria 3368
277 Ga0207708_10079688 3300026075 Bacteria 2516
278 Ga0207648_10226245 3300026089 Bacteria 1663
279 Ga0207676_10113299 3300026095 Bacteria 2273
280 Ga0207676_10425742 3300026095 Bacteria 1246
281 Ga0207674_10002834 3300026116 Bacteria 21561
282 Ga0207674_10030437 3300026116 Bacteria 5674
283 Ga0207675_100098480 3300026118 Bacteria 2754
284 Ga0207675_100222858 3300026118 Bacteria 1817
285 Ga0207675_100418937 3300026118 Bacteria 1322
286 Ga0209966_1028173 3300027695 Unclassified 1127
287 Ga0209974_10154688 3300027876 Bacteria 829
288 Ga0209974_10304664 3300027876 Bacteria 610
289 Ga0207428_10013153 3300027907 Bacteria 7245
290 Ga0207428_10026428 3300027907 Bacteria 4845
291 Ga0207428_10083959 3300027907 Unclassified 2483
292 Ga0268266_10813537 3300028379 Bacteria 903
293 Ga0268265_10507479 3300028380 Bacteria 1137
294 Ga0268264_10041465 3300028381 Bacteria 3808
295 Ga0268264_10053778 3300028381 Bacteria 3360
296 Ga0268264_10239157 3300028381 Bacteria 1681
297 Ga0265330_10089703 3300031235 Bacteria 1320
298 Ga0265330_10107961 3300031235 Bacteria 1190
299 Ga0265325_10025264 3300031241 Bacteria 3226
300 Ga0265325_10046926 3300031241 Bacteria 2238
301 Ga0265340_10006325 3300031247 Bacteria 6528
302 Ga0265327_10096175 3300031251 Bacteria 1436
303 Ga0307408_100218508 3300031548 Bacteria 1554
304 Ga0307408_100278591 3300031548 Bacteria 1392
305 Ga0307408_100610925 3300031548 Bacteria 970
306 Ga0307408_100784699 3300031548 Bacteria 863
307 Ga0307405_10001231 3300031731 Bacteria 10649
308 Ga0307405_10106559 3300031731 Unclassified 1891
309 Ga0307413_10451884 3300031824 Bacteria 1020
310 Ga0307410_10001551 3300031852 Bacteria 10471
311 Ga0307410_10064168 3300031852 Bacteria 2523
312 Ga0307410_10490010 3300031852 Bacteria 1010
313 Ga0307406_10110187 3300031901 Bacteria 1894
314 Ga0307406_10343599 3300031901 Bacteria 1163
315 Ga0307407_10001320 3300031903 Bacteria 8869
316 Ga0307407_10881685 3300031903 Unclassified 685
317 Ga0307407_10950548 3300031903 Bacteria 662
318 Ga0307412_10031627 3300031911 Bacteria 3344
319 Ga0307412_10221343 3300031911 Unclassified 1451
320 Ga0307412_10858719 3300031911 Bacteria 792
321 Ga0307409_100003494 3300031995 Bacteria 8552
322 Ga0307416_100004185 3300032002 Bacteria 8649
323 Ga0307416_100216071 3300032002 Bacteria 1834
324 Ga0307416_100609050 3300032002 Bacteria 1173
325 Ga0307414_10009925 3300032004 Bacteria 5493
326 Ga0307414_10018722 3300032004 Bacteria 4272
327 Ga0307414_10074417 3300032004 Bacteria 2461
328 Ga0307414_10402507 3300032004 Bacteria 1189
329 Ga0307414_11349426 3300032004 Bacteria 662
330 Ga0307411_10081123 3300032005 Bacteria 2233
331 Ga0307411_10245484 3300032005 Unclassified 1404
332 Ga0307411_10653185 3300032005 Bacteria 911
333 Ga0307415_100001394 3300032126 Bacteria 11528
334 Ga0307507_10036380 3300033179 Bacteria 5033
335 Ga0373950_0012372 3300034818 Bacteria 1408
336 Ga0373959_0012862 3300034820 Bacteria 1501
337 Ga0373959_0146225 3300034820 Bacteria 595
338 Ga0373938_0005277 3300034957 Bacteria 2194
339 Ga0373929_0009989 3300035085 Bacteria 1767
340 Ga0373940_0005921 3300035088 Bacteria 2681
341 Ga0373951_0028523 3300035091 Bacteria 1308
342 Ga0373952_0010720 3300035092 Bacteria 1776
343 Ga0373936_0128619 3300035113 Bacteria 1087
344 Ga0373939_0001557 3300035114 Bacteria 5572
345 Ga0373939_0036720 3300035114 Bacteria 1451
346 Ga0373941_0005359 3300035115 Bacteria 3013
347 Ga0373941_0014186 3300035115 Bacteria 2123
348 Ga0373941_0015541 3300035115 Bacteria 2055
349 Ga0373956_0348245 3300035119 Bacteria 706
350 Ga0373960_0032156 3300035121 Bacteria 1472
351 Ga0373943_0074331 3300035170 Bacteria 1728
352 Ga0373955_0089635 3300035172 Bacteria 1751
353 Ga0373942_0020729 3300035207 Bacteria 1653
354 Ga0373961_0200694 3300035241 Unclassified 703
355 Ga0373962_0016607 3300035242 Bacteria 1900
356 Ga0373962_0039955 3300035242 Bacteria 1318
357 Ga0373931_0001216 3300035691 Bacteria 11014
358 Ga0373931_0002067 3300035691 Bacteria 8832
359 Ga0373931_0006105 3300035691 Bacteria 5614
360 Ga0373935_0660690 3300035692 Bacteria 767
361 Ga0373927_0030590 3300035695 Bacteria 3512
362 Ga0373927_0045041 3300035695 Bacteria 2854
363 Ga0373933_0081009 3300035724 Bacteria 1991
364 Ga0373937_0240389 3300036401 Bacteria 1706
365 Ga0373937_1417663 3300036401 Bacteria 642
366 Ga0373937_1425481 3300036401 Unclassified 640
367 Ga0436365_0494227 3300039437 Bacteria 518
368 Ga0436365_1036200 3300039437 Bacteria 929
369 Ga0436360_1062673 3300039438 Bacteria 4036
370 Ga0436361_0176955 3300039447 Bacteria 812
371 Ga0436361_0333953 3300039447 Bacteria 2161
372 Ga0436361_0739818 3300039447 Bacteria 919
373 Ga0436363_0403659 3300039450 Bacteria 1023
374 Ga0436363_0802390 3300039450 Bacteria 3272
375 Ga0439461_0029971 3300041410 Bacteria 1129
376 Ga0451791_1874268 3300041451 Bacteria 581
377 Ga0451797_1101137 3300041453 Bacteria 725
378 Ga0451807_0883340 3300041486 Bacteria 569
379 Ga0451837_0505302 3300041494 Bacteria 683
380 Ga0439431_0074536 3300041997 Bacteria 908
381 Ga0439434_0154205 3300042435 Bacteria 761
382 Ga0451577_0012825 3300042876 Bacteria 7867
383 Ga0466972_0048368 3300044658 Bacteria 2055
384 Ga0466972_0165246 3300044658 Bacteria 1039
385 Ga0466957_0007291 3300044842 Bacteria 6249
386 Ga0495638_0174870 3300046460 Bacteria 1229
387 Ga0495653_0554111 3300046463 Unclassified 711
388 Ga0495580_0009170 3300046472 Bacteria 7800
389 Ga0495580_0022039 3300046472 Bacteria 4694
390 Ga0495580_0175013 3300046472 Bacteria 1483
391 Ga0495582_0006568 3300046473 Bacteria 6454
392 Ga0495662_0213897 3300046476 Bacteria 950
393 Ga0495584_0136507 3300046491 Bacteria 1245
394 Ga0495630_0071504 3300046517 Bacteria 2611
