F459724
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 528 | 307 | 522 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0106625|Ga0496102_0106625_543_1067 |
| Length | 174 |
| Sequence | MRAIVQSPALCTEVNLMSGHDYHAGIRWERAGAVFTDNRYSRGHSWHFDGGVVVPASSSPHTVRVPLSVEAAVDPEEALVAALASCHMLWFLSLAAGARWCVDDYGDDAVGSMGRNAAGKIAMLSVTLRPRVRFCGERVPGREEILQLHERAHEECFIANSVTTTVHIEPVFDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 3 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 4 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 5 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 6 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 7 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 8 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 9 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 193 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 196 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 197 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 201 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 202 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 220 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 224 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 225 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 259 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 291 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 302 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 303 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 304 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 305 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 0.38 |
| Isolates | 1.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.22 |
| Nodule | 0 |
| Rhizoplane | 7.39 |
| Rhizosphere | 85.8 |
| Stem | 0 |
| Stem Tuber | 0.57 |
| Unclassified | 3.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_6351538 | 2162886012 | Unclassified | 1114 |
| 2 | JGI26129J50193_1001905 | 3300003349 | Unclassified | 1451 |
| 3 | Ga0006562J51391_1054345 | 3300003578 | Bacteria | 5760 |
| 4 | Ga0006562J51391_1054347 | 3300003578 | Bacteria | 9000 |
| 5 | JGI25404J52841_10025162 | 3300003659 | Bacteria | 1282 |
| 6 | Ga0055536_1025293 | 3300003781 | Bacteria | 1695 |
| 7 | Ga0055530_10000280 | 3300003791 | Bacteria | 46300 |
| 8 | Ga0055531_10000272 | 3300003794 | Bacteria | 53837 |
| 9 | JGI25405J52794_10018288 | 3300003911 | Bacteria | 1398 |
| 10 | Ga0065715_10766435 | 3300005293 | Unclassified | 592 |
| 11 | Ga0070676_10350093 | 3300005328 | Bacteria | 1015 |
| 12 | Ga0070683_100032711 | 3300005329 | Bacteria | 4738 |
| 13 | Ga0070690_100011991 | 3300005330 | Bacteria | 5086 |
| 14 | Ga0070690_100380155 | 3300005330 | Bacteria | 1032 |
| 15 | Ga0070690_101588097 | 3300005330 | Bacteria | 530 |
| 16 | Ga0070670_100120173 | 3300005331 | Bacteria | 2266 |
| 17 | Ga0068869_100468805 | 3300005334 | Bacteria | 1047 |
| 18 | Ga0070680_100002362 | 3300005336 | Bacteria | 13942 |
| 19 | Ga0070680_100235256 | 3300005336 | Bacteria | 1547 |
| 20 | Ga0070680_100396896 | 3300005336 | Unclassified | 1175 |
| 21 | Ga0068868_100014188 | 3300005338 | Bacteria | 5867 |
| 22 | Ga0070689_100000011 | 3300005340 | Bacteria | 218327 |
| 23 | Ga0070689_100107570 | 3300005340 | Bacteria | 2214 |
| 24 | Ga0070689_100200873 | 3300005340 | Bacteria | 1628 |
| 25 | Ga0070689_101416228 | 3300005340 | Bacteria | 628 |
| 26 | Ga0070691_10005070 | 3300005341 | Bacteria | 5986 |
| 27 | Ga0070691_10006759 | 3300005341 | Bacteria | 5249 |
| 28 | Ga0070691_10112410 | 3300005341 | Bacteria | 1364 |
| 29 | Ga0070687_100059099 | 3300005343 | Bacteria | 2017 |
| 30 | Ga0070692_10157318 | 3300005345 | Bacteria | 1299 |
| 31 | Ga0070668_100648964 | 3300005347 | Bacteria | 927 |
| 32 | Ga0070669_100388621 | 3300005353 | Bacteria | 1139 |
| 33 | Ga0070675_100199744 | 3300005354 | Bacteria | 1735 |
| 34 | Ga0070675_100338777 | 3300005354 | Bacteria | 1332 |
| 35 | Ga0070671_100111835 | 3300005355 | Bacteria | 2294 |
| 36 | Ga0070674_100402103 | 3300005356 | Bacteria | 1119 |
| 37 | Ga0070673_100032086 | 3300005364 | Bacteria | 3950 |
| 38 | Ga0070688_101320073 | 3300005365 | Bacteria | 583 |
| 39 | Ga0070667_100083577 | 3300005367 | Bacteria | 2735 |
| 40 | Ga0070703_10000733 | 3300005406 | Bacteria | 10968 |
| 41 | Ga0070703_10014361 | 3300005406 | Bacteria | 2256 |
| 42 | Ga0070709_10009350 | 3300005434 | Bacteria | 5404 |
| 43 | Ga0070709_10021319 | 3300005434 | Bacteria | 3772 |
| 44 | Ga0070714_100117083 | 3300005435 | Bacteria | 2366 |
| 45 | Ga0070713_100017059 | 3300005436 | Bacteria | 5479 |
| 46 | Ga0070713_100091569 | 3300005436 | Bacteria | 2616 |
| 47 | Ga0070710_10030501 | 3300005437 | Bacteria | 2901 |
| 48 | Ga0070701_10032368 | 3300005438 | Bacteria | 2603 |
| 49 | Ga0070701_10470786 | 3300005438 | Bacteria | 810 |
| 50 | Ga0070711_100009992 | 3300005439 | Bacteria | 5855 |
| 51 | Ga0070711_100120916 | 3300005439 | Bacteria | 1937 |
| 52 | Ga0070705_100000284 | 3300005440 | Bacteria | 30207 |
| 53 | Ga0070700_100033576 | 3300005441 | Bacteria | 3091 |
| 54 | Ga0070700_100048885 | 3300005441 | Bacteria | 2623 |
| 55 | Ga0070700_100301653 | 3300005441 | Bacteria | 1169 |
| 56 | Ga0070694_100036925 | 3300005444 | Bacteria | 3238 |
| 57 | Ga0070694_100092843 | 3300005444 | Bacteria | 2121 |
| 58 | Ga0070694_100484218 | 3300005444 | Bacteria | 982 |
| 59 | Ga0070708_100018075 | 3300005445 | Bacteria | 5897 |
| 60 | Ga0070708_100051172 | 3300005445 | Bacteria | 3659 |
| 61 | Ga0070663_100005804 | 3300005455 | Bacteria | 7374 |
| 62 | Ga0070663_100992992 | 3300005455 | Unclassified | 729 |
| 63 | Ga0070678_100517354 | 3300005456 | Bacteria | 1055 |
| 64 | Ga0070681_10063222 | 3300005458 | Bacteria | 3674 |
| 65 | Ga0068867_100181206 | 3300005459 | Bacteria | 1675 |
| 66 | Ga0070706_100296292 | 3300005467 | Bacteria | 1509 |
| 67 | Ga0070706_100793944 | 3300005467 | Bacteria | 876 |
| 68 | Ga0070707_100370675 | 3300005468 | Bacteria | 1391 |
| 69 | Ga0070707_100548255 | 3300005468 | Bacteria | 1118 |
| 70 | Ga0070698_100086413 | 3300005471 | Bacteria | 3122 |
| 71 | Ga0070698_100149590 | 3300005471 | Bacteria | 2283 |
| 72 | Ga0070699_100000768 | 3300005518 | Bacteria | 29617 |
| 73 | Ga0070679_100482240 | 3300005530 | Bacteria | 1184 |
| 74 | Ga0070697_100047248 | 3300005536 | Bacteria | 3491 |
| 75 | Ga0068853_100177179 | 3300005539 | Bacteria | 1932 |
| 76 | Ga0070695_100001812 | 3300005545 | Bacteria | 12065 |
| 77 | Ga0070695_100010490 | 3300005545 | Bacteria | 5532 |
| 78 | Ga0070695_100217039 | 3300005545 | Bacteria | 1376 |
| 79 | Ga0070695_100366258 | 3300005545 | Bacteria | 1084 |
| 80 | Ga0070696_100000069 | 3300005546 | Bacteria | 49879 |
| 81 | Ga0070696_100709605 | 3300005546 | Bacteria | 821 |
| 82 | Ga0070693_100005191 | 3300005547 | Bacteria | 6231 |
| 83 | Ga0070693_100472286 | 3300005547 | Bacteria | 884 |
| 84 | Ga0070665_100054884 | 3300005548 | Bacteria | 3995 |
| 85 | Ga0070665_100875280 | 3300005548 | Bacteria | 911 |
| 86 | Ga0070704_100000106 | 3300005549 | Bacteria | 29134 |
| 87 | Ga0070704_100013495 | 3300005549 | Bacteria | 5070 |
| 88 | Ga0070704_100082585 | 3300005549 | Bacteria | 2369 |
| 89 | Ga0070704_100266865 | 3300005549 | Bacteria | 1412 |
| 90 | Ga0070704_101046474 | 3300005549 | Bacteria | 740 |
| 91 | Ga0068855_100000841 | 3300005563 | Bacteria | 38036 |
| 92 | Ga0068855_101004420 | 3300005563 | Bacteria | 876 |
| 93 | Ga0068857_100089742 | 3300005577 | Bacteria | 2750 |
| 94 | Ga0068854_100516717 | 3300005578 | Bacteria | 1008 |
| 95 | Ga0068856_100007946 | 3300005614 | Bacteria | 10358 |
| 96 | Ga0068856_100564914 | 3300005614 | Bacteria | 1159 |
| 97 | Ga0070702_100045769 | 3300005615 | Bacteria | 2477 |
| 98 | Ga0070702_101242140 | 3300005615 | Bacteria | 602 |
| 99 | Ga0068859_100006391 | 3300005617 | Bacteria | 11957 |
| 100 | Ga0068859_100166573 | 3300005617 | Bacteria | 2284 |
| 101 | Ga0068864_101080053 | 3300005618 | Bacteria | 798 |
| 102 | Ga0068866_10006416 | 3300005718 | Bacteria | 4899 |
| 103 | Ga0068861_100031033 | 3300005719 | Bacteria | 3921 |
| 104 | Ga0068861_100056703 | 3300005719 | Bacteria | 2991 |
| 105 | Ga0068861_100150729 | 3300005719 | Bacteria | 1908 |
| 106 | Ga0068861_100495113 | 3300005719 | Bacteria | 1104 |
| 107 | Ga0068851_10646043 | 3300005834 | Bacteria | 647 |
| 108 | Ga0068863_100037461 | 3300005841 | Bacteria | 4618 |
| 109 | Ga0068863_100787484 | 3300005841 | Bacteria | 948 |
| 110 | Ga0068858_100006896 | 3300005842 | Bacteria | 11045 |
| 111 | Ga0068858_100871162 | 3300005842 | Unclassified | 880 |
| 112 | Ga0068860_100027650 | 3300005843 | Bacteria | 5461 |
| 113 | Ga0068860_100121452 | 3300005843 | Bacteria | 2502 |
| 114 | Ga0068862_100007239 | 3300005844 | Bacteria | 9213 |
| 115 | Ga0068862_100055700 | 3300005844 | Bacteria | 3387 |
| 116 | Ga0081455_10000073 | 3300005937 | Bacteria | 107386 |
| 117 | Ga0081455_10249840 | 3300005937 | Bacteria | 1298 |
| 118 | Ga0081455_10329614 | 3300005937 | Bacteria | 1084 |
| 119 | Ga0081540_1000012 | 3300005983 | Bacteria | 189939 |
| 120 | Ga0070717_10165908 | 3300006028 | Bacteria | 1918 |
| 121 | Ga0070717_10773786 | 3300006028 | Bacteria | 873 |