395 Ga0495656_0216134 3300046615 Bacteria 957
396 Ga0495659_0148464 3300046664 Bacteria 940
397 Ga0495647_0197783 3300046681 Bacteria 881
398 Ga0495649_0004033 3300046694 Bacteria 9668
399 Ga0495581_0369673 3300047315 Bacteria 837
400 Ga0495602_0215192 3300048088 Bacteria 1455
401 Ga0496100_0506089 3300048903 Unclassified 931
402 Ga0496101_0011397 3300048904 Bacteria 5898
403 Ga0496101_0086578 3300048904 Bacteria 2324
404 Ga0496101_0735837 3300048904 Unclassified 778
405 Ga0496102_0014004 3300048905 Bacteria 6964
406 Ga0496102_0106625 3300048905 Bacteria 2608
407 Ga0496102_0620374 3300048905 Bacteria 1004
408 Ga0496103_0424819 3300048906 Bacteria 853
409 Ga0496104_0018714 3300048907 Bacteria 6321
410 Ga0496104_0032194 3300048907 Bacteria 4880
411 Ga0496104_0059634 3300048907 Bacteria 3613
412 Ga0496104_0178089 3300048907 Bacteria 2036
413 Ga0496104_0284878 3300048907 Bacteria 1565
414 Ga0496105_0024718 3300048908 Bacteria 4883
415 Ga0496105_0349177 3300048908 Bacteria 1182
416 Ga0496105_0793399 3300048908 Bacteria 720
417 Ga0496105_0799478 3300048908 Unclassified 717
418 Ga0496106_0001137 3300048909 Bacteria 19705
419 Ga0496106_0123669 3300048909 Bacteria 2024
420 Ga0496106_0243973 3300048909 Bacteria 1435
421 Ga0496107_0018741 3300048910 Bacteria 4877
422 Ga0496107_0077559 3300048910 Bacteria 2420
423 Ga0496107_0159965 3300048910 Bacteria 1669
424 Ga0496107_0408659 3300048910 Bacteria 1009
425 Ga0496108_0002792 3300048911 Bacteria 13997
426 Ga0496108_0586159 3300048911 Bacteria 972
427 Ga0496109_0105411 3300048912 Bacteria 2618
428 Ga0496110_0005157 3300048913 Bacteria 10214
429 Ga0496111_0026019 3300048914 Bacteria 4129
430 Ga0496112_0071456 3300048915 Bacteria 3430
431 Ga0496112_0197717 3300048915 Bacteria 1971
432 Ga0496113_1069157 3300048916 Bacteria 634
433 Ga0496114_0002917 3300048917 Bacteria 13111
434 Ga0496115_0300110 3300048918 Bacteria 1316
435 Ga0496115_0493534 3300048918 Bacteria 985
436 Ga0496115_0786594 3300048918 Bacteria 741
437 Ga0496116_0028102 3300048919 Bacteria 4081
438 Ga0496120_0101350 3300048923 Bacteria 1520
439 Ga0496122_0002203 3300048925 Bacteria 28462
440 Ga0496123_0001896 3300048926 Bacteria 27281
441 Ga0496125_0000334 3300048928 Bacteria 90058
442 Ga0501031_0007671 3300049568 Bacteria 7022
443 Ga0501031_0762173 3300049568 Bacteria 621
444 Ga0501032_0018113 3300049569 Unclassified 4938
445 Ga0501034_0354991 3300049571 Bacteria 1394
446 Ga0501036_0169692 3300049572 Unclassified 1838
447 Ga0501037_0058527 3300049573 Unclassified 2812
448 Ga0501037_0656436 3300049573 Bacteria 701
449 Ga0501038_0012702 3300049574 Bacteria 7697
450 Ga0501039_0011370 3300049575 Bacteria 6777
451 Ga0501039_0111877 3300049575 Bacteria 2135
452 Ga0501039_1050420 3300049575 Bacteria 632
453 Ga0501040_0085206 3300049576 Unclassified 2193
454 Ga0501040_0391215 3300049576 Bacteria 998
455 Ga0501041_0000980 3300049577 Bacteria 15584
456 Ga0501041_0416631 3300049577 Unclassified 852
457 Ga0501042_0003599 3300049578 Bacteria 9772
458 Ga0501042_0220561 3300049578 Bacteria 1368
459 Ga0501042_0373089 3300049578 Bacteria 1033
460 Ga0501046_0012783 3300049580 Bacteria 7141
461 Ga0501046_0298183 3300049580 Bacteria 1178
462 Ga0501048_0017654 3300049582 Bacteria 5252
463 Ga0501067_0004605 3300049583 Bacteria 7634
464 Ga0501067_0366250 3300049583 Unclassified 803
465 Ga0501068_0773284 3300049584 Unclassified 629
466 Ga0501069_0074469 3300049585 Unclassified 1905
467 Ga0501071_0164598 3300049587 Bacteria 1659
468 Ga0501072_0006568 3300049588 Bacteria 8855
469 Ga0501072_0109473 3300049588 Bacteria 2199
470 Ga0501073_1271411 3300049589 Unclassified 505
471 Ga0501074_0161174 3300049590 Unclassified 1602
472 Ga0501075_0246793 3300049591 Bacteria 1361
473 Ga0501075_0650702 3300049591 Bacteria 803
474 Ga0501075_0665850 3300049591 Bacteria 793
475 Ga0501076_0019941 3300049592 Bacteria 5130
476 Ga0501077_0008045 3300049593 Bacteria 6517
477 Ga0501077_0127496 3300049593 Bacteria 1613
478 Ga0501077_0241410 3300049593 Bacteria 1148
479 Ga0501077_0703136 3300049593 Bacteria 650
480 Ga0501079_0022509 3300049741 Bacteria 4833
481 Ga0501079_0212515 3300049741 Bacteria 1511
482 Ga0501079_0911597 3300049741 Bacteria 692
483 Ga0501081_0042469 3300049743 Unclassified 3116
484 Ga0501081_0137691 3300049743 Bacteria 1748
485 Ga0501081_1258667 3300049743 Unclassified 561
486 Ga0501035_0004444 3300049822 Bacteria 13307
487 Ga0501044_0220148 3300049823 Bacteria 1849
488 Ga0501044_0379164 3300049823 Bacteria 1329
489 Ga0501044_1024764 3300049823 Unclassified 696
490 Ga0501044_1505839 3300049823 Bacteria 538
491 Ga0501045_0153272 3300049824 Bacteria 1715
492 Ga0501045_0233249 3300049824 Bacteria 1370
493 nmdc:mga07m45_770616_c1 3300050496 Bacteria 552
494 nmdc:mga05p37_194392_c1 3300050507 Bacteria 2461
495 nmdc:mga05p37_37700_c1 3300050507 Bacteria 5928
496 nmdc:mga09592_191170_c1 3300050508 Bacteria 1772
497 nmdc:mga0qj67_172172_c1 3300050509 Bacteria 1758
498 nmdc:mga06r32_460025_c1 3300050510 Bacteria 1251
499 nmdc:mga08y16_1023985_c1 3300050511 Bacteria 805
500 nmdc:mga08y16_134749_c1 3300050511 Bacteria 2567
501 nmdc:mga08y16_144400_c1 3300050511 Bacteria 2474
502 nmdc:mga08y16_33758_c1 3300050511 Bacteria 5374
503 nmdc:mga08y16_497361_c1 3300050511 Bacteria 1239
504 nmdc:mga08y16_702339_c1 3300050511 Unclassified 1011
505 nmdc:mga08y16_971242_c1 3300050511 Bacteria 831
506 nmdc:mga0n895_20730_c1 3300050512 Bacteria 6136
507 nmdc:mga0rr50_11164_c1 3300050513 Bacteria 5731
508 nmdc:mga08x19_793967_c1 3300050514 Bacteria 672
509 nmdc:mga0a205_4542_c1 3300050515 Bacteria 12457
510 Ga0495612_0358425 3300053078 Bacteria 659
511 Ga0500562_080202 3300053108 Bacteria 883
512 Ga0500595_013733 3300053119 Bacteria 3097
513 Ga0500652_087326 3300053131 Bacteria 1301
514 Ga0500573_0040362 3300053140 Bacteria 2696
515 Ga0500573_0073385 3300053140 Bacteria 1950
516 Ga0500573_0079463 3300053140 Bacteria 1865
517 Ga0500645_008548 3300053730 Bacteria 3489
518 Ga0500645_034886 3300053730 Bacteria 1501
519 Ga0501082_0000593 3300060353 Bacteria 31985
520 Ga0501082_0222094 3300060353 Bacteria 1644
521 Ga0501082_0236133 3300060353 Bacteria 1591
522 Ga0530510_0014053 3300061734 Bacteria 5645

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10148984 Ga0105240_101489842 110
2 3300025913 Ga0207695_10000337 Ga0207695_1000033719 110
3 3300049568 Ga0501031_0007671 Ga0501031_0007671_3716_4195 111
4 3300049569 Ga0501032_0018113 Ga0501032_0018113_3722_4201 111
5 3300049571 Ga0501034_0354991 Ga0501034_0354991_168_647 111
6 3300049572 Ga0501036_0169692 Ga0501036_0169692_308_787 111
7 3300049573 Ga0501037_0058527 Ga0501037_0058527_1505_1984 111
8 3300049574 Ga0501038_0012702 Ga0501038_0012702_397_876 111
9 3300049575 Ga0501039_0011370 Ga0501039_0011370_4567_5046 111
10 3300049576 Ga0501040_0085206 Ga0501040_0085206_663_1142 111
11 3300049577 Ga0501041_0000980 Ga0501041_0000980_8251_8730 111
12 3300049578 Ga0501042_0003599 Ga0501042_0003599_1340_1819 111
13 3300049580 Ga0501046_0012783 Ga0501046_0012783_5872_6351 111
14 3300049582 Ga0501048_0017654 Ga0501048_0017654_979_1458 111
15 3300049588 Ga0501072_0109473 Ga0501072_0109473_1043_1522 111
16 3300049592 Ga0501076_0019941 Ga0501076_0019941_3738_4217 111
17 3300049743 Ga0501081_0042469 Ga0501081_0042469_1475_1954 111
18 3300049822 Ga0501035_0004444 Ga0501035_0004444_10671_11150 111
19 3300049823 Ga0501044_1024764 Ga0501044_1024764_52_531 111
20 3300049824 Ga0501045_0153272 Ga0501045_0153272_739_1203 111
21 3300005331 Ga0070670_100120173 Ga0070670_1001201732 112
22 3300025940 Ga0207691_10910085 Ga0207691_109100851 112
23 3300060353 Ga0501082_0000593 Ga0501082_0000593_18969_19448 117
24 3300005330 Ga0070690_100380155 Ga0070690_1003801552 119
25 3300005354 Ga0070675_100199744 Ga0070675_1001997442 119
26 3300005438 Ga0070701_10470786 Ga0070701_104707861 119
27 3300005618 Ga0068864_101080053 Ga0068864_1010800532 119
28 3300013306 Ga0163162_10857573 Ga0163162_108575732 119
29 3300035115 Ga0373941_0014186 Ga0373941_0014186_1581_2018 119
30 3300035691 Ga0373931_0002067 Ga0373931_0002067_7209_7646 119
31 3300005563 Ga0068855_101004420 Ga0068855_1010044201 120
32 3300005834 Ga0068851_10646043 Ga0068851_106460431 120
33 3300006028 Ga0070717_10773786 Ga0070717_107737862 120
34 3300009098 Ga0105245_11055753 Ga0105245_110557531 120
35 3300009545 Ga0105237_10058478 Ga0105237_100584782 120
36 3300009551 Ga0105238_11107305 Ga0105238_111073052 120
37 3300013296 Ga0157374_10165413 Ga0157374_101654133 120
38 3300025914 Ga0207671_10154662 Ga0207671_101546622 120
39 3300025928 Ga0207700_10414223 Ga0207700_104142232 120
40 3300031241 Ga0265325_10025264 Ga0265325_100252642 120
41 3300031247 Ga0265340_10006325 Ga0265340_100063255 120
42 3300035724 Ga0373933_0081009 Ga0373933_0081009_1419_1805 120
43 3300036401 Ga0373937_0240389 Ga0373937_0240389_229_687 120
44 3300042876 Ga0451577_0012825 Ga0451577_0012825_241_711 120
45 3300044658 Ga0466972_0048368 Ga0466972_0048368_572_1018 120
46 3300048904 Ga0496101_0086578 Ga0496101_0086578_89_547 120
47 3300048907 Ga0496104_0059634 Ga0496104_0059634_2477_2935 120
48 3300048908 Ga0496105_0799478 Ga0496105_0799478_191_649 120
49 3300048910 Ga0496107_0077559 Ga0496107_0077559_1384_1842 120
50 3300049583 Ga0501067_0004605 Ga0501067_0004605_1406_1888 120
51 3300049591 Ga0501075_0665850 Ga0501075_0665850_318_779 120
52 3300049593 Ga0501077_0127496 Ga0501077_0127496_1140_1601 120
53 3300049824 Ga0501045_0233249 Ga0501045_0233249_444_905 120
54 3300053140 Ga0500573_0079463 Ga0500573_0079463_469_930 120
55 3300060353 Ga0501082_0236133 Ga0501082_0236133_683_1144 120
56 3300061734 Ga0530510_0014053 Ga0530510_0014053_4857_5318 120
57 3300003781 Ga0055536_1025293 Ga0055536_10252932 121
58 3300003791 Ga0055530_10000280 Ga0055530_1000028029 121
59 3300003794 Ga0055531_10000272 Ga0055531_1000027230 121
60 3300003911 JGI25405J52794_10018288 JGI25405J52794_100182882 121
61 3300005330 Ga0070690_101588097 Ga0070690_1015880971 121
62 3300005719 Ga0068861_100150729 Ga0068861_1001507293 121
63 3300005937 Ga0081455_10000073 Ga0081455_10000073101 121
64 3300006353 Ga0075370_10105462 Ga0075370_101054621 121
65 3300009147 Ga0114129_10344904 Ga0114129_103449042 121
66 3300009553 Ga0105249_11507958 Ga0105249_115079582 121
67 3300021384 Ga0213876_10399662 Ga0213876_103996621 121
68 3300025292 Ga0209676_1003926 Ga0209676_10039267 121
69 3300025292 Ga0209676_1005157 Ga0209676_10051574 121
70 3300025298 Ga0209050_1000017 Ga0209050_1000017196 121
71 3300025304 Ga0209257_1000104 Ga0209257_10001048 121
72 3300026118 Ga0207675_100098480 Ga0207675_1000984802 121
73 3300031903 Ga0307407_10950548 Ga0307407_109505481 121
74 3300032004 Ga0307414_11349426 Ga0307414_113494261 121
75 3300039437 Ga0436365_0494227 Ga0436365_0494227_27_491 121
76 3300039437 Ga0436365_1036200 Ga0436365_1036200_158_619 121
77 3300044842 Ga0466957_0007291 Ga0466957_0007291_886_1347 121
78 3300048923 Ga0496120_0101350 Ga0496120_0101350_813_1253 121
79 3300049577 Ga0501041_0416631 Ga0501041_0416631_173_628 121
80 3300050496 nmdc:mga07m45_770616_c1 nmdc:mga07m45_770616_c1_19_480 121
81 3300053108 Ga0500562_080202 Ga0500562_080202_243_707 121
82 3300053119 Ga0500595_013733 Ga0500595_013733_1847_2311 121
83 3300053131 Ga0500652_087326 Ga0500652_087326_497_964 121
84 3300053730 Ga0500645_008548 Ga0500645_008548_1168_1632 121