| 122 | Ga0070715_10003085 | 3300006163 | Bacteria | 5225 |
| 123 | Ga0070716_100002028 | 3300006173 | Bacteria | 9253 |
| 124 | Ga0070716_100018496 | 3300006173 | Bacteria | 3632 |
| 125 | Ga0070716_100086486 | 3300006173 | Bacteria | 1886 |
| 126 | Ga0070712_100131203 | 3300006175 | Bacteria | 1899 |
| 127 | Ga0097621_100150981 | 3300006237 | Bacteria | 1992 |
| 128 | Ga0075370_10105462 | 3300006353 | Bacteria | 1634 |
| 129 | Ga0068871_100033343 | 3300006358 | Bacteria | 4077 |
| 130 | Ga0075428_100025030 | 3300006844 | Bacteria | 6603 |
| 131 | Ga0075428_100032484 | 3300006844 | Bacteria | 5765 |
| 132 | Ga0075428_100034965 | 3300006844 | Bacteria | 5539 |
| 133 | Ga0075430_100096586 | 3300006846 | Bacteria | 2469 |
| 134 | Ga0075433_10002093 | 3300006852 | Bacteria | 15108 |
| 135 | Ga0075433_10187301 | 3300006852 | Bacteria | 1841 |
| 136 | Ga0075434_100010143 | 3300006871 | Bacteria | 8824 |
| 137 | Ga0075429_100045458 | 3300006880 | Bacteria | 3820 |
| 138 | Ga0075429_100074337 | 3300006880 | Unclassified | 2960 |
| 139 | Ga0075429_100100565 | 3300006880 | Bacteria | 2524 |
| 140 | Ga0068865_100002839 | 3300006881 | Bacteria | 10317 |
| 141 | Ga0068865_100184968 | 3300006881 | Bacteria | 1607 |
| 142 | Ga0075436_100399717 | 3300006914 | Bacteria | 995 |
| 143 | Ga0075436_100862035 | 3300006914 | Bacteria | 676 |
| 144 | Ga0097620_100006391 | 3300006931 | Bacteria | 11957 |
| 145 | Ga0097620_100166582 | 3300006931 | Bacteria | 2284 |
| 146 | Ga0075435_100067092 | 3300007076 | Bacteria | 2921 |
| 147 | Ga0075435_101124345 | 3300007076 | Bacteria | 687 |
| 148 | Ga0099795_10044358 | 3300007788 | Bacteria | 1594 |
| 149 | Ga0105240_10002990 | 3300009093 | Bacteria | 26593 |
| 150 | Ga0105240_10035330 | 3300009093 | Bacteria | 6442 |
| 151 | Ga0105240_10148984 | 3300009093 | Bacteria | 2789 |
| 152 | Ga0111539_10002283 | 3300009094 | Bacteria | 25507 |
| 153 | Ga0111539_10034157 | 3300009094 | Bacteria | 6171 |
| 154 | Ga0111539_10045732 | 3300009094 | Bacteria | 5239 |
| 155 | Ga0111539_10116944 | 3300009094 | Bacteria | 3126 |
| 156 | Ga0111539_10533926 | 3300009094 | Unclassified | 1367 |
| 157 | Ga0111539_11501496 | 3300009094 | Bacteria | 781 |
| 158 | Ga0105245_10180079 | 3300009098 | Bacteria | 2019 |
| 159 | Ga0105245_11055753 | 3300009098 | Unclassified | 858 |
| 160 | Ga0114129_10043906 | 3300009147 | Bacteria | 6289 |
| 161 | Ga0114129_10294858 | 3300009147 | Bacteria | 2163 |
| 162 | Ga0114129_10344904 | 3300009147 | Bacteria | 1974 |
| 163 | Ga0105243_10348467 | 3300009148 | Bacteria | 1359 |
| 164 | Ga0105241_10015195 | 3300009174 | Bacteria | 5638 |
| 165 | Ga0105241_10550368 | 3300009174 | Bacteria | 1036 |
| 166 | Ga0105242_10003054 | 3300009176 | Bacteria | 13084 |
| 167 | Ga0105242_11217696 | 3300009176 | Bacteria | 773 |
| 168 | Ga0105248_10068030 | 3300009177 | Bacteria | 3999 |
| 169 | Ga0105248_10427077 | 3300009177 | Bacteria | 1492 |
| 170 | Ga0105248_11691988 | 3300009177 | Unclassified | 717 |
| 171 | Ga0105237_10015924 | 3300009545 | Bacteria | 7818 |
| 172 | Ga0105237_10058478 | 3300009545 | Bacteria | 3858 |
| 173 | Ga0105237_10192883 | 3300009545 | Bacteria | 2037 |
| 174 | Ga0105237_10594966 | 3300009545 | Bacteria | 1113 |
| 175 | Ga0105238_11047208 | 3300009551 | Bacteria | 838 |
| 176 | Ga0105238_11107305 | 3300009551 | Bacteria | 815 |
| 177 | Ga0105249_10006176 | 3300009553 | Bacteria | 10393 |
| 178 | Ga0105249_11507958 | 3300009553 | Unclassified | 745 |
| 179 | Ga0105239_10017734 | 3300010375 | Bacteria | 7877 |
| 180 | Ga0105246_10082098 | 3300011119 | Bacteria | 2300 |
| 181 | Ga0157371_10005714 | 3300013102 | Bacteria | 10429 |
| 182 | Ga0157370_10025208 | 3300013104 | Bacteria | 5887 |
| 183 | Ga0157370_10393895 | 3300013104 | Bacteria | 1275 |
| 184 | Ga0157369_10028764 | 3300013105 | Bacteria | 6147 |
| 185 | Ga0157369_11026174 | 3300013105 | Bacteria | 844 |
| 186 | Ga0157374_10013397 | 3300013296 | Bacteria | 7159 |
| 187 | Ga0157374_10165413 | 3300013296 | Unclassified | 2155 |
| 188 | Ga0157374_11156383 | 3300013296 | Unclassified | 795 |
| 189 | Ga0157378_10010285 | 3300013297 | Bacteria | 8169 |
| 190 | Ga0157378_10063482 | 3300013297 | Bacteria | 3300 |
| 191 | Ga0163162_10223584 | 3300013306 | Bacteria | 2012 |
| 192 | Ga0163162_10585067 | 3300013306 | Bacteria | 1243 |
| 193 | Ga0163162_10857573 | 3300013306 | Bacteria | 1023 |
| 194 | Ga0157372_10148341 | 3300013307 | Bacteria | 2705 |
| 195 | Ga0157372_10569764 | 3300013307 | Bacteria | 1320 |
| 196 | Ga0157375_10010032 | 3300013308 | Bacteria | 8326 |
| 197 | Ga0157375_10930122 | 3300013308 | Bacteria | 1012 |
| 198 | Ga0163163_10022026 | 3300014325 | Bacteria | 6025 |
| 199 | Ga0163163_10940511 | 3300014325 | Bacteria | 928 |
| 200 | Ga0157380_10000142 | 3300014326 | Bacteria | 40538 |
| 201 | Ga0157380_10003693 | 3300014326 | Bacteria | 10530 |
| 202 | Ga0157380_10130561 | 3300014326 | Bacteria | 2142 |
| 203 | Ga0157380_11278847 | 3300014326 | Bacteria | 780 |
| 204 | Ga0157379_10021504 | 3300014968 | Bacteria | 5710 |
| 205 | Ga0157376_11592602 | 3300014969 | Unclassified | 687 |
| 206 | Ga0213872_10271585 | 3300021361 | Bacteria | 710 |
| 207 | Ga0213874_10045308 | 3300021377 | Bacteria | 1331 |
| 208 | Ga0213876_10399662 | 3300021384 | Bacteria | 731 |
| 209 | Ga0209676_1003926 | 3300025292 | Bacteria | 8618 |
| 210 | Ga0209676_1005157 | 3300025292 | Bacteria | 6948 |
| 211 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 212 | Ga0209257_1000104 | 3300025304 | Bacteria | 245648 |
| 213 | Ga0207653_10001256 | 3300025885 | Bacteria | 8267 |
| 214 | Ga0207692_10638421 | 3300025898 | Bacteria | 687 |
| 215 | Ga0207642_10016203 | 3300025899 | Bacteria | 2801 |
| 216 | Ga0207685_10004502 | 3300025905 | Bacteria | 3554 |
| 217 | Ga0207685_10087978 | 3300025905 | Bacteria | 1301 |
| 218 | Ga0207685_10241103 | 3300025905 | Bacteria | 870 |
| 219 | Ga0207699_10004243 | 3300025906 | Bacteria | 6860 |
| 220 | Ga0207699_10010634 | 3300025906 | Bacteria | 4627 |
| 221 | Ga0207645_10737792 | 3300025907 | Unclassified | 670 |
| 222 | Ga0207643_10472168 | 3300025908 | Bacteria | 800 |
| 223 | Ga0207684_10164992 | 3300025910 | Bacteria | 1908 |
| 224 | Ga0207654_10207002 | 3300025911 | Bacteria | 1295 |
| 225 | Ga0207707_10035970 | 3300025912 | Bacteria | 4330 |
| 226 | Ga0207695_10000337 | 3300025913 | Bacteria | 110325 |
| 227 | Ga0207695_10008085 | 3300025913 | Bacteria | 13232 |
| 228 | Ga0207695_10293343 | 3300025913 | Bacteria | 1518 |
| 229 | Ga0207671_10010144 | 3300025914 | Bacteria | 7805 |
| 230 | Ga0207671_10154662 | 3300025914 | Bacteria | 1773 |
| 231 | Ga0207693_10000021 | 3300025915 | Bacteria | 128800 |
| 232 | Ga0207693_10034274 | 3300025915 | Bacteria | 4005 |
| 233 | Ga0207693_10258163 | 3300025915 | Bacteria | 1366 |
| 234 | Ga0207663_10120603 | 3300025916 | Bacteria | 1795 |
| 235 | Ga0207663_10942570 | 3300025916 | Bacteria | 691 |
| 236 | Ga0207660_10012476 | 3300025917 | Bacteria | 5561 |
| 237 | Ga0207660_10184384 | 3300025917 | Bacteria | 1622 |
| 238 | Ga0207662_10111162 | 3300025918 | Bacteria | 1708 |
| 239 | Ga0207652_10421141 | 3300025921 | Bacteria | 1204 |
| 240 | Ga0207646_10123114 | 3300025922 | Bacteria | 2331 |
| 241 | Ga0207646_10199377 | 3300025922 | Bacteria | 1808 |
| 242 | Ga0207659_10293970 | 3300025926 | Bacteria | 1332 |
| 243 | Ga0207687_10889820 | 3300025927 | Bacteria | 762 |
| 244 | Ga0207700_10003126 | 3300025928 | Bacteria | 9560 |
| 245 | Ga0207700_10176409 | 3300025928 | Bacteria | 1786 |
| 246 | Ga0207700_10414223 | 3300025928 | Bacteria | 1183 |
| 247 | Ga0207664_10118208 | 3300025929 | Bacteria | 2214 |
| 248 | Ga0207706_10790118 | 3300025933 | Bacteria | 807 |
| 249 | Ga0207686_10017032 | 3300025934 | Bacteria | 4086 |
| 250 | Ga0207709_10150875 | 3300025935 | Bacteria | 1609 |
| 251 | Ga0207670_10000005 | 3300025936 | Bacteria | 431451 |
| 252 | Ga0207669_11957301 | 3300025937 | Bacteria | 501 |
| 253 | Ga0207704_10070409 | 3300025938 | Bacteria | 2214 |
| 254 | Ga0207704_10242607 | 3300025938 | Bacteria | 1347 |
| 255 | Ga0207704_10421037 | 3300025938 | Bacteria | 1059 |
| 256 | Ga0207665_10003946 | 3300025939 | Bacteria | 9930 |
| 257 | Ga0207665_10007972 | 3300025939 | Bacteria | 6992 |
| 258 | Ga0207665_10018176 | 3300025939 | Bacteria | 4620 |
| 259 | Ga0207665_10455296 | 3300025939 | Bacteria | 983 |
| 260 | Ga0207691_10910085 | 3300025940 | Unclassified | 736 |
| 261 | Ga0207711_10080886 | 3300025941 | Bacteria | 2838 |
| 262 | Ga0207689_10043467 | 3300025942 | Bacteria | 3714 |
| 263 | Ga0207689_10088670 | 3300025942 | Bacteria | 2541 |
| 264 | Ga0207689_10647758 | 3300025942 | Unclassified | 890 |
| 265 | Ga0207667_10000839 | 3300025949 | Bacteria | 39670 |
| 266 | Ga0207667_10157339 | 3300025949 | Bacteria | 2338 |
| 267 | Ga0207712_10006325 | 3300025961 | Bacteria | 7469 |
| 268 | Ga0207668_11420122 | 3300025972 | Bacteria | 626 |
| 269 | Ga0207640_10613645 | 3300025981 | Bacteria | 922 |
| 270 | Ga0207658_10206398 | 3300025986 | Bacteria | 1644 |
| 271 | Ga0207677_10024915 | 3300026023 | Bacteria | 3725 |
| 272 | Ga0207677_11523605 | 3300026023 | Unclassified | 618 |