85 3300053730 Ga0500645_034886 Ga0500645_034886_683_1144 121
86 3300003578 Ga0006562J51391_1054345 Ga0006562J51391_10543458 122
87 3300003578 Ga0006562J51391_1054347 Ga0006562J51391_10543475 122
88 3300005328 Ga0070676_10350093 Ga0070676_103500932 122
89 3300005334 Ga0068869_100468805 Ga0068869_1004688052 122
90 3300005336 Ga0070680_100235256 Ga0070680_1002352563 122
91 3300005336 Ga0070680_100396896 Ga0070680_1003968962 122
92 3300005340 Ga0070689_100000011 Ga0070689_100000011109 122
93 3300005341 Ga0070691_10112410 Ga0070691_101124102 122
94 3300005343 Ga0070687_100059099 Ga0070687_1000590994 122
95 3300005347 Ga0070668_100648964 Ga0070668_1006489641 122
96 3300005354 Ga0070675_100338777 Ga0070675_1003387772 122
97 3300005356 Ga0070674_100402103 Ga0070674_1004021032 122
98 3300005364 Ga0070673_100032086 Ga0070673_1000320866 122
99 3300005365 Ga0070688_101320073 Ga0070688_1013200731 122
100 3300005406 Ga0070703_10014361 Ga0070703_100143614 122
101 3300005441 Ga0070700_100301653 Ga0070700_1003016531 122
102 3300005444 Ga0070694_100092843 Ga0070694_1000928434 122
103 3300005444 Ga0070694_100484218 Ga0070694_1004842181 122
104 3300005445 Ga0070708_100051172 Ga0070708_1000511724 122
105 3300005456 Ga0070678_100517354 Ga0070678_1005173542 122
106 3300005467 Ga0070706_100296292 Ga0070706_1002962923 122
107 3300005467 Ga0070706_100793944 Ga0070706_1007939442 122
108 3300005468 Ga0070707_100548255 Ga0070707_1005482553 122
109 3300005471 Ga0070698_100086413 Ga0070698_1000864132 122
110 3300005545 Ga0070695_100366258 Ga0070695_1003662582 122
111 3300005546 Ga0070696_100709605 Ga0070696_1007096052 122
112 3300005548 Ga0070665_100875280 Ga0070665_1008752801 122
113 3300005549 Ga0070704_100013495 Ga0070704_1000134956 122
114 3300005549 Ga0070704_100082585 Ga0070704_1000825852 122
115 3300005617 Ga0068859_100166573 Ga0068859_1001665733 122
116 3300005719 Ga0068861_100031033 Ga0068861_1000310336 122
117 3300005841 Ga0068863_100787484 Ga0068863_1007874842 122
118 3300005844 Ga0068862_100055700 Ga0068862_1000557002 122
119 3300005937 Ga0081455_10249840 Ga0081455_102498401 122
120 3300006844 Ga0075428_100032484 Ga0075428_1000324847 122
121 3300006844 Ga0075428_100034965 Ga0075428_1000349656 122
122 3300006846 Ga0075430_100096586 Ga0075430_1000965861 122
123 3300006852 Ga0075433_10187301 Ga0075433_101873011 122
124 3300006880 Ga0075429_100074337 Ga0075429_1000743375 122
125 3300006880 Ga0075429_100100565 Ga0075429_1001005654 122
126 3300006881 Ga0068865_100184968 Ga0068865_1001849682 122
127 3300006931 Ga0097620_100166582 Ga0097620_1001665823 122
128 3300009094 Ga0111539_10002283 Ga0111539_1000228334 122
129 3300009094 Ga0111539_10034157 Ga0111539_100341573 122
130 3300009094 Ga0111539_10116944 Ga0111539_101169444 122
131 3300009094 Ga0111539_10533926 Ga0111539_105339262 122
132 3300009147 Ga0114129_10043906 Ga0114129_100439063 122
133 3300009148 Ga0105243_10348467 Ga0105243_103484672 122
134 3300009176 Ga0105242_11217696 Ga0105242_112176962 122
135 3300009177 Ga0105248_10427077 Ga0105248_104270772 122
136 3300009177 Ga0105248_11691988 Ga0105248_116919882 122
137 3300013102 Ga0157371_10005714 Ga0157371_100057142 122
138 3300013104 Ga0157370_10025208 Ga0157370_100252087 122
139 3300013105 Ga0157369_10028764 Ga0157369_100287648 122
140 3300013296 Ga0157374_11156383 Ga0157374_111563832 122
141 3300013306 Ga0163162_10585067 Ga0163162_105850672 122
142 3300013308 Ga0157375_10930122 Ga0157375_109301221 122
143 3300014325 Ga0163163_10940511 Ga0163163_109405112 122
144 3300014326 Ga0157380_10000142 Ga0157380_1000014228 122
145 3300014326 Ga0157380_10003693 Ga0157380_1000369311 122
146 3300014326 Ga0157380_10130561 Ga0157380_101305612 122
147 3300014326 Ga0157380_11278847 Ga0157380_112788471 122
148 3300025905 Ga0207685_10241103 Ga0207685_102411031 122
149 3300025907 Ga0207645_10737792 Ga0207645_107377921 122
150 3300025908 Ga0207643_10472168 Ga0207643_104721682 122
151 3300025910 Ga0207684_10164992 Ga0207684_101649922 122
152 3300025917 Ga0207660_10184384 Ga0207660_101843843 122
153 3300025918 Ga0207662_10111162 Ga0207662_101111622 122
154 3300025922 Ga0207646_10123114 Ga0207646_101231142 122
155 3300025926 Ga0207659_10293970 Ga0207659_102939702 122
156 3300025933 Ga0207706_10790118 Ga0207706_107901181 122
157 3300025935 Ga0207709_10150875 Ga0207709_101508752 122
158 3300025936 Ga0207670_10000005 Ga0207670_10000005269 122
159 3300025937 Ga0207669_11957301 Ga0207669_119573011 122
160 3300025938 Ga0207704_10421037 Ga0207704_104210371 122
161 3300025939 Ga0207665_10007972 Ga0207665_100079722 122
162 3300025942 Ga0207689_10043467 Ga0207689_100434674 122
163 3300025972 Ga0207668_11420122 Ga0207668_114201221 122
164 3300026075 Ga0207708_10013400 Ga0207708_100134003 122
165 3300026116 Ga0207674_10030437 Ga0207674_100304373 122
166 3300027695 Ga0209966_1028173 Ga0209966_10281731 122
167 3300027876 Ga0209974_10154688 Ga0209974_101546881 122
168 3300027876 Ga0209974_10304664 Ga0209974_103046641 122
169 3300027907 Ga0207428_10013153 Ga0207428_100131532 122
170 3300027907 Ga0207428_10083959 Ga0207428_100839594 122
171 3300028379 Ga0268266_10813537 Ga0268266_108135371 122
172 3300028380 Ga0268265_10507479 Ga0268265_105074793 122
173 3300031548 Ga0307408_100278591 Ga0307408_1002785913 122
174 3300031548 Ga0307408_100784699 Ga0307408_1007846991 122
175 3300031731 Ga0307405_10106559 Ga0307405_101065593 122
176 3300031824 Ga0307413_10451884 Ga0307413_104518842 122
177 3300031852 Ga0307410_10064168 Ga0307410_100641682 122
178 3300031852 Ga0307410_10490010 Ga0307410_104900102 122
179 3300031901 Ga0307406_10110187 Ga0307406_101101872 122
180 3300031903 Ga0307407_10881685 Ga0307407_108816852 122
181 3300031911 Ga0307412_10221343 Ga0307412_102213433 122
182 3300031911 Ga0307412_10858719 Ga0307412_108587192 122
183 3300032002 Ga0307416_100216071 Ga0307416_1002160711 122
184 3300032004 Ga0307414_10009925 Ga0307414_100099252 122
185 3300032004 Ga0307414_10074417 Ga0307414_100744172 122
186 3300032004 Ga0307414_10402507 Ga0307414_104025072 122
187 3300032005 Ga0307411_10081123 Ga0307411_100811231 122
188 3300032005 Ga0307411_10653185 Ga0307411_106531852 122
189 3300036401 Ga0373937_1425481 Ga0373937_1425481_72_518 122
190 3300041451 Ga0451791_1874268 Ga0451791_1874268_53_517 122
191 3300041453 Ga0451797_1101137 Ga0451797_1101137_70_519 122
192 3300041486 Ga0451807_0883340 Ga0451807_0883340_95_556 122
193 3300041494 Ga0451837_0505302 Ga0451837_0505302_113_574 122
194 3300046460 Ga0495638_0174870 Ga0495638_0174870_296_760 122
195 3300046463 Ga0495653_0554111 Ga0495653_0554111_188_637 122
196 3300046476 Ga0495662_0213897 Ga0495662_0213897_124_570 122
197 3300046664 Ga0495659_0148464 Ga0495659_0148464_171_620 122
198 3300046694 Ga0495649_0004033 Ga0495649_0004033_2630_3094 122
199 3300048907 Ga0496104_0284878 Ga0496104_0284878_407_856 122
200 3300048908 Ga0496105_0024718 Ga0496105_0024718_3571_4020 122
201 3300048915 Ga0496112_0197717 Ga0496112_0197717_1311_1760 122
202 3300048919 Ga0496116_0028102 Ga0496116_0028102_988_1452 122
203 3300048925 Ga0496122_0002203 Ga0496122_0002203_19323_19787 122
204 3300048926 Ga0496123_0001896 Ga0496123_0001896_19559_20023 122
205 3300048928 Ga0496125_0000334 Ga0496125_0000334_39143_39607 122
206 3300049568 Ga0501031_0762173 Ga0501031_0762173_98_547 122
207 3300049573 Ga0501037_0656436 Ga0501037_0656436_100_549 122
208 3300049575 Ga0501039_0111877 Ga0501039_0111877_1302_1751 122
209 3300049576 Ga0501040_0391215 Ga0501040_0391215_381_830 122
210 3300049578 Ga0501042_0373089 Ga0501042_0373089_164_613 122
211 3300049587 Ga0501071_0164598 Ga0501071_0164598_290_739 122
212 3300049589 Ga0501073_1271411 Ga0501073_1271411_12_461 122
213 3300049741 Ga0501079_0212515 Ga0501079_0212515_141_590 122
214 3300049743 Ga0501081_1258667 Ga0501081_1258667_67_516 122
215 3300049823 Ga0501044_0379164 Ga0501044_0379164_664_1149 122
216 3300049823 Ga0501044_1505839 Ga0501044_1505839_36_428 122
217 3300050507 nmdc:mga05p37_37700_c1 nmdc:mga05p37_37700_c1_1427_1891 122
218 3300050508 nmdc:mga09592_191170_c1 nmdc:mga09592_191170_c1_170_619 122
219 3300050509 nmdc:mga0qj67_172172_c1 nmdc:mga0qj67_172172_c1_1248_1697 122
220 3300050510 nmdc:mga06r32_460025_c1 nmdc:mga06r32_460025_c1_636_1100 122
221 3300050511 nmdc:mga08y16_1023985_c1 nmdc:mga08y16_1023985_c1_301_765 122
222 3300050511 nmdc:mga08y16_134749_c1 nmdc:mga08y16_134749_c1_2027_2476 122
223 3300050511 nmdc:mga08y16_33758_c1 nmdc:mga08y16_33758_c1_3336_3785 122
224 3300050511 nmdc:mga08y16_702339_c1 nmdc:mga08y16_702339_c1_337_786 122
225 3300053140 Ga0500573_0040362 Ga0500573_0040362_1114_1578 122
226 3300053140 Ga0500573_0073385 Ga0500573_0073385_61_525 122
227 3300060353 Ga0501082_0222094 Ga0501082_0222094_447_896 122
228 iso_pu_bacteria 2928972540 2928974587 122
229 iso_pu_bacteria 2941485952 2941487971 122
230 iso_pu_bacteria 2977240413 2977243510 122
231 2162886012 MBSR1b_contig_6351538 MBSR1b_0074.00000290 123
232 3300003349 JGI26129J50193_1001905 JGI26129J50193_10019052 123
233 3300003659 JGI25404J52841_10025162 JGI25404J52841_100251622 123
234 3300005293 Ga0065715_10766435 Ga0065715_107664351 123
235 3300005329 Ga0070683_100032711 Ga0070683_1000327112 123
236 3300005330 Ga0070690_100011991 Ga0070690_1000119915 123
237 3300005336 Ga0070680_100002362 Ga0070680_10000236213 123
238 3300005338 Ga0068868_100014188 Ga0068868_1000141888 123
239 3300005340 Ga0070689_100107570 Ga0070689_1001075701 123
240 3300005340 Ga0070689_100200873 Ga0070689_1002008731 123
241 3300005340 Ga0070689_101416228 Ga0070689_1014162281 123
242 3300005341 Ga0070691_10005070 Ga0070691_100050703 123
243 3300005341 Ga0070691_10006759 Ga0070691_100067596 123
244 3300005345 Ga0070692_10157318 Ga0070692_101573182 123
245 3300005353 Ga0070669_100388621 Ga0070669_1003886212 123
246 3300005355 Ga0070671_100111835 Ga0070671_1001118353 123
247 3300005367 Ga0070667_100083577 Ga0070667_1000835773 123
248 3300005406 Ga0070703_10000733 Ga0070703_100007332 123
249 3300005434 Ga0070709_10009350 Ga0070709_100093503 123
250 3300005434 Ga0070709_10021319 Ga0070709_100213192 123
251 3300005435 Ga0070714_100117083 Ga0070714_1001170832 123
252 3300005436 Ga0070713_100017059 Ga0070713_1000170597 123
253 3300005436 Ga0070713_100091569 Ga0070713_1000915691 123
254 3300005437 Ga0070710_10030501 Ga0070710_100305014 123
255 3300005438 Ga0070701_10032368 Ga0070701_100323683 123
256 3300005439 Ga0070711_100009992 Ga0070711_1000099927 123
257 3300005439 Ga0070711_100120916 Ga0070711_1001209162 123
258 3300005440 Ga0070705_100000284 Ga0070705_1000002842 123
259 3300005441 Ga0070700_100033576 Ga0070700_1000335762 123
260 3300005441 Ga0070700_100048885 Ga0070700_1000488852 123
261 3300005444 Ga0070694_100036925 Ga0070694_1000369252 123
262 3300005445 Ga0070708_100018075 Ga0070708_1000180754 123
263 3300005455 Ga0070663_100005804 Ga0070663_1000058046 123
264 3300005455 Ga0070663_100992992 Ga0070663_1009929921 123
265 3300005458 Ga0070681_10063222 Ga0070681_100632222 123
266 3300005459 Ga0068867_100181206 Ga0068867_1001812061 123
267 3300005468 Ga0070707_100370675 Ga0070707_1003706752 123
268 3300005471 Ga0070698_100149590 Ga0070698_1001495901 123
269 3300005518 Ga0070699_100000768 Ga0070699_10000076826 123
270 3300005530 Ga0070679_100482240 Ga0070679_1004822402 123