| 273 | Ga0207678_10009050 | 3300026067 | Bacteria | 8768 |
| 274 | Ga0207678_10595335 | 3300026067 | Unclassified | 969 |
| 275 | Ga0207708_10013400 | 3300026075 | Bacteria | 6127 |
| 276 | Ga0207708_10044894 | 3300026075 | Bacteria | 3368 |
| 277 | Ga0207708_10079688 | 3300026075 | Bacteria | 2516 |
| 278 | Ga0207648_10226245 | 3300026089 | Bacteria | 1663 |
| 279 | Ga0207676_10113299 | 3300026095 | Bacteria | 2273 |
| 280 | Ga0207676_10425742 | 3300026095 | Bacteria | 1246 |
| 281 | Ga0207674_10002834 | 3300026116 | Bacteria | 21561 |
| 282 | Ga0207674_10030437 | 3300026116 | Bacteria | 5674 |
| 283 | Ga0207675_100098480 | 3300026118 | Bacteria | 2754 |
| 284 | Ga0207675_100222858 | 3300026118 | Bacteria | 1817 |
| 285 | Ga0207675_100418937 | 3300026118 | Bacteria | 1322 |
| 286 | Ga0209966_1028173 | 3300027695 | Unclassified | 1127 |
| 287 | Ga0209974_10154688 | 3300027876 | Bacteria | 829 |
| 288 | Ga0209974_10304664 | 3300027876 | Bacteria | 610 |
| 289 | Ga0207428_10013153 | 3300027907 | Bacteria | 7245 |
| 290 | Ga0207428_10026428 | 3300027907 | Bacteria | 4845 |
| 291 | Ga0207428_10083959 | 3300027907 | Unclassified | 2483 |
| 292 | Ga0268266_10813537 | 3300028379 | Bacteria | 903 |
| 293 | Ga0268265_10507479 | 3300028380 | Bacteria | 1137 |
| 294 | Ga0268264_10041465 | 3300028381 | Bacteria | 3808 |
| 295 | Ga0268264_10053778 | 3300028381 | Bacteria | 3360 |
| 296 | Ga0268264_10239157 | 3300028381 | Bacteria | 1681 |
| 297 | Ga0265330_10089703 | 3300031235 | Bacteria | 1320 |
| 298 | Ga0265330_10107961 | 3300031235 | Bacteria | 1190 |
| 299 | Ga0265325_10025264 | 3300031241 | Bacteria | 3226 |
| 300 | Ga0265325_10046926 | 3300031241 | Bacteria | 2238 |
| 301 | Ga0265340_10006325 | 3300031247 | Bacteria | 6528 |
| 302 | Ga0265327_10096175 | 3300031251 | Bacteria | 1436 |
| 303 | Ga0307408_100218508 | 3300031548 | Bacteria | 1554 |
| 304 | Ga0307408_100278591 | 3300031548 | Bacteria | 1392 |
| 305 | Ga0307408_100610925 | 3300031548 | Bacteria | 970 |
| 306 | Ga0307408_100784699 | 3300031548 | Bacteria | 863 |
| 307 | Ga0307405_10001231 | 3300031731 | Bacteria | 10649 |
| 308 | Ga0307405_10106559 | 3300031731 | Unclassified | 1891 |
| 309 | Ga0307413_10451884 | 3300031824 | Bacteria | 1020 |
| 310 | Ga0307410_10001551 | 3300031852 | Bacteria | 10471 |
| 311 | Ga0307410_10064168 | 3300031852 | Bacteria | 2523 |
| 312 | Ga0307410_10490010 | 3300031852 | Bacteria | 1010 |
| 313 | Ga0307406_10110187 | 3300031901 | Bacteria | 1894 |
| 314 | Ga0307406_10343599 | 3300031901 | Bacteria | 1163 |
| 315 | Ga0307407_10001320 | 3300031903 | Bacteria | 8869 |
| 316 | Ga0307407_10881685 | 3300031903 | Unclassified | 685 |
| 317 | Ga0307407_10950548 | 3300031903 | Bacteria | 662 |
| 318 | Ga0307412_10031627 | 3300031911 | Bacteria | 3344 |
| 319 | Ga0307412_10221343 | 3300031911 | Unclassified | 1451 |
| 320 | Ga0307412_10858719 | 3300031911 | Bacteria | 792 |
| 321 | Ga0307409_100003494 | 3300031995 | Bacteria | 8552 |
| 322 | Ga0307416_100004185 | 3300032002 | Bacteria | 8649 |
| 323 | Ga0307416_100216071 | 3300032002 | Bacteria | 1834 |
| 324 | Ga0307416_100609050 | 3300032002 | Bacteria | 1173 |
| 325 | Ga0307414_10009925 | 3300032004 | Bacteria | 5493 |
| 326 | Ga0307414_10018722 | 3300032004 | Bacteria | 4272 |
| 327 | Ga0307414_10074417 | 3300032004 | Bacteria | 2461 |
| 328 | Ga0307414_10402507 | 3300032004 | Bacteria | 1189 |
| 329 | Ga0307414_11349426 | 3300032004 | Bacteria | 662 |
| 330 | Ga0307411_10081123 | 3300032005 | Bacteria | 2233 |
| 331 | Ga0307411_10245484 | 3300032005 | Unclassified | 1404 |
| 332 | Ga0307411_10653185 | 3300032005 | Bacteria | 911 |
| 333 | Ga0307415_100001394 | 3300032126 | Bacteria | 11528 |
| 334 | Ga0307507_10036380 | 3300033179 | Bacteria | 5033 |
| 335 | Ga0373950_0012372 | 3300034818 | Bacteria | 1408 |
| 336 | Ga0373959_0012862 | 3300034820 | Bacteria | 1501 |
| 337 | Ga0373959_0146225 | 3300034820 | Bacteria | 595 |
| 338 | Ga0373938_0005277 | 3300034957 | Bacteria | 2194 |
| 339 | Ga0373929_0009989 | 3300035085 | Bacteria | 1767 |
| 340 | Ga0373940_0005921 | 3300035088 | Bacteria | 2681 |
| 341 | Ga0373951_0028523 | 3300035091 | Bacteria | 1308 |
| 342 | Ga0373952_0010720 | 3300035092 | Bacteria | 1776 |
| 343 | Ga0373936_0128619 | 3300035113 | Bacteria | 1087 |
| 344 | Ga0373939_0001557 | 3300035114 | Bacteria | 5572 |
| 345 | Ga0373939_0036720 | 3300035114 | Bacteria | 1451 |
| 346 | Ga0373941_0005359 | 3300035115 | Bacteria | 3013 |
| 347 | Ga0373941_0014186 | 3300035115 | Bacteria | 2123 |
| 348 | Ga0373941_0015541 | 3300035115 | Bacteria | 2055 |
| 349 | Ga0373956_0348245 | 3300035119 | Bacteria | 706 |
| 350 | Ga0373960_0032156 | 3300035121 | Bacteria | 1472 |
| 351 | Ga0373943_0074331 | 3300035170 | Bacteria | 1728 |
| 352 | Ga0373955_0089635 | 3300035172 | Bacteria | 1751 |
| 353 | Ga0373942_0020729 | 3300035207 | Bacteria | 1653 |
| 354 | Ga0373961_0200694 | 3300035241 | Unclassified | 703 |
| 355 | Ga0373962_0016607 | 3300035242 | Bacteria | 1900 |
| 356 | Ga0373962_0039955 | 3300035242 | Bacteria | 1318 |
| 357 | Ga0373931_0001216 | 3300035691 | Bacteria | 11014 |
| 358 | Ga0373931_0002067 | 3300035691 | Bacteria | 8832 |
| 359 | Ga0373931_0006105 | 3300035691 | Bacteria | 5614 |
| 360 | Ga0373935_0660690 | 3300035692 | Bacteria | 767 |
| 361 | Ga0373927_0030590 | 3300035695 | Bacteria | 3512 |
| 362 | Ga0373927_0045041 | 3300035695 | Bacteria | 2854 |
| 363 | Ga0373933_0081009 | 3300035724 | Bacteria | 1991 |
| 364 | Ga0373937_0240389 | 3300036401 | Bacteria | 1706 |
| 365 | Ga0373937_1417663 | 3300036401 | Bacteria | 642 |
| 366 | Ga0373937_1425481 | 3300036401 | Unclassified | 640 |
| 367 | Ga0436365_0494227 | 3300039437 | Bacteria | 518 |
| 368 | Ga0436365_1036200 | 3300039437 | Bacteria | 929 |
| 369 | Ga0436360_1062673 | 3300039438 | Bacteria | 4036 |
| 370 | Ga0436361_0176955 | 3300039447 | Bacteria | 812 |
| 371 | Ga0436361_0333953 | 3300039447 | Bacteria | 2161 |
| 372 | Ga0436361_0739818 | 3300039447 | Bacteria | 919 |
| 373 | Ga0436363_0403659 | 3300039450 | Bacteria | 1023 |
| 374 | Ga0436363_0802390 | 3300039450 | Bacteria | 3272 |
| 375 | Ga0439461_0029971 | 3300041410 | Bacteria | 1129 |
| 376 | Ga0451791_1874268 | 3300041451 | Bacteria | 581 |
| 377 | Ga0451797_1101137 | 3300041453 | Bacteria | 725 |
| 378 | Ga0451807_0883340 | 3300041486 | Bacteria | 569 |
| 379 | Ga0451837_0505302 | 3300041494 | Bacteria | 683 |
| 380 | Ga0439431_0074536 | 3300041997 | Bacteria | 908 |
| 381 | Ga0439434_0154205 | 3300042435 | Bacteria | 761 |
| 382 | Ga0451577_0012825 | 3300042876 | Bacteria | 7867 |
| 383 | Ga0466972_0048368 | 3300044658 | Bacteria | 2055 |
| 384 | Ga0466972_0165246 | 3300044658 | Bacteria | 1039 |
| 385 | Ga0466957_0007291 | 3300044842 | Bacteria | 6249 |
| 386 | Ga0495638_0174870 | 3300046460 | Bacteria | 1229 |
| 387 | Ga0495653_0554111 | 3300046463 | Unclassified | 711 |
| 388 | Ga0495580_0009170 | 3300046472 | Bacteria | 7800 |
| 389 | Ga0495580_0022039 | 3300046472 | Bacteria | 4694 |
| 390 | Ga0495580_0175013 | 3300046472 | Bacteria | 1483 |
| 391 | Ga0495582_0006568 | 3300046473 | Bacteria | 6454 |
| 392 | Ga0495662_0213897 | 3300046476 | Bacteria | 950 |
| 393 | Ga0495584_0136507 | 3300046491 | Bacteria | 1245 |
| 394 | Ga0495630_0071504 | 3300046517 | Bacteria | 2611 |
| 395 | Ga0495656_0216134 | 3300046615 | Bacteria | 957 |
| 396 | Ga0495659_0148464 | 3300046664 | Bacteria | 940 |
| 397 | Ga0495647_0197783 | 3300046681 | Bacteria | 881 |
| 398 | Ga0495649_0004033 | 3300046694 | Bacteria | 9668 |
| 399 | Ga0495581_0369673 | 3300047315 | Bacteria | 837 |
| 400 | Ga0495602_0215192 | 3300048088 | Bacteria | 1455 |
| 401 | Ga0496100_0506089 | 3300048903 | Unclassified | 931 |
| 402 | Ga0496101_0011397 | 3300048904 | Bacteria | 5898 |
| 403 | Ga0496101_0086578 | 3300048904 | Bacteria | 2324 |
| 404 | Ga0496101_0735837 | 3300048904 | Unclassified | 778 |
| 405 | Ga0496102_0014004 | 3300048905 | Bacteria | 6964 |
| 406 | Ga0496102_0106625 | 3300048905 | Bacteria | 2608 |
| 407 | Ga0496102_0620374 | 3300048905 | Bacteria | 1004 |
| 408 | Ga0496103_0424819 | 3300048906 | Bacteria | 853 |
| 409 | Ga0496104_0018714 | 3300048907 | Bacteria | 6321 |
| 410 | Ga0496104_0032194 | 3300048907 | Bacteria | 4880 |
| 411 | Ga0496104_0059634 | 3300048907 | Bacteria | 3613 |
| 412 | Ga0496104_0178089 | 3300048907 | Bacteria | 2036 |
| 413 | Ga0496104_0284878 | 3300048907 | Bacteria | 1565 |
| 414 | Ga0496105_0024718 | 3300048908 | Bacteria | 4883 |
| 415 | Ga0496105_0349177 | 3300048908 | Bacteria | 1182 |
| 416 | Ga0496105_0793399 | 3300048908 | Bacteria | 720 |
| 417 | Ga0496105_0799478 | 3300048908 | Unclassified | 717 |
| 418 | Ga0496106_0001137 | 3300048909 | Bacteria | 19705 |
| 419 | Ga0496106_0123669 | 3300048909 | Bacteria | 2024 |
| 420 | Ga0496106_0243973 | 3300048909 | Bacteria | 1435 |
| 421 | Ga0496107_0018741 | 3300048910 | Bacteria | 4877 |
| 422 | Ga0496107_0077559 | 3300048910 | Bacteria | 2420 |
| 423 | Ga0496107_0159965 | 3300048910 | Bacteria | 1669 |
| 424 | Ga0496107_0408659 | 3300048910 | Bacteria | 1009 |
| 425 | Ga0496108_0002792 | 3300048911 | Bacteria | 13997 |
| 426 | Ga0496108_0586159 | 3300048911 | Bacteria | 972 |
| 427 | Ga0496109_0105411 | 3300048912 | Bacteria | 2618 |
| 428 | Ga0496110_0005157 | 3300048913 | Bacteria | 10214 |
| 429 | Ga0496111_0026019 | 3300048914 | Bacteria | 4129 |
| 430 | Ga0496112_0071456 | 3300048915 | Bacteria | 3430 |
| 431 | Ga0496112_0197717 | 3300048915 | Bacteria | 1971 |
| 432 | Ga0496113_1069157 | 3300048916 | Bacteria | 634 |
| 433 | Ga0496114_0002917 | 3300048917 | Bacteria | 13111 |
| 434 | Ga0496115_0300110 | 3300048918 | Bacteria | 1316 |
| 435 | Ga0496115_0493534 | 3300048918 | Bacteria | 985 |
| 436 | Ga0496115_0786594 | 3300048918 | Bacteria | 741 |
| 437 | Ga0496116_0028102 | 3300048919 | Bacteria | 4081 |
| 438 | Ga0496120_0101350 | 3300048923 | Bacteria | 1520 |
| 439 | Ga0496122_0002203 | 3300048925 | Bacteria | 28462 |
| 440 | Ga0496123_0001896 | 3300048926 | Bacteria | 27281 |
| 441 | Ga0496125_0000334 | 3300048928 | Bacteria | 90058 |
| 442 | Ga0501031_0007671 | 3300049568 | Bacteria | 7022 |
| 443 | Ga0501031_0762173 | 3300049568 | Bacteria | 621 |
| 444 | Ga0501032_0018113 | 3300049569 | Unclassified | 4938 |
| 445 | Ga0501034_0354991 | 3300049571 | Bacteria | 1394 |
| 446 | Ga0501036_0169692 | 3300049572 | Unclassified | 1838 |
| 447 | Ga0501037_0058527 | 3300049573 | Unclassified | 2812 |
| 448 | Ga0501037_0656436 | 3300049573 | Bacteria | 701 |
| 449 | Ga0501038_0012702 | 3300049574 | Bacteria | 7697 |
| 450 | Ga0501039_0011370 | 3300049575 | Bacteria | 6777 |
| 451 | Ga0501039_0111877 | 3300049575 | Bacteria | 2135 |
| 452 | Ga0501039_1050420 | 3300049575 | Bacteria | 632 |
| 453 | Ga0501040_0085206 | 3300049576 | Unclassified | 2193 |
| 454 | Ga0501040_0391215 | 3300049576 | Bacteria | 998 |
| 455 | Ga0501041_0000980 | 3300049577 | Bacteria | 15584 |
| 456 | Ga0501041_0416631 | 3300049577 | Unclassified | 852 |
| 457 | Ga0501042_0003599 | 3300049578 | Bacteria | 9772 |
| 458 | Ga0501042_0220561 | 3300049578 | Bacteria | 1368 |
| 459 | Ga0501042_0373089 | 3300049578 | Bacteria | 1033 |
| 460 | Ga0501046_0012783 | 3300049580 | Bacteria | 7141 |
| 461 | Ga0501046_0298183 | 3300049580 | Bacteria | 1178 |
| 462 | Ga0501048_0017654 | 3300049582 | Bacteria | 5252 |
| 463 | Ga0501067_0004605 | 3300049583 | Bacteria | 7634 |
| 464 | Ga0501067_0366250 | 3300049583 | Unclassified | 803 |
| 465 | Ga0501068_0773284 | 3300049584 | Unclassified | 629 |
| 466 | Ga0501069_0074469 | 3300049585 | Unclassified | 1905 |
| 467 | Ga0501071_0164598 | 3300049587 | Bacteria | 1659 |
| 468 | Ga0501072_0006568 | 3300049588 | Bacteria | 8855 |
| 469 | Ga0501072_0109473 | 3300049588 | Bacteria | 2199 |
| 470 | Ga0501073_1271411 | 3300049589 | Unclassified | 505 |
| 471 | Ga0501074_0161174 | 3300049590 | Unclassified | 1602 |
| 472 | Ga0501075_0246793 | 3300049591 | Bacteria | 1361 |
| 473 | Ga0501075_0650702 | 3300049591 | Bacteria | 803 |
| 474 | Ga0501075_0665850 | 3300049591 | Bacteria | 793 |
| 475 | Ga0501076_0019941 | 3300049592 | Bacteria | 5130 |
| 476 | Ga0501077_0008045 | 3300049593 | Bacteria | 6517 |
| 477 | Ga0501077_0127496 | 3300049593 | Bacteria | 1613 |
| 478 | Ga0501077_0241410 | 3300049593 | Bacteria | 1148 |
| 479 | Ga0501077_0703136 | 3300049593 | Bacteria | 650 |
| 480 | Ga0501079_0022509 | 3300049741 | Bacteria | 4833 |
| 481 | Ga0501079_0212515 | 3300049741 | Bacteria | 1511 |
| 482 | Ga0501079_0911597 | 3300049741 | Bacteria | 692 |
| 483 | Ga0501081_0042469 | 3300049743 | Unclassified | 3116 |
| 484 | Ga0501081_0137691 | 3300049743 | Bacteria | 1748 |
| 485 | Ga0501081_1258667 | 3300049743 | Unclassified | 561 |
| 486 | Ga0501035_0004444 | 3300049822 | Bacteria | 13307 |
| 487 | Ga0501044_0220148 | 3300049823 | Bacteria | 1849 |
| 488 | Ga0501044_0379164 | 3300049823 | Bacteria | 1329 |
| 489 | Ga0501044_1024764 | 3300049823 | Unclassified | 696 |
| 490 | Ga0501044_1505839 | 3300049823 | Bacteria | 538 |
| 491 | Ga0501045_0153272 | 3300049824 | Bacteria | 1715 |
| 492 | Ga0501045_0233249 | 3300049824 | Bacteria | 1370 |
| 493 | nmdc:mga07m45_770616_c1 | 3300050496 | Bacteria | 552 |
| 494 | nmdc:mga05p37_194392_c1 | 3300050507 | Bacteria | 2461 |
| 495 | nmdc:mga05p37_37700_c1 | 3300050507 | Bacteria | 5928 |
| 496 | nmdc:mga09592_191170_c1 | 3300050508 | Bacteria | 1772 |
| 497 | nmdc:mga0qj67_172172_c1 | 3300050509 | Bacteria | 1758 |
| 498 | nmdc:mga06r32_460025_c1 | 3300050510 | Bacteria | 1251 |
| 499 | nmdc:mga08y16_1023985_c1 | 3300050511 | Bacteria | 805 |
| 500 | nmdc:mga08y16_134749_c1 | 3300050511 | Bacteria | 2567 |
| 501 | nmdc:mga08y16_144400_c1 | 3300050511 | Bacteria | 2474 |
| 502 | nmdc:mga08y16_33758_c1 | 3300050511 | Bacteria | 5374 |
| 503 | nmdc:mga08y16_497361_c1 | 3300050511 | Bacteria | 1239 |
| 504 | nmdc:mga08y16_702339_c1 | 3300050511 | Unclassified | 1011 |
| 505 | nmdc:mga08y16_971242_c1 | 3300050511 | Bacteria | 831 |
| 506 | nmdc:mga0n895_20730_c1 | 3300050512 | Bacteria | 6136 |
| 507 | nmdc:mga0rr50_11164_c1 | 3300050513 | Bacteria | 5731 |
| 508 | nmdc:mga08x19_793967_c1 | 3300050514 | Bacteria | 672 |
| 509 | nmdc:mga0a205_4542_c1 | 3300050515 | Bacteria | 12457 |
| 510 | Ga0495612_0358425 | 3300053078 | Bacteria | 659 |
| 511 | Ga0500562_080202 | 3300053108 | Bacteria | 883 |
| 512 | Ga0500595_013733 | 3300053119 | Bacteria | 3097 |
| 513 | Ga0500652_087326 | 3300053131 | Bacteria | 1301 |
| 514 | Ga0500573_0040362 | 3300053140 | Bacteria | 2696 |
| 515 | Ga0500573_0073385 | 3300053140 | Bacteria | 1950 |
| 516 | Ga0500573_0079463 | 3300053140 | Bacteria | 1865 |
| 517 | Ga0500645_008548 | 3300053730 | Bacteria | 3489 |
| 518 | Ga0500645_034886 | 3300053730 | Bacteria | 1501 |
| 519 | Ga0501082_0000593 | 3300060353 | Bacteria | 31985 |
| 520 | Ga0501082_0222094 | 3300060353 | Bacteria | 1644 |
| 521 | Ga0501082_0236133 | 3300060353 | Bacteria | 1591 |
| 522 | Ga0530510_0014053 | 3300061734 | Bacteria | 5645 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10148984 | Ga0105240_101489842 | 110 |
| 2 | 3300025913 | Ga0207695_10000337 | Ga0207695_1000033719 | 110 |
| 3 | 3300049568 | Ga0501031_0007671 | Ga0501031_0007671_3716_4195 | 111 |
| 4 | 3300049569 | Ga0501032_0018113 | Ga0501032_0018113_3722_4201 | 111 |
| 5 | 3300049571 | Ga0501034_0354991 | Ga0501034_0354991_168_647 | 111 |
| 6 | 3300049572 | Ga0501036_0169692 | Ga0501036_0169692_308_787 | 111 |
| 7 | 3300049573 | Ga0501037_0058527 | Ga0501037_0058527_1505_1984 | 111 |
| 8 | 3300049574 | Ga0501038_0012702 | Ga0501038_0012702_397_876 | 111 |
| 9 | 3300049575 | Ga0501039_0011370 | Ga0501039_0011370_4567_5046 | 111 |
| 10 | 3300049576 | Ga0501040_0085206 | Ga0501040_0085206_663_1142 | 111 |
| 11 | 3300049577 | Ga0501041_0000980 | Ga0501041_0000980_8251_8730 | 111 |
| 12 | 3300049578 | Ga0501042_0003599 | Ga0501042_0003599_1340_1819 | 111 |
| 13 | 3300049580 | Ga0501046_0012783 | Ga0501046_0012783_5872_6351 | 111 |
| 14 | 3300049582 | Ga0501048_0017654 | Ga0501048_0017654_979_1458 | 111 |
| 15 | 3300049588 | Ga0501072_0109473 | Ga0501072_0109473_1043_1522 | 111 |
| 16 | 3300049592 | Ga0501076_0019941 | Ga0501076_0019941_3738_4217 | 111 |
| 17 | 3300049743 | Ga0501081_0042469 | Ga0501081_0042469_1475_1954 | 111 |
| 18 | 3300049822 | Ga0501035_0004444 | Ga0501035_0004444_10671_11150 | 111 |
| 19 | 3300049823 | Ga0501044_1024764 | Ga0501044_1024764_52_531 | 111 |
| 20 | 3300049824 | Ga0501045_0153272 | Ga0501045_0153272_739_1203 | 111 |
| 21 | 3300005331 | Ga0070670_100120173 | Ga0070670_1001201732 | 112 |
| 22 | 3300025940 | Ga0207691_10910085 | Ga0207691_109100851 | 112 |
| 23 | 3300060353 | Ga0501082_0000593 | Ga0501082_0000593_18969_19448 | 117 |
| 24 | 3300005330 | Ga0070690_100380155 | Ga0070690_1003801552 | 119 |
| 25 | 3300005354 | Ga0070675_100199744 | Ga0070675_1001997442 | 119 |
| 26 | 3300005438 | Ga0070701_10470786 | Ga0070701_104707861 | 119 |
| 27 | 3300005618 | Ga0068864_101080053 | Ga0068864_1010800532 | 119 |
| 28 | 3300013306 | Ga0163162_10857573 | Ga0163162_108575732 | 119 |
| 29 | 3300035115 | Ga0373941_0014186 | Ga0373941_0014186_1581_2018 | 119 |
| 30 | 3300035691 | Ga0373931_0002067 | Ga0373931_0002067_7209_7646 | 119 |
| 31 | 3300005563 | Ga0068855_101004420 | Ga0068855_1010044201 | 120 |
| 32 | 3300005834 | Ga0068851_10646043 | Ga0068851_106460431 | 120 |
| 33 | 3300006028 | Ga0070717_10773786 | Ga0070717_107737862 | 120 |
| 34 | 3300009098 | Ga0105245_11055753 | Ga0105245_110557531 | 120 |
| 35 | 3300009545 | Ga0105237_10058478 | Ga0105237_100584782 | 120 |
| 36 | 3300009551 | Ga0105238_11107305 | Ga0105238_111073052 | 120 |
| 37 | 3300013296 | Ga0157374_10165413 | Ga0157374_101654133 | 120 |
| 38 | 3300025914 | Ga0207671_10154662 | Ga0207671_101546622 | 120 |
| 39 | 3300025928 | Ga0207700_10414223 | Ga0207700_104142232 | 120 |
| 40 | 3300031241 | Ga0265325_10025264 | Ga0265325_100252642 | 120 |
| 41 | 3300031247 | Ga0265340_10006325 | Ga0265340_100063255 | 120 |
| 42 | 3300035724 | Ga0373933_0081009 | Ga0373933_0081009_1419_1805 | 120 |
| 43 | 3300036401 | Ga0373937_0240389 | Ga0373937_0240389_229_687 | 120 |
| 44 | 3300042876 | Ga0451577_0012825 | Ga0451577_0012825_241_711 | 120 |
| 45 | 3300044658 | Ga0466972_0048368 | Ga0466972_0048368_572_1018 | 120 |