271 3300005536 Ga0070697_100047248 Ga0070697_1000472482 123
272 3300005539 Ga0068853_100177179 Ga0068853_1001771791 123
273 3300005545 Ga0070695_100001812 Ga0070695_10000181210 123
274 3300005545 Ga0070695_100010490 Ga0070695_1000104902 123
275 3300005545 Ga0070695_100217039 Ga0070695_1002170392 123
276 3300005546 Ga0070696_100000069 Ga0070696_1000000696 123
277 3300005547 Ga0070693_100005191 Ga0070693_1000051913 123
278 3300005547 Ga0070693_100472286 Ga0070693_1004722862 123
279 3300005548 Ga0070665_100054884 Ga0070665_1000548842 123
280 3300005549 Ga0070704_100000106 Ga0070704_10000010616 123
281 3300005549 Ga0070704_100266865 Ga0070704_1002668653 123
282 3300005549 Ga0070704_101046474 Ga0070704_1010464741 123
283 3300005563 Ga0068855_100000841 Ga0068855_10000084114 123
284 3300005577 Ga0068857_100089742 Ga0068857_1000897423 123
285 3300005578 Ga0068854_100516717 Ga0068854_1005167172 123
286 3300005614 Ga0068856_100007946 Ga0068856_10000794611 123
287 3300005614 Ga0068856_100564914 Ga0068856_1005649142 123
288 3300005615 Ga0070702_100045769 Ga0070702_1000457692 123
289 3300005615 Ga0070702_101242140 Ga0070702_1012421401 123
290 3300005617 Ga0068859_100006391 Ga0068859_1000063916 123
291 3300005718 Ga0068866_10006416 Ga0068866_100064165 123
292 3300005719 Ga0068861_100056703 Ga0068861_1000567033 123
293 3300005719 Ga0068861_100495113 Ga0068861_1004951132 123
294 3300005841 Ga0068863_100037461 Ga0068863_1000374616 123
295 3300005842 Ga0068858_100006896 Ga0068858_10000689610 123
296 3300005842 Ga0068858_100871162 Ga0068858_1008711621 123
297 3300005843 Ga0068860_100027650 Ga0068860_1000276507 123
298 3300005843 Ga0068860_100121452 Ga0068860_1001214523 123
299 3300005844 Ga0068862_100007239 Ga0068862_1000072397 123
300 3300005937 Ga0081455_10329614 Ga0081455_103296142 123
301 3300005983 Ga0081540_1000012 Ga0081540_1000012176 123
302 3300006028 Ga0070717_10165908 Ga0070717_101659082 123
303 3300006163 Ga0070715_10003085 Ga0070715_100030857 123
304 3300006173 Ga0070716_100002028 Ga0070716_1000020284 123
305 3300006173 Ga0070716_100018496 Ga0070716_1000184964 123
306 3300006173 Ga0070716_100086486 Ga0070716_1000864862 123
307 3300006175 Ga0070712_100131203 Ga0070712_1001312033 123
308 3300006237 Ga0097621_100150981 Ga0097621_1001509812 123
309 3300006358 Ga0068871_100033343 Ga0068871_1000333433 123
310 3300006844 Ga0075428_100025030 Ga0075428_1000250301 123
311 3300006852 Ga0075433_10002093 Ga0075433_1000209314 123
312 3300006871 Ga0075434_100010143 Ga0075434_1000101433 123
313 3300006880 Ga0075429_100045458 Ga0075429_1000454582 123
314 3300006881 Ga0068865_100002839 Ga0068865_1000028395 123
315 3300006914 Ga0075436_100399717 Ga0075436_1003997172 123
316 3300006914 Ga0075436_100862035 Ga0075436_1008620351 123
317 3300006931 Ga0097620_100006391 Ga0097620_1000063916 123
318 3300007076 Ga0075435_100067092 Ga0075435_1000670923 123
319 3300007076 Ga0075435_101124345 Ga0075435_1011243452 123
320 3300007788 Ga0099795_10044358 Ga0099795_100443582 123
321 3300009093 Ga0105240_10002990 Ga0105240_1000299020 123
322 3300009093 Ga0105240_10035330 Ga0105240_100353307 123
323 3300009094 Ga0111539_10045732 Ga0111539_100457322 123
324 3300009094 Ga0111539_11501496 Ga0111539_115014962 123
325 3300009098 Ga0105245_10180079 Ga0105245_101800792 123
326 3300009147 Ga0114129_10294858 Ga0114129_102948583 123
327 3300009174 Ga0105241_10015195 Ga0105241_100151957 123
328 3300009174 Ga0105241_10550368 Ga0105241_105503681 123
329 3300009176 Ga0105242_10003054 Ga0105242_100030545 123
330 3300009177 Ga0105248_10068030 Ga0105248_100680303 123
331 3300009545 Ga0105237_10015924 Ga0105237_100159243 123
332 3300009545 Ga0105237_10192883 Ga0105237_101928831 123
333 3300009545 Ga0105237_10594966 Ga0105237_105949662 123
334 3300009551 Ga0105238_11047208 Ga0105238_110472082 123
335 3300009553 Ga0105249_10006176 Ga0105249_100061762 123
336 3300010375 Ga0105239_10017734 Ga0105239_100177345 123
337 3300011119 Ga0105246_10082098 Ga0105246_100820982 123
338 3300013104 Ga0157370_10393895 Ga0157370_103938952 123
339 3300013105 Ga0157369_11026174 Ga0157369_110261742 123
340 3300013296 Ga0157374_10013397 Ga0157374_100133972 123
341 3300013297 Ga0157378_10010285 Ga0157378_100102855 123
342 3300013297 Ga0157378_10063482 Ga0157378_100634822 123
343 3300013306 Ga0163162_10223584 Ga0163162_102235842 123
344 3300013307 Ga0157372_10148341 Ga0157372_101483413 123
345 3300013307 Ga0157372_10569764 Ga0157372_105697642 123
346 3300013308 Ga0157375_10010032 Ga0157375_1001003210 123
347 3300014325 Ga0163163_10022026 Ga0163163_100220262 123
348 3300014968 Ga0157379_10021504 Ga0157379_100215045 123
349 3300014969 Ga0157376_11592602 Ga0157376_115926021 123
350 3300021361 Ga0213872_10271585 Ga0213872_102715851 123
351 3300021377 Ga0213874_10045308 Ga0213874_100453081 123
352 3300025885 Ga0207653_10001256 Ga0207653_100012569 123
353 3300025898 Ga0207692_10638421 Ga0207692_106384211 123
354 3300025899 Ga0207642_10016203 Ga0207642_100162032 123
355 3300025905 Ga0207685_10004502 Ga0207685_100045024 123
356 3300025905 Ga0207685_10087978 Ga0207685_100879781 123
357 3300025906 Ga0207699_10004243 Ga0207699_100042436 123
358 3300025906 Ga0207699_10010634 Ga0207699_100106343 123
359 3300025911 Ga0207654_10207002 Ga0207654_102070022 123
360 3300025912 Ga0207707_10035970 Ga0207707_100359704 123
361 3300025913 Ga0207695_10008085 Ga0207695_1000808511 123
362 3300025913 Ga0207695_10293343 Ga0207695_102933433 123
363 3300025914 Ga0207671_10010144 Ga0207671_100101449 123
364 3300025915 Ga0207693_10000021 Ga0207693_1000002169 123
365 3300025915 Ga0207693_10034274 Ga0207693_100342745 123
366 3300025915 Ga0207693_10258163 Ga0207693_102581632 123