| 46 | 3300048904 | Ga0496101_0086578 | Ga0496101_0086578_89_547 | 120 |
| 47 | 3300048907 | Ga0496104_0059634 | Ga0496104_0059634_2477_2935 | 120 |
| 48 | 3300048908 | Ga0496105_0799478 | Ga0496105_0799478_191_649 | 120 |
| 49 | 3300048910 | Ga0496107_0077559 | Ga0496107_0077559_1384_1842 | 120 |
| 50 | 3300049583 | Ga0501067_0004605 | Ga0501067_0004605_1406_1888 | 120 |
| 51 | 3300049591 | Ga0501075_0665850 | Ga0501075_0665850_318_779 | 120 |
| 52 | 3300049593 | Ga0501077_0127496 | Ga0501077_0127496_1140_1601 | 120 |
| 53 | 3300049824 | Ga0501045_0233249 | Ga0501045_0233249_444_905 | 120 |
| 54 | 3300053140 | Ga0500573_0079463 | Ga0500573_0079463_469_930 | 120 |
| 55 | 3300060353 | Ga0501082_0236133 | Ga0501082_0236133_683_1144 | 120 |
| 56 | 3300061734 | Ga0530510_0014053 | Ga0530510_0014053_4857_5318 | 120 |
| 57 | 3300003781 | Ga0055536_1025293 | Ga0055536_10252932 | 121 |
| 58 | 3300003791 | Ga0055530_10000280 | Ga0055530_1000028029 | 121 |
| 59 | 3300003794 | Ga0055531_10000272 | Ga0055531_1000027230 | 121 |
| 60 | 3300003911 | JGI25405J52794_10018288 | JGI25405J52794_100182882 | 121 |
| 61 | 3300005330 | Ga0070690_101588097 | Ga0070690_1015880971 | 121 |
| 62 | 3300005719 | Ga0068861_100150729 | Ga0068861_1001507293 | 121 |
| 63 | 3300005937 | Ga0081455_10000073 | Ga0081455_10000073101 | 121 |
| 64 | 3300006353 | Ga0075370_10105462 | Ga0075370_101054621 | 121 |
| 65 | 3300009147 | Ga0114129_10344904 | Ga0114129_103449042 | 121 |
| 66 | 3300009553 | Ga0105249_11507958 | Ga0105249_115079582 | 121 |
| 67 | 3300021384 | Ga0213876_10399662 | Ga0213876_103996621 | 121 |
| 68 | 3300025292 | Ga0209676_1003926 | Ga0209676_10039267 | 121 |
| 69 | 3300025292 | Ga0209676_1005157 | Ga0209676_10051574 | 121 |
| 70 | 3300025298 | Ga0209050_1000017 | Ga0209050_1000017196 | 121 |
| 71 | 3300025304 | Ga0209257_1000104 | Ga0209257_10001048 | 121 |
| 72 | 3300026118 | Ga0207675_100098480 | Ga0207675_1000984802 | 121 |
| 73 | 3300031903 | Ga0307407_10950548 | Ga0307407_109505481 | 121 |
| 74 | 3300032004 | Ga0307414_11349426 | Ga0307414_113494261 | 121 |
| 75 | 3300039437 | Ga0436365_0494227 | Ga0436365_0494227_27_491 | 121 |
| 76 | 3300039437 | Ga0436365_1036200 | Ga0436365_1036200_158_619 | 121 |
| 77 | 3300044842 | Ga0466957_0007291 | Ga0466957_0007291_886_1347 | 121 |
| 78 | 3300048923 | Ga0496120_0101350 | Ga0496120_0101350_813_1253 | 121 |
| 79 | 3300049577 | Ga0501041_0416631 | Ga0501041_0416631_173_628 | 121 |
| 80 | 3300050496 | nmdc:mga07m45_770616_c1 | nmdc:mga07m45_770616_c1_19_480 | 121 |
| 81 | 3300053108 | Ga0500562_080202 | Ga0500562_080202_243_707 | 121 |
| 82 | 3300053119 | Ga0500595_013733 | Ga0500595_013733_1847_2311 | 121 |
| 83 | 3300053131 | Ga0500652_087326 | Ga0500652_087326_497_964 | 121 |
| 84 | 3300053730 | Ga0500645_008548 | Ga0500645_008548_1168_1632 | 121 |
| 85 | 3300053730 | Ga0500645_034886 | Ga0500645_034886_683_1144 | 121 |
| 86 | 3300003578 | Ga0006562J51391_1054345 | Ga0006562J51391_10543458 | 122 |
| 87 | 3300003578 | Ga0006562J51391_1054347 | Ga0006562J51391_10543475 | 122 |
| 88 | 3300005328 | Ga0070676_10350093 | Ga0070676_103500932 | 122 |
| 89 | 3300005334 | Ga0068869_100468805 | Ga0068869_1004688052 | 122 |
| 90 | 3300005336 | Ga0070680_100235256 | Ga0070680_1002352563 | 122 |
| 91 | 3300005336 | Ga0070680_100396896 | Ga0070680_1003968962 | 122 |
| 92 | 3300005340 | Ga0070689_100000011 | Ga0070689_100000011109 | 122 |
| 93 | 3300005341 | Ga0070691_10112410 | Ga0070691_101124102 | 122 |
| 94 | 3300005343 | Ga0070687_100059099 | Ga0070687_1000590994 | 122 |
| 95 | 3300005347 | Ga0070668_100648964 | Ga0070668_1006489641 | 122 |
| 96 | 3300005354 | Ga0070675_100338777 | Ga0070675_1003387772 | 122 |
| 97 | 3300005356 | Ga0070674_100402103 | Ga0070674_1004021032 | 122 |
| 98 | 3300005364 | Ga0070673_100032086 | Ga0070673_1000320866 | 122 |
| 99 | 3300005365 | Ga0070688_101320073 | Ga0070688_1013200731 | 122 |
| 100 | 3300005406 | Ga0070703_10014361 | Ga0070703_100143614 | 122 |
| 101 | 3300005441 | Ga0070700_100301653 | Ga0070700_1003016531 | 122 |
| 102 | 3300005444 | Ga0070694_100092843 | Ga0070694_1000928434 | 122 |
| 103 | 3300005444 | Ga0070694_100484218 | Ga0070694_1004842181 | 122 |
| 104 | 3300005445 | Ga0070708_100051172 | Ga0070708_1000511724 | 122 |
| 105 | 3300005456 | Ga0070678_100517354 | Ga0070678_1005173542 | 122 |
| 106 | 3300005467 | Ga0070706_100296292 | Ga0070706_1002962923 | 122 |
| 107 | 3300005467 | Ga0070706_100793944 | Ga0070706_1007939442 | 122 |
| 108 | 3300005468 | Ga0070707_100548255 | Ga0070707_1005482553 | 122 |
| 109 | 3300005471 | Ga0070698_100086413 | Ga0070698_1000864132 | 122 |
| 110 | 3300005545 | Ga0070695_100366258 | Ga0070695_1003662582 | 122 |
| 111 | 3300005546 | Ga0070696_100709605 | Ga0070696_1007096052 | 122 |
| 112 | 3300005548 | Ga0070665_100875280 | Ga0070665_1008752801 | 122 |
| 113 | 3300005549 | Ga0070704_100013495 | Ga0070704_1000134956 | 122 |
| 114 | 3300005549 | Ga0070704_100082585 | Ga0070704_1000825852 | 122 |
| 115 | 3300005617 | Ga0068859_100166573 | Ga0068859_1001665733 | 122 |
| 116 | 3300005719 | Ga0068861_100031033 | Ga0068861_1000310336 | 122 |
| 117 | 3300005841 | Ga0068863_100787484 | Ga0068863_1007874842 | 122 |
| 118 | 3300005844 | Ga0068862_100055700 | Ga0068862_1000557002 | 122 |
| 119 | 3300005937 | Ga0081455_10249840 | Ga0081455_102498401 | 122 |
| 120 | 3300006844 | Ga0075428_100032484 | Ga0075428_1000324847 | 122 |
| 121 | 3300006844 | Ga0075428_100034965 | Ga0075428_1000349656 | 122 |
| 122 | 3300006846 | Ga0075430_100096586 | Ga0075430_1000965861 | 122 |
| 123 | 3300006852 | Ga0075433_10187301 | Ga0075433_101873011 | 122 |
| 124 | 3300006880 | Ga0075429_100074337 | Ga0075429_1000743375 | 122 |
| 125 | 3300006880 | Ga0075429_100100565 | Ga0075429_1001005654 | 122 |
| 126 | 3300006881 | Ga0068865_100184968 | Ga0068865_1001849682 | 122 |
| 127 | 3300006931 | Ga0097620_100166582 | Ga0097620_1001665823 | 122 |
| 128 | 3300009094 | Ga0111539_10002283 | Ga0111539_1000228334 | 122 |
| 129 | 3300009094 | Ga0111539_10034157 | Ga0111539_100341573 | 122 |
| 130 | 3300009094 | Ga0111539_10116944 | Ga0111539_101169444 | 122 |
| 131 | 3300009094 | Ga0111539_10533926 | Ga0111539_105339262 | 122 |
| 132 | 3300009147 | Ga0114129_10043906 | Ga0114129_100439063 | 122 |
| 133 | 3300009148 | Ga0105243_10348467 | Ga0105243_103484672 | 122 |
| 134 | 3300009176 | Ga0105242_11217696 | Ga0105242_112176962 | 122 |
| 135 | 3300009177 | Ga0105248_10427077 | Ga0105248_104270772 | 122 |
| 136 | 3300009177 | Ga0105248_11691988 | Ga0105248_116919882 | 122 |
| 137 | 3300013102 | Ga0157371_10005714 | Ga0157371_100057142 | 122 |
| 138 | 3300013104 | Ga0157370_10025208 | Ga0157370_100252087 | 122 |
| 139 | 3300013105 | Ga0157369_10028764 | Ga0157369_100287648 | 122 |
| 140 | 3300013296 | Ga0157374_11156383 | Ga0157374_111563832 | 122 |
| 141 | 3300013306 | Ga0163162_10585067 | Ga0163162_105850672 | 122 |
| 142 | 3300013308 | Ga0157375_10930122 | Ga0157375_109301221 | 122 |
| 143 | 3300014325 | Ga0163163_10940511 | Ga0163163_109405112 | 122 |
| 144 | 3300014326 | Ga0157380_10000142 | Ga0157380_1000014228 | 122 |
| 145 | 3300014326 | Ga0157380_10003693 | Ga0157380_1000369311 | 122 |
| 146 | 3300014326 | Ga0157380_10130561 | Ga0157380_101305612 | 122 |
| 147 | 3300014326 | Ga0157380_11278847 | Ga0157380_112788471 | 122 |
| 148 | 3300025905 | Ga0207685_10241103 | Ga0207685_102411031 | 122 |
| 149 | 3300025907 | Ga0207645_10737792 | Ga0207645_107377921 | 122 |
| 150 | 3300025908 | Ga0207643_10472168 | Ga0207643_104721682 | 122 |
| 151 | 3300025910 | Ga0207684_10164992 | Ga0207684_101649922 | 122 |
| 152 | 3300025917 | Ga0207660_10184384 | Ga0207660_101843843 | 122 |
| 153 | 3300025918 | Ga0207662_10111162 | Ga0207662_101111622 | 122 |
| 154 | 3300025922 | Ga0207646_10123114 | Ga0207646_101231142 | 122 |
| 155 | 3300025926 | Ga0207659_10293970 | Ga0207659_102939702 | 122 |
| 156 | 3300025933 | Ga0207706_10790118 | Ga0207706_107901181 | 122 |
| 157 | 3300025935 | Ga0207709_10150875 | Ga0207709_101508752 | 122 |
| 158 | 3300025936 | Ga0207670_10000005 | Ga0207670_10000005269 | 122 |
| 159 | 3300025937 | Ga0207669_11957301 | Ga0207669_119573011 | 122 |
| 160 | 3300025938 | Ga0207704_10421037 | Ga0207704_104210371 | 122 |
| 161 | 3300025939 | Ga0207665_10007972 | Ga0207665_100079722 | 122 |
| 162 | 3300025942 | Ga0207689_10043467 | Ga0207689_100434674 | 122 |
| 163 | 3300025972 | Ga0207668_11420122 | Ga0207668_114201221 | 122 |
| 164 | 3300026075 | Ga0207708_10013400 | Ga0207708_100134003 | 122 |
| 165 | 3300026116 | Ga0207674_10030437 | Ga0207674_100304373 | 122 |
| 166 | 3300027695 | Ga0209966_1028173 | Ga0209966_10281731 | 122 |
| 167 | 3300027876 | Ga0209974_10154688 | Ga0209974_101546881 | 122 |
| 168 | 3300027876 | Ga0209974_10304664 | Ga0209974_103046641 | 122 |
| 169 | 3300027907 | Ga0207428_10013153 | Ga0207428_100131532 | 122 |
| 170 | 3300027907 | Ga0207428_10083959 | Ga0207428_100839594 | 122 |
| 171 | 3300028379 | Ga0268266_10813537 | Ga0268266_108135371 | 122 |
| 172 | 3300028380 | Ga0268265_10507479 | Ga0268265_105074793 | 122 |
| 173 | 3300031548 | Ga0307408_100278591 | Ga0307408_1002785913 | 122 |