367 3300025916 Ga0207663_10120603 Ga0207663_101206032 123
368 3300025916 Ga0207663_10942570 Ga0207663_109425702 123
369 3300025917 Ga0207660_10012476 Ga0207660_100124765 123
370 3300025921 Ga0207652_10421141 Ga0207652_104211412 123
371 3300025922 Ga0207646_10199377 Ga0207646_101993773 123
372 3300025927 Ga0207687_10889820 Ga0207687_108898202 123
373 3300025928 Ga0207700_10003126 Ga0207700_100031264 123
374 3300025928 Ga0207700_10176409 Ga0207700_101764092 123
375 3300025929 Ga0207664_10118208 Ga0207664_101182083 123
376 3300025934 Ga0207686_10017032 Ga0207686_100170324 123
377 3300025938 Ga0207704_10070409 Ga0207704_100704092 123
378 3300025938 Ga0207704_10242607 Ga0207704_102426072 123
379 3300025939 Ga0207665_10003946 Ga0207665_100039464 123
380 3300025939 Ga0207665_10018176 Ga0207665_100181762 123
381 3300025939 Ga0207665_10455296 Ga0207665_104552963 123
382 3300025941 Ga0207711_10080886 Ga0207711_100808861 123
383 3300025942 Ga0207689_10088670 Ga0207689_100886702 123
384 3300025942 Ga0207689_10647758 Ga0207689_106477581 123
385 3300025949 Ga0207667_10000839 Ga0207667_1000083915 123
386 3300025949 Ga0207667_10157339 Ga0207667_101573393 123
387 3300025961 Ga0207712_10006325 Ga0207712_100063257 123
388 3300025981 Ga0207640_10613645 Ga0207640_106136451 123
389 3300025986 Ga0207658_10206398 Ga0207658_102063982 123
390 3300026023 Ga0207677_10024915 Ga0207677_100249153 123
391 3300026023 Ga0207677_11523605 Ga0207677_115236051 123
392 3300026067 Ga0207678_10009050 Ga0207678_100090506 123
393 3300026067 Ga0207678_10595335 Ga0207678_105953352 123
394 3300026075 Ga0207708_10044894 Ga0207708_100448943 123
395 3300026075 Ga0207708_10079688 Ga0207708_100796882 123
396 3300026089 Ga0207648_10226245 Ga0207648_102262452 123
397 3300026095 Ga0207676_10113299 Ga0207676_101132993 123
398 3300026095 Ga0207676_10425742 Ga0207676_104257422 123
399 3300026116 Ga0207674_10002834 Ga0207674_1000283420 123
400 3300026118 Ga0207675_100222858 Ga0207675_1002228582 123
401 3300026118 Ga0207675_100418937 Ga0207675_1004189372 123
402 3300027907 Ga0207428_10026428 Ga0207428_100264283 123
403 3300028381 Ga0268264_10041465 Ga0268264_100414653 123
404 3300028381 Ga0268264_10053778 Ga0268264_100537782 123
405 3300028381 Ga0268264_10239157 Ga0268264_102391573 123
406 3300031235 Ga0265330_10089703 Ga0265330_100897032 123
407 3300031235 Ga0265330_10107961 Ga0265330_101079612 123
408 3300031241 Ga0265325_10046926 Ga0265325_100469263 123
409 3300031251 Ga0265327_10096175 Ga0265327_100961752 123
410 3300031548 Ga0307408_100218508 Ga0307408_1002185083 123
411 3300031548 Ga0307408_100610925 Ga0307408_1006109251 123
412 3300031731 Ga0307405_10001231 Ga0307405_100012319 123
413 3300031852 Ga0307410_10001551 Ga0307410_100015513 123
414 3300031901 Ga0307406_10343599 Ga0307406_103435993 123
415 3300031903 Ga0307407_10001320 Ga0307407_100013204 123
416 3300031911 Ga0307412_10031627 Ga0307412_100316275 123
417 3300031995 Ga0307409_100003494 Ga0307409_1000034949 123
418 3300032002 Ga0307416_100004185 Ga0307416_1000041858 123
419 3300032002 Ga0307416_100609050 Ga0307416_1006090503 123
420 3300032004 Ga0307414_10018722 Ga0307414_100187227 123
421 3300032005 Ga0307411_10245484 Ga0307411_102454842 123
422 3300032126 Ga0307415_100001394 Ga0307415_10000139413 123
423 3300033179 Ga0307507_10036380 Ga0307507_100363803 123
424 3300034818 Ga0373950_0012372 Ga0373950_0012372_115_597 123
425 3300034820 Ga0373959_0012862 Ga0373959_0012862_959_1441 123
426 3300034820 Ga0373959_0146225 Ga0373959_0146225_79_561 123
427 3300034957 Ga0373938_0005277 Ga0373938_0005277_78_560 123
428 3300035085 Ga0373929_0009989 Ga0373929_0009989_960_1442 123
429 3300035088 Ga0373940_0005921 Ga0373940_0005921_932_1414 123
430 3300035091 Ga0373951_0028523 Ga0373951_0028523_587_1069 123
431 3300035092 Ga0373952_0010720 Ga0373952_0010720_516_998 123
432 3300035113 Ga0373936_0128619 Ga0373936_0128619_321_794 123
433 3300035114 Ga0373939_0001557 Ga0373939_0001557_2742_3224 123
434 3300035114 Ga0373939_0036720 Ga0373939_0036720_319_801 123
435 3300035115 Ga0373941_0005359 Ga0373941_0005359_1509_1991 123
436 3300035115 Ga0373941_0015541 Ga0373941_0015541_1410_1892 123
437 3300035119 Ga0373956_0348245 Ga0373956_0348245_96_569 123
438 3300035121 Ga0373960_0032156 Ga0373960_0032156_524_1006 123
439 3300035170 Ga0373943_0074331 Ga0373943_0074331_656_1129 123
440 3300035172 Ga0373955_0089635 Ga0373955_0089635_150_623 123
441 3300035207 Ga0373942_0020729 Ga0373942_0020729_205_687 123
442 3300035241 Ga0373961_0200694 Ga0373961_0200694_166_648 123
443 3300035242 Ga0373962_0016607 Ga0373962_0016607_699_1181 123
444 3300035242 Ga0373962_0039955 Ga0373962_0039955_420_902 123
445 3300035691 Ga0373931_0001216 Ga0373931_0001216_7700_8182 123
446 3300035691 Ga0373931_0006105 Ga0373931_0006105_2179_2661 123
447 3300035692 Ga0373935_0660690 Ga0373935_0660690_245_751 123
448 3300035695 Ga0373927_0030590 Ga0373927_0030590_2756_3229 123
449 3300035695 Ga0373927_0045041 Ga0373927_0045041_2110_2583 123
450 3300036401 Ga0373937_1417663 Ga0373937_1417663_63_536 123
451 3300039438 Ga0436360_1062673 Ga0436360_1062673_786_1262 123
452 3300039447 Ga0436361_0176955 Ga0436361_0176955_84_560 123
453 3300039447 Ga0436361_0333953 Ga0436361_0333953_224_694 123
454 3300039447 Ga0436361_0739818 Ga0436361_0739818_114_590 123
455 3300039450 Ga0436363_0403659 Ga0436363_0403659_120_596 123
456 3300039450 Ga0436363_0802390 Ga0436363_0802390_27_503 123
457 3300041410 Ga0439461_0029971 Ga0439461_0029971_147_632 123
458 3300041997 Ga0439431_0074536 Ga0439431_0074536_285_770 123
459 3300042435 Ga0439434_0154205 Ga0439434_0154205_133_636 123