| 174 | 3300031548 | Ga0307408_100784699 | Ga0307408_1007846991 | 122 |
| 175 | 3300031731 | Ga0307405_10106559 | Ga0307405_101065593 | 122 |
| 176 | 3300031824 | Ga0307413_10451884 | Ga0307413_104518842 | 122 |
| 177 | 3300031852 | Ga0307410_10064168 | Ga0307410_100641682 | 122 |
| 178 | 3300031852 | Ga0307410_10490010 | Ga0307410_104900102 | 122 |
| 179 | 3300031901 | Ga0307406_10110187 | Ga0307406_101101872 | 122 |
| 180 | 3300031903 | Ga0307407_10881685 | Ga0307407_108816852 | 122 |
| 181 | 3300031911 | Ga0307412_10221343 | Ga0307412_102213433 | 122 |
| 182 | 3300031911 | Ga0307412_10858719 | Ga0307412_108587192 | 122 |
| 183 | 3300032002 | Ga0307416_100216071 | Ga0307416_1002160711 | 122 |
| 184 | 3300032004 | Ga0307414_10009925 | Ga0307414_100099252 | 122 |
| 185 | 3300032004 | Ga0307414_10074417 | Ga0307414_100744172 | 122 |
| 186 | 3300032004 | Ga0307414_10402507 | Ga0307414_104025072 | 122 |
| 187 | 3300032005 | Ga0307411_10081123 | Ga0307411_100811231 | 122 |
| 188 | 3300032005 | Ga0307411_10653185 | Ga0307411_106531852 | 122 |
| 189 | 3300036401 | Ga0373937_1425481 | Ga0373937_1425481_72_518 | 122 |
| 190 | 3300041451 | Ga0451791_1874268 | Ga0451791_1874268_53_517 | 122 |
| 191 | 3300041453 | Ga0451797_1101137 | Ga0451797_1101137_70_519 | 122 |
| 192 | 3300041486 | Ga0451807_0883340 | Ga0451807_0883340_95_556 | 122 |
| 193 | 3300041494 | Ga0451837_0505302 | Ga0451837_0505302_113_574 | 122 |
| 194 | 3300046460 | Ga0495638_0174870 | Ga0495638_0174870_296_760 | 122 |
| 195 | 3300046463 | Ga0495653_0554111 | Ga0495653_0554111_188_637 | 122 |
| 196 | 3300046476 | Ga0495662_0213897 | Ga0495662_0213897_124_570 | 122 |
| 197 | 3300046664 | Ga0495659_0148464 | Ga0495659_0148464_171_620 | 122 |
| 198 | 3300046694 | Ga0495649_0004033 | Ga0495649_0004033_2630_3094 | 122 |
| 199 | 3300048907 | Ga0496104_0284878 | Ga0496104_0284878_407_856 | 122 |
| 200 | 3300048908 | Ga0496105_0024718 | Ga0496105_0024718_3571_4020 | 122 |
| 201 | 3300048915 | Ga0496112_0197717 | Ga0496112_0197717_1311_1760 | 122 |
| 202 | 3300048919 | Ga0496116_0028102 | Ga0496116_0028102_988_1452 | 122 |
| 203 | 3300048925 | Ga0496122_0002203 | Ga0496122_0002203_19323_19787 | 122 |
| 204 | 3300048926 | Ga0496123_0001896 | Ga0496123_0001896_19559_20023 | 122 |
| 205 | 3300048928 | Ga0496125_0000334 | Ga0496125_0000334_39143_39607 | 122 |
| 206 | 3300049568 | Ga0501031_0762173 | Ga0501031_0762173_98_547 | 122 |
| 207 | 3300049573 | Ga0501037_0656436 | Ga0501037_0656436_100_549 | 122 |
| 208 | 3300049575 | Ga0501039_0111877 | Ga0501039_0111877_1302_1751 | 122 |
| 209 | 3300049576 | Ga0501040_0391215 | Ga0501040_0391215_381_830 | 122 |
| 210 | 3300049578 | Ga0501042_0373089 | Ga0501042_0373089_164_613 | 122 |
| 211 | 3300049587 | Ga0501071_0164598 | Ga0501071_0164598_290_739 | 122 |
| 212 | 3300049589 | Ga0501073_1271411 | Ga0501073_1271411_12_461 | 122 |
| 213 | 3300049741 | Ga0501079_0212515 | Ga0501079_0212515_141_590 | 122 |
| 214 | 3300049743 | Ga0501081_1258667 | Ga0501081_1258667_67_516 | 122 |
| 215 | 3300049823 | Ga0501044_0379164 | Ga0501044_0379164_664_1149 | 122 |
| 216 | 3300049823 | Ga0501044_1505839 | Ga0501044_1505839_36_428 | 122 |
| 217 | 3300050507 | nmdc:mga05p37_37700_c1 | nmdc:mga05p37_37700_c1_1427_1891 | 122 |
| 218 | 3300050508 | nmdc:mga09592_191170_c1 | nmdc:mga09592_191170_c1_170_619 | 122 |
| 219 | 3300050509 | nmdc:mga0qj67_172172_c1 | nmdc:mga0qj67_172172_c1_1248_1697 | 122 |
| 220 | 3300050510 | nmdc:mga06r32_460025_c1 | nmdc:mga06r32_460025_c1_636_1100 | 122 |
| 221 | 3300050511 | nmdc:mga08y16_1023985_c1 | nmdc:mga08y16_1023985_c1_301_765 | 122 |
| 222 | 3300050511 | nmdc:mga08y16_134749_c1 | nmdc:mga08y16_134749_c1_2027_2476 | 122 |
| 223 | 3300050511 | nmdc:mga08y16_33758_c1 | nmdc:mga08y16_33758_c1_3336_3785 | 122 |
| 224 | 3300050511 | nmdc:mga08y16_702339_c1 | nmdc:mga08y16_702339_c1_337_786 | 122 |
| 225 | 3300053140 | Ga0500573_0040362 | Ga0500573_0040362_1114_1578 | 122 |
| 226 | 3300053140 | Ga0500573_0073385 | Ga0500573_0073385_61_525 | 122 |
| 227 | 3300060353 | Ga0501082_0222094 | Ga0501082_0222094_447_896 | 122 |
| 228 | iso_pu_bacteria | 2928972540 | 2928974587 | 122 |
| 229 | iso_pu_bacteria | 2941485952 | 2941487971 | 122 |
| 230 | iso_pu_bacteria | 2977240413 | 2977243510 | 122 |
| 231 | 2162886012 | MBSR1b_contig_6351538 | MBSR1b_0074.00000290 | 123 |
| 232 | 3300003349 | JGI26129J50193_1001905 | JGI26129J50193_10019052 | 123 |
| 233 | 3300003659 | JGI25404J52841_10025162 | JGI25404J52841_100251622 | 123 |
| 234 | 3300005293 | Ga0065715_10766435 | Ga0065715_107664351 | 123 |
| 235 | 3300005329 | Ga0070683_100032711 | Ga0070683_1000327112 | 123 |
| 236 | 3300005330 | Ga0070690_100011991 | Ga0070690_1000119915 | 123 |
| 237 | 3300005336 | Ga0070680_100002362 | Ga0070680_10000236213 | 123 |
| 238 | 3300005338 | Ga0068868_100014188 | Ga0068868_1000141888 | 123 |
| 239 | 3300005340 | Ga0070689_100107570 | Ga0070689_1001075701 | 123 |
| 240 | 3300005340 | Ga0070689_100200873 | Ga0070689_1002008731 | 123 |
| 241 | 3300005340 | Ga0070689_101416228 | Ga0070689_1014162281 | 123 |
| 242 | 3300005341 | Ga0070691_10005070 | Ga0070691_100050703 | 123 |
| 243 | 3300005341 | Ga0070691_10006759 | Ga0070691_100067596 | 123 |
| 244 | 3300005345 | Ga0070692_10157318 | Ga0070692_101573182 | 123 |
| 245 | 3300005353 | Ga0070669_100388621 | Ga0070669_1003886212 | 123 |
| 246 | 3300005355 | Ga0070671_100111835 | Ga0070671_1001118353 | 123 |
| 247 | 3300005367 | Ga0070667_100083577 | Ga0070667_1000835773 | 123 |
| 248 | 3300005406 | Ga0070703_10000733 | Ga0070703_100007332 | 123 |
| 249 | 3300005434 | Ga0070709_10009350 | Ga0070709_100093503 | 123 |
| 250 | 3300005434 | Ga0070709_10021319 | Ga0070709_100213192 | 123 |
| 251 | 3300005435 | Ga0070714_100117083 | Ga0070714_1001170832 | 123 |
| 252 | 3300005436 | Ga0070713_100017059 | Ga0070713_1000170597 | 123 |
| 253 | 3300005436 | Ga0070713_100091569 | Ga0070713_1000915691 | 123 |
| 254 | 3300005437 | Ga0070710_10030501 | Ga0070710_100305014 | 123 |
| 255 | 3300005438 | Ga0070701_10032368 | Ga0070701_100323683 | 123 |
| 256 | 3300005439 | Ga0070711_100009992 | Ga0070711_1000099927 | 123 |
| 257 | 3300005439 | Ga0070711_100120916 | Ga0070711_1001209162 | 123 |
| 258 | 3300005440 | Ga0070705_100000284 | Ga0070705_1000002842 | 123 |
| 259 | 3300005441 | Ga0070700_100033576 | Ga0070700_1000335762 | 123 |
| 260 | 3300005441 | Ga0070700_100048885 | Ga0070700_1000488852 | 123 |
| 261 | 3300005444 | Ga0070694_100036925 | Ga0070694_1000369252 | 123 |
| 262 | 3300005445 | Ga0070708_100018075 | Ga0070708_1000180754 | 123 |
| 263 | 3300005455 | Ga0070663_100005804 | Ga0070663_1000058046 | 123 |
| 264 | 3300005455 | Ga0070663_100992992 | Ga0070663_1009929921 | 123 |
| 265 | 3300005458 | Ga0070681_10063222 | Ga0070681_100632222 | 123 |
| 266 | 3300005459 | Ga0068867_100181206 | Ga0068867_1001812061 | 123 |
| 267 | 3300005468 | Ga0070707_100370675 | Ga0070707_1003706752 | 123 |
| 268 | 3300005471 | Ga0070698_100149590 | Ga0070698_1001495901 | 123 |
| 269 | 3300005518 | Ga0070699_100000768 | Ga0070699_10000076826 | 123 |
| 270 | 3300005530 | Ga0070679_100482240 | Ga0070679_1004822402 | 123 |
| 271 | 3300005536 | Ga0070697_100047248 | Ga0070697_1000472482 | 123 |
| 272 | 3300005539 | Ga0068853_100177179 | Ga0068853_1001771791 | 123 |
| 273 | 3300005545 | Ga0070695_100001812 | Ga0070695_10000181210 | 123 |
| 274 | 3300005545 | Ga0070695_100010490 | Ga0070695_1000104902 | 123 |
| 275 | 3300005545 | Ga0070695_100217039 | Ga0070695_1002170392 | 123 |
| 276 | 3300005546 | Ga0070696_100000069 | Ga0070696_1000000696 | 123 |
| 277 | 3300005547 | Ga0070693_100005191 | Ga0070693_1000051913 | 123 |
| 278 | 3300005547 | Ga0070693_100472286 | Ga0070693_1004722862 | 123 |
| 279 | 3300005548 | Ga0070665_100054884 | Ga0070665_1000548842 | 123 |
| 280 | 3300005549 | Ga0070704_100000106 | Ga0070704_10000010616 | 123 |
| 281 | 3300005549 | Ga0070704_100266865 | Ga0070704_1002668653 | 123 |
| 282 | 3300005549 | Ga0070704_101046474 | Ga0070704_1010464741 | 123 |
| 283 | 3300005563 | Ga0068855_100000841 | Ga0068855_10000084114 | 123 |
| 284 | 3300005577 | Ga0068857_100089742 | Ga0068857_1000897423 | 123 |
| 285 | 3300005578 | Ga0068854_100516717 | Ga0068854_1005167172 | 123 |
| 286 | 3300005614 | Ga0068856_100007946 | Ga0068856_10000794611 | 123 |
| 287 | 3300005614 | Ga0068856_100564914 | Ga0068856_1005649142 | 123 |
| 288 | 3300005615 | Ga0070702_100045769 | Ga0070702_1000457692 | 123 |
| 289 | 3300005615 | Ga0070702_101242140 | Ga0070702_1012421401 | 123 |
| 290 | 3300005617 | Ga0068859_100006391 | Ga0068859_1000063916 | 123 |
| 291 | 3300005718 | Ga0068866_10006416 | Ga0068866_100064165 | 123 |
| 292 | 3300005719 | Ga0068861_100056703 | Ga0068861_1000567033 | 123 |
| 293 | 3300005719 | Ga0068861_100495113 | Ga0068861_1004951132 | 123 |
| 294 | 3300005841 | Ga0068863_100037461 | Ga0068863_1000374616 | 123 |
| 295 | 3300005842 | Ga0068858_100006896 | Ga0068858_10000689610 | 123 |
| 296 | 3300005842 | Ga0068858_100871162 | Ga0068858_1008711621 | 123 |
| 297 | 3300005843 | Ga0068860_100027650 | Ga0068860_1000276507 | 123 |