460 3300044658 Ga0466972_0165246 Ga0466972_0165246_210_710 123
461 3300046472 Ga0495580_0009170 Ga0495580_0009170_1572_2045 123
462 3300046472 Ga0495580_0022039 Ga0495580_0022039_2756_3229 123
463 3300046472 Ga0495580_0175013 Ga0495580_0175013_658_1122 123
464 3300046473 Ga0495582_0006568 Ga0495582_0006568_2847_3353 123
465 3300046491 Ga0495584_0136507 Ga0495584_0136507_511_993 123
466 3300046517 Ga0495630_0071504 Ga0495630_0071504_1806_2279 123
467 3300046615 Ga0495656_0216134 Ga0495656_0216134_375_857 123
468 3300046681 Ga0495647_0197783 Ga0495647_0197783_167_640 123
469 3300047315 Ga0495581_0369673 Ga0495581_0369673_305_811 123
470 3300048088 Ga0495602_0215192 Ga0495602_0215192_320_793 123
471 3300048903 Ga0496100_0506089 Ga0496100_0506089_400_876 123
472 3300048904 Ga0496101_0011397 Ga0496101_0011397_598_1071 123
473 3300048904 Ga0496101_0735837 Ga0496101_0735837_245_721 123
474 3300048905 Ga0496102_0014004 Ga0496102_0014004_2995_3468 123
475 3300048905 Ga0496102_0106625 Ga0496102_0106625_543_1067 123
476 3300048905 Ga0496102_0620374 Ga0496102_0620374_452_928 123
477 3300048906 Ga0496103_0424819 Ga0496103_0424819_325_798 123
478 3300048907 Ga0496104_0018714 Ga0496104_0018714_1289_1762 123
479 3300048907 Ga0496104_0032194 Ga0496104_0032194_2745_3269 123
480 3300048907 Ga0496104_0178089 Ga0496104_0178089_1528_2010 123
481 3300048908 Ga0496105_0349177 Ga0496105_0349177_552_1076 123
482 3300048908 Ga0496105_0793399 Ga0496105_0793399_71_544 123
483 3300048909 Ga0496106_0001137 Ga0496106_0001137_8426_8908 123
484 3300048909 Ga0496106_0123669 Ga0496106_0123669_88_612 123
485 3300048909 Ga0496106_0243973 Ga0496106_0243973_840_1313 123
486 3300048910 Ga0496107_0018741 Ga0496107_0018741_2891_3373 123
487 3300048910 Ga0496107_0159965 Ga0496107_0159965_586_1110 123
488 3300048910 Ga0496107_0408659 Ga0496107_0408659_34_507 123
489 3300048911 Ga0496108_0002792 Ga0496108_0002792_2747_3220 123
490 3300048911 Ga0496108_0586159 Ga0496108_0586159_396_920 123
491 3300048912 Ga0496109_0105411 Ga0496109_0105411_1752_2225 123
492 3300048913 Ga0496110_0005157 Ga0496110_0005157_4418_4891 123
493 3300048914 Ga0496111_0026019 Ga0496111_0026019_72_545 123
494 3300048915 Ga0496112_0071456 Ga0496112_0071456_1280_1753 123
495 3300048916 Ga0496113_1069157 Ga0496113_1069157_117_593 123
496 3300048917 Ga0496114_0002917 Ga0496114_0002917_7731_8204 123
497 3300048918 Ga0496115_0300110 Ga0496115_0300110_74_598 123
498 3300048918 Ga0496115_0493534 Ga0496115_0493534_314_790 123
499 3300048918 Ga0496115_0786594 Ga0496115_0786594_197_670 123
500 3300049575 Ga0501039_1050420 Ga0501039_1050420_129_599 123
501 3300049578 Ga0501042_0220561 Ga0501042_0220561_110_586 123
502 3300049580 Ga0501046_0298183 Ga0501046_0298183_622_1092 123
503 3300049583 Ga0501067_0366250 Ga0501067_0366250_178_630 123
504 3300049584 Ga0501068_0773284 Ga0501068_0773284_52_504 123
505 3300049585 Ga0501069_0074469 Ga0501069_0074469_978_1430 123
506 3300049588 Ga0501072_0006568 Ga0501072_0006568_1721_2215 123
507 3300049590 Ga0501074_0161174 Ga0501074_0161174_1024_1476 123
508 3300049591 Ga0501075_0246793 Ga0501075_0246793_307_801 123
509 3300049591 Ga0501075_0650702 Ga0501075_0650702_161_637 123
510 3300049593 Ga0501077_0008045 Ga0501077_0008045_6012_6506 123
511 3300049593 Ga0501077_0241410 Ga0501077_0241410_660_1136 123
512 3300049593 Ga0501077_0703136 Ga0501077_0703136_110_568 123
513 3300049741 Ga0501079_0022509 Ga0501079_0022509_4129_4623 123
514 3300049741 Ga0501079_0911597 Ga0501079_0911597_212_673 123
515 3300049743 Ga0501081_0137691 Ga0501081_0137691_40_534 123
516 3300049823 Ga0501044_0220148 Ga0501044_0220148_509_970 123
517 3300050507 nmdc:mga05p37_194392_c1 nmdc:mga05p37_194392_c1_1570_2052 123
518 3300050511 nmdc:mga08y16_144400_c1 nmdc:mga08y16_144400_c1_1084_1566 123
519 3300050511 nmdc:mga08y16_497361_c1 nmdc:mga08y16_497361_c1_702_1166 123
520 3300050511 nmdc:mga08y16_971242_c1 nmdc:mga08y16_971242_c1_115_597 123
521 3300050512 nmdc:mga0n895_20730_c1 nmdc:mga0n895_20730_c1_5342_5824 123
522 3300050513 nmdc:mga0rr50_11164_c1 nmdc:mga0rr50_11164_c1_3662_4144 123
523 3300050514 nmdc:mga08x19_793967_c1 nmdc:mga08x19_793967_c1_130_603 123
524 3300050515 nmdc:mga0a205_4542_c1 nmdc:mga0a205_4542_c1_10670_11152 123
525 3300053078 Ga0495612_0358425 Ga0495612_0358425_110_583 123
526 iso_pu_bacteria 2855195626 2855198932 123
527 iso_pu_bacteria 2871272651 2871274366 123
528 iso_pu_bacteria 2900051742 2900052506 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

68

171

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9708 2 122
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9478 2 122
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9023 23 122
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9014 23 121
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.8985 23 122
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.948 2 122 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9257 2 122 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9039 23 122 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8888 20 121 3.30.300.20
af_Q55E30_8_160_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8714 20 123 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A0J1GHH4-F1-model_v4 Peroxiredoxin 0.9926 22 123
AF-A0A534GYJ0-F1-model_v4 OsmC family peroxiredoxin 0.9904 24 123
AF-A0A850STB2-F1-model_v4 OsmC family protein 0.9875 24 120
AF-A0A3C0PGU9-F1-model_v4 Osmotically inducible protein OsmC 0.9874 6 123
AF-A0A1F2TUU2-F1-model_v4 OsmC family protein 0.9864 39 122

Feature Viewer

pLDDT pTM Quality
95.87 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map