| 298 | 3300005843 | Ga0068860_100121452 | Ga0068860_1001214523 | 123 |
| 299 | 3300005844 | Ga0068862_100007239 | Ga0068862_1000072397 | 123 |
| 300 | 3300005937 | Ga0081455_10329614 | Ga0081455_103296142 | 123 |
| 301 | 3300005983 | Ga0081540_1000012 | Ga0081540_1000012176 | 123 |
| 302 | 3300006028 | Ga0070717_10165908 | Ga0070717_101659082 | 123 |
| 303 | 3300006163 | Ga0070715_10003085 | Ga0070715_100030857 | 123 |
| 304 | 3300006173 | Ga0070716_100002028 | Ga0070716_1000020284 | 123 |
| 305 | 3300006173 | Ga0070716_100018496 | Ga0070716_1000184964 | 123 |
| 306 | 3300006173 | Ga0070716_100086486 | Ga0070716_1000864862 | 123 |
| 307 | 3300006175 | Ga0070712_100131203 | Ga0070712_1001312033 | 123 |
| 308 | 3300006237 | Ga0097621_100150981 | Ga0097621_1001509812 | 123 |
| 309 | 3300006358 | Ga0068871_100033343 | Ga0068871_1000333433 | 123 |
| 310 | 3300006844 | Ga0075428_100025030 | Ga0075428_1000250301 | 123 |
| 311 | 3300006852 | Ga0075433_10002093 | Ga0075433_1000209314 | 123 |
| 312 | 3300006871 | Ga0075434_100010143 | Ga0075434_1000101433 | 123 |
| 313 | 3300006880 | Ga0075429_100045458 | Ga0075429_1000454582 | 123 |
| 314 | 3300006881 | Ga0068865_100002839 | Ga0068865_1000028395 | 123 |
| 315 | 3300006914 | Ga0075436_100399717 | Ga0075436_1003997172 | 123 |
| 316 | 3300006914 | Ga0075436_100862035 | Ga0075436_1008620351 | 123 |
| 317 | 3300006931 | Ga0097620_100006391 | Ga0097620_1000063916 | 123 |
| 318 | 3300007076 | Ga0075435_100067092 | Ga0075435_1000670923 | 123 |
| 319 | 3300007076 | Ga0075435_101124345 | Ga0075435_1011243452 | 123 |
| 320 | 3300007788 | Ga0099795_10044358 | Ga0099795_100443582 | 123 |
| 321 | 3300009093 | Ga0105240_10002990 | Ga0105240_1000299020 | 123 |
| 322 | 3300009093 | Ga0105240_10035330 | Ga0105240_100353307 | 123 |
| 323 | 3300009094 | Ga0111539_10045732 | Ga0111539_100457322 | 123 |
| 324 | 3300009094 | Ga0111539_11501496 | Ga0111539_115014962 | 123 |
| 325 | 3300009098 | Ga0105245_10180079 | Ga0105245_101800792 | 123 |
| 326 | 3300009147 | Ga0114129_10294858 | Ga0114129_102948583 | 123 |
| 327 | 3300009174 | Ga0105241_10015195 | Ga0105241_100151957 | 123 |
| 328 | 3300009174 | Ga0105241_10550368 | Ga0105241_105503681 | 123 |
| 329 | 3300009176 | Ga0105242_10003054 | Ga0105242_100030545 | 123 |
| 330 | 3300009177 | Ga0105248_10068030 | Ga0105248_100680303 | 123 |
| 331 | 3300009545 | Ga0105237_10015924 | Ga0105237_100159243 | 123 |
| 332 | 3300009545 | Ga0105237_10192883 | Ga0105237_101928831 | 123 |
| 333 | 3300009545 | Ga0105237_10594966 | Ga0105237_105949662 | 123 |
| 334 | 3300009551 | Ga0105238_11047208 | Ga0105238_110472082 | 123 |
| 335 | 3300009553 | Ga0105249_10006176 | Ga0105249_100061762 | 123 |
| 336 | 3300010375 | Ga0105239_10017734 | Ga0105239_100177345 | 123 |
| 337 | 3300011119 | Ga0105246_10082098 | Ga0105246_100820982 | 123 |
| 338 | 3300013104 | Ga0157370_10393895 | Ga0157370_103938952 | 123 |
| 339 | 3300013105 | Ga0157369_11026174 | Ga0157369_110261742 | 123 |
| 340 | 3300013296 | Ga0157374_10013397 | Ga0157374_100133972 | 123 |
| 341 | 3300013297 | Ga0157378_10010285 | Ga0157378_100102855 | 123 |
| 342 | 3300013297 | Ga0157378_10063482 | Ga0157378_100634822 | 123 |
| 343 | 3300013306 | Ga0163162_10223584 | Ga0163162_102235842 | 123 |
| 344 | 3300013307 | Ga0157372_10148341 | Ga0157372_101483413 | 123 |
| 345 | 3300013307 | Ga0157372_10569764 | Ga0157372_105697642 | 123 |
| 346 | 3300013308 | Ga0157375_10010032 | Ga0157375_1001003210 | 123 |
| 347 | 3300014325 | Ga0163163_10022026 | Ga0163163_100220262 | 123 |
| 348 | 3300014968 | Ga0157379_10021504 | Ga0157379_100215045 | 123 |
| 349 | 3300014969 | Ga0157376_11592602 | Ga0157376_115926021 | 123 |
| 350 | 3300021361 | Ga0213872_10271585 | Ga0213872_102715851 | 123 |
| 351 | 3300021377 | Ga0213874_10045308 | Ga0213874_100453081 | 123 |
| 352 | 3300025885 | Ga0207653_10001256 | Ga0207653_100012569 | 123 |
| 353 | 3300025898 | Ga0207692_10638421 | Ga0207692_106384211 | 123 |
| 354 | 3300025899 | Ga0207642_10016203 | Ga0207642_100162032 | 123 |
| 355 | 3300025905 | Ga0207685_10004502 | Ga0207685_100045024 | 123 |
| 356 | 3300025905 | Ga0207685_10087978 | Ga0207685_100879781 | 123 |
| 357 | 3300025906 | Ga0207699_10004243 | Ga0207699_100042436 | 123 |
| 358 | 3300025906 | Ga0207699_10010634 | Ga0207699_100106343 | 123 |
| 359 | 3300025911 | Ga0207654_10207002 | Ga0207654_102070022 | 123 |
| 360 | 3300025912 | Ga0207707_10035970 | Ga0207707_100359704 | 123 |
| 361 | 3300025913 | Ga0207695_10008085 | Ga0207695_1000808511 | 123 |
| 362 | 3300025913 | Ga0207695_10293343 | Ga0207695_102933433 | 123 |
| 363 | 3300025914 | Ga0207671_10010144 | Ga0207671_100101449 | 123 |
| 364 | 3300025915 | Ga0207693_10000021 | Ga0207693_1000002169 | 123 |
| 365 | 3300025915 | Ga0207693_10034274 | Ga0207693_100342745 | 123 |
| 366 | 3300025915 | Ga0207693_10258163 | Ga0207693_102581632 | 123 |
| 367 | 3300025916 | Ga0207663_10120603 | Ga0207663_101206032 | 123 |
| 368 | 3300025916 | Ga0207663_10942570 | Ga0207663_109425702 | 123 |
| 369 | 3300025917 | Ga0207660_10012476 | Ga0207660_100124765 | 123 |
| 370 | 3300025921 | Ga0207652_10421141 | Ga0207652_104211412 | 123 |
| 371 | 3300025922 | Ga0207646_10199377 | Ga0207646_101993773 | 123 |
| 372 | 3300025927 | Ga0207687_10889820 | Ga0207687_108898202 | 123 |
| 373 | 3300025928 | Ga0207700_10003126 | Ga0207700_100031264 | 123 |
| 374 | 3300025928 | Ga0207700_10176409 | Ga0207700_101764092 | 123 |
| 375 | 3300025929 | Ga0207664_10118208 | Ga0207664_101182083 | 123 |
| 376 | 3300025934 | Ga0207686_10017032 | Ga0207686_100170324 | 123 |
| 377 | 3300025938 | Ga0207704_10070409 | Ga0207704_100704092 | 123 |
| 378 | 3300025938 | Ga0207704_10242607 | Ga0207704_102426072 | 123 |
| 379 | 3300025939 | Ga0207665_10003946 | Ga0207665_100039464 | 123 |
| 380 | 3300025939 | Ga0207665_10018176 | Ga0207665_100181762 | 123 |
| 381 | 3300025939 | Ga0207665_10455296 | Ga0207665_104552963 | 123 |
| 382 | 3300025941 | Ga0207711_10080886 | Ga0207711_100808861 | 123 |
| 383 | 3300025942 | Ga0207689_10088670 | Ga0207689_100886702 | 123 |
| 384 | 3300025942 | Ga0207689_10647758 | Ga0207689_106477581 | 123 |
| 385 | 3300025949 | Ga0207667_10000839 | Ga0207667_1000083915 | 123 |
| 386 | 3300025949 | Ga0207667_10157339 | Ga0207667_101573393 | 123 |
| 387 | 3300025961 | Ga0207712_10006325 | Ga0207712_100063257 | 123 |
| 388 | 3300025981 | Ga0207640_10613645 | Ga0207640_106136451 | 123 |
| 389 | 3300025986 | Ga0207658_10206398 | Ga0207658_102063982 | 123 |
| 390 | 3300026023 | Ga0207677_10024915 | Ga0207677_100249153 | 123 |
| 391 | 3300026023 | Ga0207677_11523605 | Ga0207677_115236051 | 123 |
| 392 | 3300026067 | Ga0207678_10009050 | Ga0207678_100090506 | 123 |
| 393 | 3300026067 | Ga0207678_10595335 | Ga0207678_105953352 | 123 |
| 394 | 3300026075 | Ga0207708_10044894 | Ga0207708_100448943 | 123 |
| 395 | 3300026075 | Ga0207708_10079688 | Ga0207708_100796882 | 123 |
| 396 | 3300026089 | Ga0207648_10226245 | Ga0207648_102262452 | 123 |
| 397 | 3300026095 | Ga0207676_10113299 | Ga0207676_101132993 | 123 |
| 398 | 3300026095 | Ga0207676_10425742 | Ga0207676_104257422 | 123 |
| 399 | 3300026116 | Ga0207674_10002834 | Ga0207674_1000283420 | 123 |
| 400 | 3300026118 | Ga0207675_100222858 | Ga0207675_1002228582 | 123 |
| 401 | 3300026118 | Ga0207675_100418937 | Ga0207675_1004189372 | 123 |
| 402 | 3300027907 | Ga0207428_10026428 | Ga0207428_100264283 | 123 |
| 403 | 3300028381 | Ga0268264_10041465 | Ga0268264_100414653 | 123 |
| 404 | 3300028381 | Ga0268264_10053778 | Ga0268264_100537782 | 123 |
| 405 | 3300028381 | Ga0268264_10239157 | Ga0268264_102391573 | 123 |
| 406 | 3300031235 | Ga0265330_10089703 | Ga0265330_100897032 | 123 |
| 407 | 3300031235 | Ga0265330_10107961 | Ga0265330_101079612 | 123 |
| 408 | 3300031241 | Ga0265325_10046926 | Ga0265325_100469263 | 123 |
| 409 | 3300031251 | Ga0265327_10096175 | Ga0265327_100961752 | 123 |
| 410 | 3300031548 | Ga0307408_100218508 | Ga0307408_1002185083 | 123 |
| 411 | 3300031548 | Ga0307408_100610925 | Ga0307408_1006109251 | 123 |
| 412 | 3300031731 | Ga0307405_10001231 | Ga0307405_100012319 | 123 |
| 413 | 3300031852 | Ga0307410_10001551 | Ga0307410_100015513 | 123 |
| 414 | 3300031901 | Ga0307406_10343599 | Ga0307406_103435993 | 123 |
| 415 | 3300031903 | Ga0307407_10001320 | Ga0307407_100013204 | 123 |
| 416 | 3300031911 | Ga0307412_10031627 | Ga0307412_100316275 | 123 |
| 417 | 3300031995 | Ga0307409_100003494 | Ga0307409_1000034949 | 123 |
| 418 | 3300032002 | Ga0307416_100004185 | Ga0307416_1000041858 | 123 |
| 419 | 3300032002 | Ga0307416_100609050 | Ga0307416_1006090503 | 123 |
| 420 | 3300032004 | Ga0307414_10018722 | Ga0307414_100187227 | 123 |
| 421 | 3300032005 | Ga0307411_10245484 | Ga0307411_102454842 | 123 |
| 422 | 3300032126 | Ga0307415_100001394 | Ga0307415_10000139413 | 123 |
| 423 | 3300033179 | Ga0307507_10036380 | Ga0307507_100363803 | 123 |
| 424 | 3300034818 | Ga0373950_0012372 | Ga0373950_0012372_115_597 | 123 |
| 425 | 3300034820 | Ga0373959_0012862 | Ga0373959_0012862_959_1441 | 123 |
| 426 | 3300034820 | Ga0373959_0146225 | Ga0373959_0146225_79_561 | 123 |
| 427 | 3300034957 | Ga0373938_0005277 | Ga0373938_0005277_78_560 | 123 |
| 428 | 3300035085 | Ga0373929_0009989 | Ga0373929_0009989_960_1442 | 123 |
| 429 | 3300035088 | Ga0373940_0005921 | Ga0373940_0005921_932_1414 | 123 |
| 430 | 3300035091 | Ga0373951_0028523 | Ga0373951_0028523_587_1069 | 123 |
| 431 | 3300035092 | Ga0373952_0010720 | Ga0373952_0010720_516_998 | 123 |
| 432 | 3300035113 | Ga0373936_0128619 | Ga0373936_0128619_321_794 | 123 |
| 433 | 3300035114 | Ga0373939_0001557 | Ga0373939_0001557_2742_3224 | 123 |
| 434 | 3300035114 | Ga0373939_0036720 | Ga0373939_0036720_319_801 | 123 |
| 435 | 3300035115 | Ga0373941_0005359 | Ga0373941_0005359_1509_1991 | 123 |
| 436 | 3300035115 | Ga0373941_0015541 | Ga0373941_0015541_1410_1892 | 123 |
| 437 | 3300035119 | Ga0373956_0348245 | Ga0373956_0348245_96_569 | 123 |
| 438 | 3300035121 | Ga0373960_0032156 | Ga0373960_0032156_524_1006 | 123 |
| 439 | 3300035170 | Ga0373943_0074331 | Ga0373943_0074331_656_1129 | 123 |
| 440 | 3300035172 | Ga0373955_0089635 | Ga0373955_0089635_150_623 | 123 |
| 441 | 3300035207 | Ga0373942_0020729 | Ga0373942_0020729_205_687 | 123 |
| 442 | 3300035241 | Ga0373961_0200694 | Ga0373961_0200694_166_648 | 123 |
| 443 | 3300035242 | Ga0373962_0016607 | Ga0373962_0016607_699_1181 | 123 |
| 444 | 3300035242 | Ga0373962_0039955 | Ga0373962_0039955_420_902 | 123 |
| 445 | 3300035691 | Ga0373931_0001216 | Ga0373931_0001216_7700_8182 | 123 |
| 446 | 3300035691 | Ga0373931_0006105 | Ga0373931_0006105_2179_2661 | 123 |
| 447 | 3300035692 | Ga0373935_0660690 | Ga0373935_0660690_245_751 | 123 |
| 448 | 3300035695 | Ga0373927_0030590 | Ga0373927_0030590_2756_3229 | 123 |
| 449 | 3300035695 | Ga0373927_0045041 | Ga0373927_0045041_2110_2583 | 123 |
| 450 | 3300036401 | Ga0373937_1417663 | Ga0373937_1417663_63_536 | 123 |
| 451 | 3300039438 | Ga0436360_1062673 | Ga0436360_1062673_786_1262 | 123 |
| 452 | 3300039447 | Ga0436361_0176955 | Ga0436361_0176955_84_560 | 123 |
| 453 | 3300039447 | Ga0436361_0333953 | Ga0436361_0333953_224_694 | 123 |
| 454 | 3300039447 | Ga0436361_0739818 | Ga0436361_0739818_114_590 | 123 |
| 455 | 3300039450 | Ga0436363_0403659 | Ga0436363_0403659_120_596 | 123 |
| 456 | 3300039450 | Ga0436363_0802390 | Ga0436363_0802390_27_503 | 123 |
| 457 | 3300041410 | Ga0439461_0029971 | Ga0439461_0029971_147_632 | 123 |
| 458 | 3300041997 | Ga0439431_0074536 | Ga0439431_0074536_285_770 | 123 |
| 459 | 3300042435 | Ga0439434_0154205 | Ga0439434_0154205_133_636 | 123 |
| 460 | 3300044658 | Ga0466972_0165246 | Ga0466972_0165246_210_710 | 123 |
| 461 | 3300046472 | Ga0495580_0009170 | Ga0495580_0009170_1572_2045 | 123 |
| 462 | 3300046472 | Ga0495580_0022039 | Ga0495580_0022039_2756_3229 | 123 |
| 463 | 3300046472 | Ga0495580_0175013 | Ga0495580_0175013_658_1122 | 123 |
| 464 | 3300046473 | Ga0495582_0006568 | Ga0495582_0006568_2847_3353 | 123 |
| 465 | 3300046491 | Ga0495584_0136507 | Ga0495584_0136507_511_993 | 123 |
| 466 | 3300046517 | Ga0495630_0071504 | Ga0495630_0071504_1806_2279 | 123 |
| 467 | 3300046615 | Ga0495656_0216134 | Ga0495656_0216134_375_857 | 123 |
| 468 | 3300046681 | Ga0495647_0197783 | Ga0495647_0197783_167_640 | 123 |
| 469 | 3300047315 | Ga0495581_0369673 | Ga0495581_0369673_305_811 | 123 |
| 470 | 3300048088 | Ga0495602_0215192 | Ga0495602_0215192_320_793 | 123 |
| 471 | 3300048903 | Ga0496100_0506089 | Ga0496100_0506089_400_876 | 123 |
| 472 | 3300048904 | Ga0496101_0011397 | Ga0496101_0011397_598_1071 | 123 |
| 473 | 3300048904 | Ga0496101_0735837 | Ga0496101_0735837_245_721 | 123 |
| 474 | 3300048905 | Ga0496102_0014004 | Ga0496102_0014004_2995_3468 | 123 |
| 475 | 3300048905 | Ga0496102_0106625 | Ga0496102_0106625_543_1067 | 123 |
| 476 | 3300048905 | Ga0496102_0620374 | Ga0496102_0620374_452_928 | 123 |
| 477 | 3300048906 | Ga0496103_0424819 | Ga0496103_0424819_325_798 | 123 |
| 478 | 3300048907 | Ga0496104_0018714 | Ga0496104_0018714_1289_1762 | 123 |
| 479 | 3300048907 | Ga0496104_0032194 | Ga0496104_0032194_2745_3269 | 123 |
| 480 | 3300048907 | Ga0496104_0178089 | Ga0496104_0178089_1528_2010 | 123 |
| 481 | 3300048908 | Ga0496105_0349177 | Ga0496105_0349177_552_1076 | 123 |
| 482 | 3300048908 | Ga0496105_0793399 | Ga0496105_0793399_71_544 | 123 |
| 483 | 3300048909 | Ga0496106_0001137 | Ga0496106_0001137_8426_8908 | 123 |
| 484 | 3300048909 | Ga0496106_0123669 | Ga0496106_0123669_88_612 | 123 |
| 485 | 3300048909 | Ga0496106_0243973 | Ga0496106_0243973_840_1313 | 123 |
| 486 | 3300048910 | Ga0496107_0018741 | Ga0496107_0018741_2891_3373 | 123 |
| 487 | 3300048910 | Ga0496107_0159965 | Ga0496107_0159965_586_1110 | 123 |
| 488 | 3300048910 | Ga0496107_0408659 | Ga0496107_0408659_34_507 | 123 |
| 489 | 3300048911 | Ga0496108_0002792 | Ga0496108_0002792_2747_3220 | 123 |
| 490 | 3300048911 | Ga0496108_0586159 | Ga0496108_0586159_396_920 | 123 |
| 491 | 3300048912 | Ga0496109_0105411 | Ga0496109_0105411_1752_2225 | 123 |
| 492 | 3300048913 | Ga0496110_0005157 | Ga0496110_0005157_4418_4891 | 123 |
| 493 | 3300048914 | Ga0496111_0026019 | Ga0496111_0026019_72_545 | 123 |
| 494 | 3300048915 | Ga0496112_0071456 | Ga0496112_0071456_1280_1753 | 123 |
| 495 | 3300048916 | Ga0496113_1069157 | Ga0496113_1069157_117_593 | 123 |
| 496 | 3300048917 | Ga0496114_0002917 | Ga0496114_0002917_7731_8204 | 123 |
| 497 | 3300048918 | Ga0496115_0300110 | Ga0496115_0300110_74_598 | 123 |
| 498 | 3300048918 | Ga0496115_0493534 | Ga0496115_0493534_314_790 | 123 |
| 499 | 3300048918 | Ga0496115_0786594 | Ga0496115_0786594_197_670 | 123 |
| 500 | 3300049575 | Ga0501039_1050420 | Ga0501039_1050420_129_599 | 123 |
| 501 | 3300049578 | Ga0501042_0220561 | Ga0501042_0220561_110_586 | 123 |
| 502 | 3300049580 | Ga0501046_0298183 | Ga0501046_0298183_622_1092 | 123 |
| 503 | 3300049583 | Ga0501067_0366250 | Ga0501067_0366250_178_630 | 123 |
| 504 | 3300049584 | Ga0501068_0773284 | Ga0501068_0773284_52_504 | 123 |
| 505 | 3300049585 | Ga0501069_0074469 | Ga0501069_0074469_978_1430 | 123 |
| 506 | 3300049588 | Ga0501072_0006568 | Ga0501072_0006568_1721_2215 | 123 |
| 507 | 3300049590 | Ga0501074_0161174 | Ga0501074_0161174_1024_1476 | 123 |
| 508 | 3300049591 | Ga0501075_0246793 | Ga0501075_0246793_307_801 | 123 |
| 509 | 3300049591 | Ga0501075_0650702 | Ga0501075_0650702_161_637 | 123 |
| 510 | 3300049593 | Ga0501077_0008045 | Ga0501077_0008045_6012_6506 | 123 |
| 511 | 3300049593 | Ga0501077_0241410 | Ga0501077_0241410_660_1136 | 123 |
| 512 | 3300049593 | Ga0501077_0703136 | Ga0501077_0703136_110_568 | 123 |
| 513 | 3300049741 | Ga0501079_0022509 | Ga0501079_0022509_4129_4623 | 123 |
| 514 | 3300049741 | Ga0501079_0911597 | Ga0501079_0911597_212_673 | 123 |
| 515 | 3300049743 | Ga0501081_0137691 | Ga0501081_0137691_40_534 | 123 |
| 516 | 3300049823 | Ga0501044_0220148 | Ga0501044_0220148_509_970 | 123 |
| 517 | 3300050507 | nmdc:mga05p37_194392_c1 | nmdc:mga05p37_194392_c1_1570_2052 | 123 |
| 518 | 3300050511 | nmdc:mga08y16_144400_c1 | nmdc:mga08y16_144400_c1_1084_1566 | 123 |
| 519 | 3300050511 | nmdc:mga08y16_497361_c1 | nmdc:mga08y16_497361_c1_702_1166 | 123 |
| 520 | 3300050511 | nmdc:mga08y16_971242_c1 | nmdc:mga08y16_971242_c1_115_597 | 123 |
| 521 | 3300050512 | nmdc:mga0n895_20730_c1 | nmdc:mga0n895_20730_c1_5342_5824 | 123 |
| 522 | 3300050513 | nmdc:mga0rr50_11164_c1 | nmdc:mga0rr50_11164_c1_3662_4144 | 123 |
| 523 | 3300050514 | nmdc:mga08x19_793967_c1 | nmdc:mga08x19_793967_c1_130_603 | 123 |
| 524 | 3300050515 | nmdc:mga0a205_4542_c1 | nmdc:mga0a205_4542_c1_10670_11152 | 123 |
| 525 | 3300053078 | Ga0495612_0358425 | Ga0495612_0358425_110_583 | 123 |
| 526 | iso_pu_bacteria | 2855195626 | 2855198932 | 123 |
| 527 | iso_pu_bacteria | 2871272651 | 2871274366 | 123 |
| 528 | iso_pu_bacteria | 2900051742 | 2900052506 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d7v-assembly1.cif.gz_B | structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 | 0.9708 | 2 | 122 |
| 2d7v-assembly1.cif.gz_B | structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 | 0.9478 | 2 | 122 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9023 | 23 | 122 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.9014 | 23 | 121 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.8985 | 23 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d7vB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.948 | 2 | 122 | 3.30.300.20 |
| 2d7vB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9257 | 2 | 122 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9039 | 23 | 122 | 3.30.300.20 |
| af_Q55EI4_11_156_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8888 | 20 | 121 | 3.30.300.20 |
| af_Q55E30_8_160_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8714 | 20 | 123 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0J1GHH4-F1-model_v4 | Peroxiredoxin | 0.9926 | 22 | 123 |
|
| AF-A0A534GYJ0-F1-model_v4 | OsmC family peroxiredoxin | 0.9904 | 24 | 123 |
|
| AF-A0A850STB2-F1-model_v4 | OsmC family protein | 0.9875 | 24 | 120 |
|
| AF-A0A3C0PGU9-F1-model_v4 | Osmotically inducible protein OsmC | 0.9874 | 6 | 123 |
|
| AF-A0A1F2TUU2-F1-model_v4 | OsmC family protein | 0.9864 | 39 | 122 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar