F459511

General Info

Members Datasets Scaffolds Average Seq Length
527 275 1054 104

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100048878|Ga0070705_1000488782
Length 116
Sequence MAEAAAMKSAPLGGGDVLATAGAWKKAGKGVALATVVTTWGSSPRPVGSQLAVSDKQEMEGSVSGGCIEGAVVLEAQKVIADGKPRLLDFGVTNEQAWEVGLACGGKVQVFVEKLD

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
169 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
245 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
246 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
247 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
248 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
249 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
250 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
251 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
252 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
253 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
254 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
257 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
260 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
263 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
264 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
269 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
270 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
271 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
272 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
273 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
274 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
275 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 1.33
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.39
Nodule 0
Rhizoplane 0.76
Rhizosphere 84.25
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100048878 3300005440 Bacteria 2453
2 JGI25153J46596_10000451 3300003215 Bacteria 26293
3 Ga0070658_10001821 3300005327 Bacteria 17931
4 Ga0070658_10056836 3300005327 Bacteria 3181
5 Ga0070690_101622329 3300005330 Bacteria 525
6 Ga0070680_100005313 3300005336 Bacteria 9748
7 Ga0070680_100579232 3300005336 Bacteria 963
8 Ga0070680_101177940 3300005336 Bacteria 663
9 Ga0070660_100001961 3300005339 Bacteria 14190
10 Ga0070687_100637779 3300005343 Bacteria 737
11 Ga0070673_100147461 3300005364 Bacteria 1990
12 Ga0070659_100218056 3300005366 Bacteria 1574
13 Ga0070659_101321481 3300005366 Bacteria 640
14 Ga0070667_102102057 3300005367 Bacteria 532
15 Ga0070714_100639064 3300005435 Bacteria 1024
16 Ga0070711_100335496 3300005439 Bacteria 1211
17 Ga0070705_101049491 3300005440 Bacteria 664
18 Ga0070700_101765558 3300005441 Bacteria 532
19 Ga0070694_100013168 3300005444 Bacteria 5162
20 Ga0070708_100070101 3300005445 Bacteria 3153
21 Ga0070708_101907032 3300005445 Bacteria 551
22 Ga0070678_101119271 3300005456 Bacteria 728
23 Ga0070662_100383018 3300005457 Bacteria 1158
24 Ga0070681_10895290 3300005458 Bacteria 806
25 Ga0070706_100024966 3300005467 Bacteria 5501
26 Ga0070706_100409307 3300005467 Bacteria 1263
27 Ga0070707_100287699 3300005468 Bacteria 1597
28 Ga0070707_101316652 3300005468 Bacteria 689
29 Ga0070698_100001083 3300005471 Bacteria 29936
30 Ga0070698_100342816 3300005471 Bacteria 1426
31 Ga0070699_100118916 3300005518 Bacteria 2323
32 Ga0070699_101062784 3300005518 Bacteria 743
33 Ga0070679_100802905 3300005530 Bacteria 884
34 Ga0070684_100962133 3300005535 Bacteria 801
35 Ga0070697_100050795 3300005536 Bacteria 3367
36 Ga0070697_100306782 3300005536 Bacteria 1365
37 Ga0070686_100095985 3300005544 Bacteria 1993
38 Ga0070695_100004242 3300005545 Bacteria 8389
39 Ga0070693_100794761 3300005547 Bacteria 701
40 Ga0070665_100006473 3300005548 Bacteria 11920
41 Ga0070665_100027897 3300005548 Bacteria 5685
42 Ga0070665_100056753 3300005548 Bacteria 3926
43 Ga0070704_100058147 3300005549 Bacteria 2753
44 Ga0070704_100433744 3300005549 Bacteria 1128
45 Ga0068855_100086099 3300005563 Bacteria 3634
46 Ga0068855_101423249 3300005563 Bacteria 714
47 Ga0068855_101480804 3300005563 Bacteria 697
48 Ga0068855_101576239 3300005563 Bacteria 672
49 Ga0068855_102167684 3300005563 Bacteria 558
50 Ga0070664_100752155 3300005564 Bacteria 910
51 Ga0068856_100342876 3300005614 Bacteria 1512
52 Ga0068856_100486466 3300005614 Bacteria 1255
53 Ga0068856_101260175 3300005614 Bacteria 755
54 Ga0068852_100042611 3300005616 Bacteria 3843
55 Ga0068852_100138269 3300005616 Bacteria 2251
56 Ga0068852_102100760 3300005616 Bacteria 587
57 Ga0068864_100973876 3300005618 Bacteria 840
58 Ga0068863_100313554 3300005841 Bacteria 1523
59 Ga0068860_100889588 3300005843 Bacteria 906
60 Ga0068862_100015240 3300005844 Bacteria 6383
61 Ga0081455_10010925 3300005937 Bacteria 9158
62 Ga0081455_10319932 3300005937 Bacteria 1106
63 Ga0081540_1067027 3300005983 Bacteria 1679
64 Ga0081539_10090606 3300005985 Bacteria 1581
65 Ga0081539_10146214 3300005985 Bacteria 1142
66 Ga0081539_10464163 3300005985 Bacteria 524
67 Ga0070716_100130047 3300006173 Bacteria 1590
68 Ga0070716_101413449 3300006173 Bacteria 566
69 Ga0070712_100197004 3300006175 Bacteria 1580
70 Ga0075362_10414174 3300006177 Bacteria 681
71 Ga0075362_10467897 3300006177 Bacteria 642
72 Ga0075367_10054663 3300006178 Bacteria 2368
73 Ga0068871_100450058 3300006358 Bacteria 1154
74 Ga0075428_100724281 3300006844 Bacteria 1059
75 Ga0075431_100234340 3300006847 Bacteria 1869
76 Ga0075431_100333454 3300006847 Bacteria 1528
77 Ga0075431_100368933 3300006847 Bacteria 1441
78 Ga0075431_100943919 3300006847 Bacteria 831
79 Ga0075433_11182351 3300006852 Bacteria 664
80 Ga0075434_100185974 3300006871 Bacteria 2098
81 Ga0075436_100475543 3300006914 Bacteria 912
82 Ga0075435_100663239 3300007076 Bacteria 906
83 Ga0099794_10017677 3300007265 Bacteria 3182
84 Ga0099794_10387977 3300007265 Bacteria 729
85 Ga0099795_10025043 3300007788 Bacteria 1996
86 Ga0099795_10307828 3300007788 Bacteria 698
87 Ga0105240_10043860 3300009093 Bacteria 5688
88 Ga0105240_10125522 3300009093 Bacteria 3084
89 Ga0105240_10257278 3300009093 Bacteria 2016
90 Ga0105240_10356973 3300009093 Bacteria 1657
91 Ga0105240_10586167 3300009093 Bacteria 1229
92 Ga0105240_11000167 3300009093 Bacteria 894
93 Ga0105240_11799776 3300009093 Bacteria 638
94 Ga0111539_10738173 3300009094 Bacteria 1146
95 Ga0105245_10007375 3300009098 Bacteria 9628
96 Ga0105245_10171127 3300009098 Bacteria 2069
97 Ga0105245_10710340 3300009098 Bacteria 1039
98 Ga0105247_11221051 3300009101 Bacteria 600
99 Ga0105243_11934628 3300009148 Bacteria 623
100 Ga0105243_12386975 3300009148 Bacteria 567
101 Ga0105242_10331483 3300009176 Bacteria 1399
102 Ga0105248_11481264 3300009177 Bacteria 768
103 Ga0105248_11757877 3300009177 Unclassified 703
104 Ga0105237_10131035 3300009545 Bacteria 2502
105 Ga0105237_10359068 3300009545 Bacteria 1461
106 Ga0105237_10502498 3300009545 Bacteria 1219
107 Ga0105238_10001150 3300009551 Bacteria 26729
108 Ga0105238_10005370 3300009551 Bacteria 12664
109 Ga0105238_10231768 3300009551 Bacteria 1823
110 Ga0105238_10339380 3300009551 Bacteria 1490
111 Ga0105238_10477184 3300009551 Bacteria 1246
112 Ga0105238_10702598 3300009551 Bacteria 1023
113 Ga0105238_10812930 3300009551 Bacteria 951
114 Ga0105238_10842167 3300009551 Bacteria 934
115 Ga0099796_10462810 3300010159 Bacteria 565
116 Ga0105239_10040531 3300010375 Bacteria 5102
117 Ga0105239_10256960 3300010375 Bacteria 1963
118 Ga0105239_11084530 3300010375 Bacteria 922
119 Ga0105239_12189648 3300010375 Bacteria 643
120 Ga0157369_11424469 3300013105 Bacteria 705
121 Ga0157374_10326509 3300013296 Bacteria 1521
122 Ga0157374_11821994 3300013296 Bacteria 634
123 Ga0157378_11699753 3300013297 Unclassified 678
124 Ga0157372_10236752 3300013307 Bacteria 2118
125 Ga0157372_12209947 3300013307 Bacteria 632
126 Ga0157375_10291768 3300013308 Bacteria 1794
127 Ga0157375_13113729 3300013308 Bacteria 553
128 Ga0163163_10261280 3300014325 Bacteria 1782
129 Ga0163163_10274609 3300014325 Bacteria 1736
130 Ga0163163_10585375 3300014325 Bacteria 1179
131 Ga0163163_10716415 3300014325 Bacteria 1064
132 Ga0163163_11377217 3300014325 Bacteria 767
133 Ga0182008_10032678 3300014497 Bacteria 2613
134 Ga0157377_11287654 3300014745 Bacteria 571
135 Ga0157379_10425236 3300014968 Bacteria 1224
136 Ga0157379_12547156 3300014968 Bacteria 512
137 Ga0157376_10326515 3300014969 Bacteria 1460
138 Ga0197907_10553248 3300020069 Bacteria 613
139 Ga0206350_11057715 3300020080 Bacteria 586
140 Ga0206350_11533149 3300020080 Bacteria 666
141 Ga0206354_11648484 3300020081 Bacteria 506
142 Ga0206353_10866286 3300020082 Bacteria 884
143 Ga0206353_11638641 3300020082 Bacteria 604
144 Ga0213872_10062067 3300021361 Bacteria 1689
145 Ga0213872_10095321 3300021361 Bacteria 1329
146 Ga0213876_10013905 3300021384 Bacteria 4266
147 Ga0213871_10019972 3300021441 Bacteria 1655
148 Ga0224712_10187538 3300022467 Bacteria 935
149 Ga0209675_1001973 3300025291 Bacteria 11020
150 Ga0209675_1079921 3300025291 Bacteria 607
151 Ga0209676_1085327 3300025292 Bacteria 708
152 Ga0209758_1000119 3300025297 Bacteria 195545
153 Ga0209758_1000128 3300025297 Bacteria 186771
154 Ga0209758_1066060 3300025297 Bacteria 1164
155 Ga0209758_1125264 3300025297 Bacteria 687
156 Ga0209758_1183272 3300025297 Bacteria 502
157 Ga0209051_1022454 3300025303 Bacteria 2656
158 Ga0209257_1000301 3300025304 Bacteria 108454
159 Ga0209257_1022650 3300025304 Bacteria 2233
160 Ga0207643_10191188 3300025908 Bacteria 1243
161 Ga0207705_10305855 3300025909 Bacteria 1220
162 Ga0207684_10210731 3300025910 Bacteria 1676
163 Ga0207684_10440111 3300025910 Bacteria 1119
164 Ga0207707_10133465 3300025912 Bacteria 2171
165 Ga0207707_11218187 3300025912 Bacteria 608
166 Ga0207695_10141839 3300025913 Bacteria 2350
167 Ga0207695_10143673 3300025913 Bacteria 2332
168 Ga0207695_10373394 3300025913 Bacteria 1312
169 Ga0207695_10504001 3300025913 Bacteria 1092
170 Ga0207695_10940795 3300025913 Bacteria 744
171 Ga0207695_11622580 3300025913 Bacteria 527
172 Ga0207671_10327221 3300025914 Bacteria 1213
173 Ga0207693_10202230 3300025915 Bacteria 1562
174 Ga0207663_10113499 3300025916 Bacteria 1843
175 Ga0207660_10153638 3300025917 Bacteria 1770
176 Ga0207660_11217641 3300025917 Bacteria 612
177 Ga0207657_10005707 3300025919 Bacteria 12993
178 Ga0207652_10799994 3300025921 Bacteria 837
179 Ga0207652_10899089 3300025921 Bacteria 782
180 Ga0207652_11142403 3300025921 Bacteria 680
181 Ga0207646_10801715 3300025922 Bacteria 839
182 Ga0207694_10000576 3300025924 Bacteria 33196
183 Ga0207694_10287829 3300025924 Bacteria 1351
184 Ga0207694_10306722 3300025924 Bacteria 1308
185 Ga0207694_10755010 3300025924 Bacteria 821
186 Ga0207694_11289343 3300025924 Bacteria 618
187 Ga0207694_11355637 3300025924 Bacteria 601
188 Ga0207687_10015248 3300025927 Bacteria 5035
189 Ga0207687_10077012 3300025927 Bacteria 2397
190 Ga0207687_10083456 3300025927 Bacteria 2313
191 Ga0207700_10350196 3300025928 Bacteria 1286
192 Ga0207700_11086579 3300025928 Bacteria 715
193 Ga0207700_11488032 3300025928 Bacteria 601
194 Ga0207664_10522393 3300025929 Bacteria 1064
195 Ga0207690_10071037 3300025932 Bacteria 2400
196 Ga0207690_10190084 3300025932 Bacteria 1552
197 Ga0207686_10245254 3300025934 Bacteria 1306
198 Ga0207704_10430031 3300025938 Bacteria 1049
199 Ga0207711_10534766 3300025941 Bacteria 1093
200 Ga0207711_11506364 3300025941 Bacteria 616
201 Ga0207661_10105485 3300025944 Bacteria 2375
202 Ga0207679_10609552 3300025945 Bacteria 984
203 Ga0207667_10100577 3300025949 Bacteria 2982
204 Ga0207667_10361496 3300025949 Bacteria 1480
205 Ga0207667_10564544 3300025949 Bacteria 1150
206 Ga0207667_10927642 3300025949 Bacteria 861
207 Ga0207667_11112731 3300025949 Bacteria 773
208 Ga0207667_11492639 3300025949 Bacteria 647
209 Ga0207651_10504746 3300025960 Bacteria 1046
210 Ga0207658_11162679 3300025986 Bacteria 705
211 Ga0207677_10186994 3300026023 Bacteria 1635
212 Ga0207703_10427977 3300026035 Bacteria 1233
213 Ga0207703_10932933 3300026035 Bacteria 832
214 Ga0207639_10884433 3300026041 Bacteria 835
215 Ga0207702_10803660 3300026078 Bacteria 930
216 Ga0207702_11228728 3300026078 Bacteria 743
217 Ga0207702_11367128 3300026078 Bacteria 702
218 Ga0207702_11812444 3300026078 Bacteria 602
219 Ga0207641_11214449 3300026088 Bacteria 754
220 Ga0207648_10355650 3300026089 Bacteria 1321
221 Ga0207676_10788596 3300026095 Unclassified 926
222 Ga0207676_10847413 3300026095 Bacteria 894
223 Ga0207674_10336661 3300026116 Bacteria 1459
224 Ga0207674_10871971 3300026116 Bacteria 868
225 Ga0207683_10561904 3300026121 Bacteria 1055
226 Ga0207698_10874021 3300026142 Bacteria 905
227 Ga0207698_11169847 3300026142 Bacteria 783
228 Ga0209813_10153910 3300027866 Bacteria 825
229 Ga0268266_10000234 3300028379 Bacteria 94817
230 Ga0268266_10004819 3300028379 Bacteria 12815
231 Ga0268266_10030239 3300028379 Bacteria 4603
232 Ga0268266_11404999 3300028379 Bacteria 673
233 Ga0268264_10648736 3300028381 Bacteria 1044
234 Ga0268264_11046381 3300028381 Bacteria 824
235 Ga0265337_1006137 3300028556 Bacteria 4674
236 Ga0307517_10242089 3300028786 Bacteria 1069
237 Ga0307517_10302991 3300028786 Bacteria 895
238 Ga0265338_10100187 3300028800 Bacteria 2363
239 Ga0307512_10247690 3300030522 Bacteria 892
240 Ga0265332_10090659 3300031238 Bacteria 1293
241 Ga0265332_10420608 3300031238 Bacteria 552
242 Ga0265320_10267647 3300031240 Bacteria 757
243 Ga0265325_10000522 3300031241 Bacteria 27711
244 Ga0265325_10180129 3300031241 Bacteria 984
245 Ga0265325_10322177 3300031241 Bacteria 687
246 Ga0265325_10353626 3300031241 Bacteria 649
247 Ga0265329_10074263 3300031242 Bacteria 1076
248 Ga0265340_10182001 3300031247 Bacteria 950
249 Ga0265340_10303744 3300031247 Bacteria 707
250 Ga0265339_10321551 3300031249 Bacteria 734
251 Ga0265339_10524811 3300031249 Bacteria 546
252 Ga0265339_10545681 3300031249 Bacteria 533
253 Ga0265327_10008743 3300031251 Bacteria 7485
254 Ga0265316_10145852 3300031344 Bacteria 1775
255 Ga0265316_10222129 3300031344 Bacteria 1394
256 Ga0265316_10619756 3300031344 Bacteria 766
257 Ga0307513_10569121 3300031456 Bacteria 844
258 Ga0307408_100932989 3300031548 Bacteria 796
259 Ga0265313_10158627 3300031595 Bacteria 962
260 Ga0265313_10196383 3300031595 Bacteria 841
261 Ga0265314_10000279 3300031711 Bacteria 74300
262 Ga0265314_10057416 3300031711 Bacteria 2673
263 Ga0265314_10476372 3300031711 Bacteria 661
264 Ga0265342_10001077 3300031712 Bacteria 26505
265 Ga0265342_10085159 3300031712 Bacteria 1820
266 Ga0265342_10277595 3300031712 Bacteria 888
267 Ga0307516_10456339 3300031730 Bacteria 934
268 Ga0307410_11197413 3300031852 Bacteria 662
269 Ga0307416_100220252 3300032002 Bacteria 1819
270 Ga0307510_10167430 3300033180 Bacteria 1783
271 Ga0373930_0041938 3300034816 Bacteria 978
272 Ga0373950_0129567 3300034818 Bacteria 564
273 Ga0373944_0298283 3300035089 Bacteria 604
274 Ga0373932_0438985 3300035112 Bacteria 511
275 Ga0373943_0378462 3300035170 Bacteria 815
276 Ga0373946_0113004 3300035171 Bacteria 1231
277 Ga0373931_0289387 3300035691 Bacteria 1008
278 Ga0373935_0062972 3300035692 Bacteria 2377
279 Ga0373947_0266648 3300035725 Bacteria 1136
280 Ga0373947_0288294 3300035725 Bacteria 1093
281 Ga0373947_1224685 3300035725 Bacteria 511
282 Ga0373937_0130753 3300036401 Bacteria 2345
283 Ga0373937_0230901 3300036401 Bacteria 1743
284 Ga0316584_0709493 3300036712 Bacteria 689
285 Ga0373925_0020893 3300037068 Bacteria 4771
286 Ga0373925_0121151 3300037068 Bacteria 2031
287 Ga0395899_0047236 3300037312 Bacteria 3206
288 Ga0395899_0118539 3300037312 Bacteria 1898
289 Ga0395899_0250260 3300037312 Bacteria 1216
290 Ga0395899_0332656 3300037312 Bacteria 1020
291 Ga0395900_0003491 3300037418 Bacteria 16965
292 Ga0395900_0061940 3300037418 Bacteria 3846
293 Ga0395900_0383909 3300037418 Bacteria 1372
294 Ga0395898_0027205 3300037466 Bacteria 5744
295 Ga0395898_0061525 3300037466 Bacteria 3647
296 Ga0395898_0104298 3300037466 Bacteria 2719
297 Ga0395901_0001490 3300038443 Bacteria 24357
298 Ga0395901_0037081 3300038443 Bacteria 5042
299 Ga0395901_0062532 3300038443 Bacteria 3874
300 Ga0395901_0070242 3300038443 Bacteria 3648
301 Ga0395901_0352239 3300038443 Bacteria 1519
302 Ga0395901_0708752 3300038443 Bacteria 1003
303 Ga0436365_1881475 3300039437 Bacteria 6913
304 Ga0436360_0123786 3300039438 Bacteria 811
305 Ga0436360_0312387 3300039438 Bacteria 566
306 Ga0436361_0402996 3300039447 Bacteria 905
307 Ga0436361_0712055 3300039447 Bacteria 1426
308 Ga0436363_0263637 3300039450 Bacteria 1502
309 Ga0439461_0052683 3300041410 Bacteria 906
310 Ga0451804_0331918 3300041463 Bacteria 667
311 Ga0451807_1903504 3300041486 Bacteria 697
312 Ga0451853_1116895 3300041512 Bacteria 547
313 Ga0451577_1991599 3300042876 Bacteria 508
314 Ga0466969_0021347 3300044656 Bacteria 3349
315 Ga0466972_0625427 3300044658 Bacteria 510
316 Ga0466966_0095554 3300044684 Bacteria 1841
317 Ga0466963_0362364 3300044694 Bacteria 1021
318 Ga0466963_0743317 3300044694 Bacteria 692
319 Ga0466970_0263127 3300044765 Bacteria 968
320 Ga0466959_0585590 3300045049 Bacteria 751
321 Ga0451576_0200553 3300045051 Bacteria 2084
322 Ga0495638_0005489 3300046460 Bacteria 9427
323 Ga0495638_0102192 3300046460 Bacteria 1713
324 Ga0495580_0387344 3300046472 Bacteria 944
325 Ga0495584_0570860 3300046491 Bacteria 577
326 Ga0495606_0583122 3300046507 Unclassified 551
327 Ga0495606_0634947 3300046507 Bacteria 519
328 Ga0495608_0677461 3300046511 Bacteria 615
329 Ga0495645_0705823 3300046543 Bacteria 612
330 Ga0495656_0071319 3300046615 Bacteria 1544
331 Ga0495634_0440594 3300046642 Bacteria 770
332 Ga0495625_0116857 3300046660 Bacteria 1819
333 Ga0495625_0792735 3300046660 Bacteria 552
334 Ga0495659_0229906 3300046664 Bacteria 768
335 Ga0495670_0618596 3300046691 Bacteria 590
336 Ga0495672_0297559 3300047320 Bacteria 765
337 Ga0495680_0859064 3300047322 Bacteria 589
338 Ga0495686_0262387 3300047472 Bacteria 966
339 Ga0495686_0611779 3300047472 Bacteria 563
340 Ga0496104_0684236 3300048907 Bacteria 934
341 Ga0496112_1749178 3300048915 Bacteria 534
342 Ga0496125_0312296 3300048928 Bacteria 957
343 Ga0496126_0015930 3300048929 Bacteria 7542
344 Ga0496126_0209046 3300048929 Bacteria 1644
345 Ga0496126_0700417 3300048929 Bacteria 787
346 Ga0501031_0167961 3300049568 Bacteria 1433
347 Ga0501032_0137718 3300049569 Bacteria 1608
348 Ga0501032_0478223 3300049569 Bacteria 797
349 Ga0501033_0120082 3300049570 Bacteria 1908
350 Ga0501033_0181480 3300049570 Bacteria 1509
351 Ga0501033_0656186 3300049570 Bacteria 716
352 Ga0501034_0092659 3300049571 Bacteria 3018
353 Ga0501034_0138579 3300049571 Bacteria 2413
354 Ga0501034_0153806 3300049571 Bacteria 2275
355 Ga0501034_0154054 3300049571 Bacteria 2273
356 Ga0501034_0586535 3300049571 Bacteria 1021
357 Ga0501034_1128374 3300049571 Bacteria 664
358 Ga0501034_1185493 3300049571 Bacteria 643
359 Ga0501036_0185250 3300049572 Bacteria 1752
360 Ga0501036_0870353 3300049572 Bacteria 740
361 Ga0501036_1513685 3300049572 Bacteria 543
362 Ga0501036_1731125 3300049572 Bacteria 503
363 Ga0501037_0092366 3300049573 Bacteria 2189
364 Ga0501037_0213514 3300049573 Bacteria 1360
365 Ga0501037_0306454 3300049573 Bacteria 1102
366 Ga0501037_0470765 3300049573 Bacteria 855
367 Ga0501038_0057149 3300049574 Bacteria 3350
368 Ga0501038_0305548 3300049574 Bacteria 1247
369 Ga0501038_0853899 3300049574 Bacteria 674
370 Ga0501038_1368814 3300049574 Bacteria 509
371 Ga0501039_0021178 3300049575 Bacteria 4988
372 Ga0501039_0290764 3300049575 Bacteria 1285
373 Ga0501039_0442817 3300049575 Bacteria 1020
374 Ga0501040_0226658 3300049576 Bacteria 1330
375 Ga0501041_0033218 3300049577 Bacteria 3121
376 Ga0501042_1410822 3300049578 Bacteria 508
377 Ga0501043_0010963 3300049579 Bacteria 7103
378 Ga0501046_0107882 3300049580 Bacteria 2130
379 Ga0501047_0165673 3300049581 Bacteria 2080
380 Ga0501047_0197418 3300049581 Bacteria 1874
381 Ga0501047_0198480 3300049581 Bacteria 1868
382 Ga0501047_0419048 3300049581 Bacteria 1170
383 Ga0501047_0453350 3300049581 Bacteria 1112
384 Ga0501047_1189566 3300049581 Bacteria 576
385 Ga0501048_0549635 3300049582 Bacteria 828
386 Ga0501067_0182266 3300049583 Bacteria 1169
387 Ga0501067_0324631 3300049583 Bacteria 857
388 Ga0501067_0807054 3300049583 Bacteria 529
389 Ga0501068_0021845 3300049584 Bacteria 3739
390 Ga0501069_0025833 3300049585 Bacteria 3212
391 Ga0501069_0071681 3300049585 Bacteria 1942
392 Ga0501069_0190415 3300049585 Bacteria 1187
393 Ga0501069_0962320 3300049585 Bacteria 521
394 Ga0501070_0023022 3300049586 Bacteria 5215
395 Ga0501070_0035260 3300049586 Bacteria 4182
396 Ga0501070_0052498 3300049586 Bacteria 3384
397 Ga0501070_0059852 3300049586 Bacteria 3157
398 Ga0501070_0115664 3300049586 Bacteria 2215
399 Ga0501070_0141990 3300049586 Bacteria 1982
400 Ga0501070_0358511 3300049586 Bacteria 1183
401 Ga0501071_0033988 3300049587 Bacteria 3626
402 Ga0501071_0397049 3300049587 Bacteria 1053
403 Ga0501072_0024958 3300049588 Bacteria 4654
404 Ga0501072_0107076 3300049588 Bacteria 2224
405 Ga0501072_0801710 3300049588 Bacteria 738
406 Ga0501072_1143253 3300049588 Bacteria 605
407 Ga0501073_0030427 3300049589 Bacteria 3854
408 Ga0501073_0051226 3300049589 Bacteria 2892
409 Ga0501073_0275754 3300049589 Bacteria 1160
410 Ga0501073_0307957 3300049589 Bacteria 1093
411 Ga0501073_0342411 3300049589 Bacteria 1032
412 Ga0501075_0111871 3300049591 Bacteria 2076
413 Ga0501076_0017903 3300049592 Bacteria 5388
414 Ga0501076_0526477 3300049592 Bacteria 974
415 Ga0501076_1240065 3300049592 Bacteria 613
416 Ga0501077_0766398 3300049593 Bacteria 620
417 Ga0501079_0066433 3300049741 Bacteria 2783
418 Ga0501079_0218485 3300049741 Bacteria 1489
419 Ga0501079_0619347 3300049741 Bacteria 852
420 Ga0501080_0055641 3300049742 Bacteria 3685
421 Ga0501080_0062951 3300049742 Bacteria 3452
422 Ga0501080_0380045 3300049742 Bacteria 1273
423 Ga0501080_0476629 3300049742 Bacteria 1117
424 Ga0501080_0599049 3300049742 Bacteria 978
425 Ga0501080_0721134 3300049742 Bacteria 878
426 Ga0501080_1840205 3300049742 Bacteria 508
427 Ga0501081_0057473 3300049743 Bacteria 2690
428 Ga0501081_0253238 3300049743 Bacteria 1286
429 Ga0501081_0370573 3300049743 Bacteria 1057
430 Ga0501081_0777971 3300049743 Bacteria 720
431 Ga0501083_0009203 3300049744 Bacteria 6976
432 Ga0501083_0023666 3300049744 Bacteria 4259
433 Ga0501083_0078250 3300049744 Bacteria 2194
434 Ga0501083_0479178 3300049744 Bacteria 810
435 Ga0501035_0017061 3300049822 Bacteria 6690
436 Ga0501035_0091353 3300049822 Bacteria 2680
437 Ga0501035_0098212 3300049822 Bacteria 2571
438 Ga0501035_0171489 3300049822 Bacteria 1874
439 Ga0501035_0420390 3300049822 Bacteria 1110
440 Ga0501035_0612786 3300049822 Bacteria 886
441 Ga0501044_0043654 3300049823 Bacteria 4657
442 Ga0501044_0083170 3300049823 Bacteria 3237
443 Ga0501044_0085720 3300049823 Bacteria 3182
444 Ga0501044_0124181 3300049823 Bacteria 2579
445 Ga0501044_0214668 3300049823 Bacteria 1877
446 Ga0501044_0264272 3300049823 Bacteria 1658
447 Ga0501044_0309598 3300049823 Bacteria 1506
448 Ga0501044_0373810 3300049823 Bacteria 1341
449 Ga0501044_0839766 3300049823 Bacteria 796
450 Ga0501044_0968425 3300049823 Bacteria 723
451 Ga0501044_1132026 3300049823 Bacteria 651
452 Ga0501044_1281865 3300049823 Bacteria 599
453 Ga0501044_1310197 3300049823 Bacteria 591
454 Ga0501045_0102828 3300049824 Bacteria 2115
455 Ga0501045_1057156 3300049824 Bacteria 594
456 nmdc:mga03n38_758819_c1 3300050490 Bacteria 562
457 nmdc:mga0yw44_232615_c1 3300050492 Bacteria 1223
458 nmdc:mga0k408_100243_c1 3300050493 Bacteria 1707
459 nmdc:mga06z11_1028846_c1 3300050494 Bacteria 502
460 nmdc:mga04h51_179065_c1 3300050495 Bacteria 824
461 nmdc:mga09592_1100667_c1 3300050508 Bacteria 660
462 nmdc:mga0qj67_208862_c1 3300050509 Bacteria 1586
463 nmdc:mga06r32_1886019_c1 3300050510 Bacteria 532
464 nmdc:mga06r32_454390_c1 3300050510 Bacteria 1260
465 nmdc:mga06r32_70105_c1 3300050510 Bacteria 3389
466 nmdc:mga06r32_95580_c1 3300050510 Bacteria 2908
467 nmdc:mga0n895_123090_c1 3300050512 Bacteria 2615
468 nmdc:mga08x19_152017_c2 3300050514 Bacteria 831
469 nmdc:mga0a205_1075949_c1 3300050515 Bacteria 651
470 Ga0495619_0606847 3300053085 Bacteria 748
471 Ga0500578_0038900 3300053086 Bacteria 3055
472 Ga0500643_060060 3300053087 Bacteria 1069
473 Ga0500644_0141490 3300053088 Bacteria 956
474 Ga0500646_0008967 3300053090 Bacteria 2561
475 Ga0500651_0005136 3300053093 Bacteria 7448
476 Ga0500651_0094320 3300053093 Bacteria 1840
477 Ga0500651_0653751 3300053093 Bacteria 566
478 Ga0500641_0006651 3300053096 Bacteria 4105
479 Ga0500641_0007714 3300053096 Bacteria 3835
480 Ga0500641_0019815 3300053096 Bacteria 2546
481 Ga0500641_0060961 3300053096 Bacteria 1571
482 Ga0500650_0211021 3300053098 Bacteria 882
483 Ga0500555_004436 3300053103 Bacteria 3990
484 Ga0500595_000354 3300053119 Bacteria 29968
485 Ga0500595_024954 3300053119 Bacteria 2080
486 Ga0500628_171547 3300053129 Bacteria 616
487 Ga0500642_0001634 3300053130 Bacteria 6470
488 Ga0500642_0079750 3300053130 Bacteria 1502
489 Ga0500642_0161388 3300053130 Bacteria 1050
490 Ga0500652_141732 3300053131 Bacteria 1000
491 Ga0500655_027099 3300053133 Bacteria 1093
492 Ga0500658_0031049 3300053134 Bacteria 2088
493 Ga0500658_0282182 3300053134 Bacteria 763
494 Ga0500658_0442404 3300053134 Bacteria 592
495 Ga0500658_0583764 3300053134 Bacteria 501
496 Ga0500577_0051044 3300053142 Bacteria 1554
497 Ga0500577_0194842 3300053142 Bacteria 873
498 Ga0500588_0003375 3300053146 Bacteria 3368
499 Ga0500588_0179644 3300053146 Bacteria 777
500 Ga0500588_0268508 3300053146 Bacteria 643
501 Ga0500588_0272912 3300053146 Unclassified 637
502 Ga0500616_0000846 3300053153 Bacteria 34311
503 Ga0500616_0063398 3300053153 Bacteria 1906
504 Ga0500622_0155102 3300053156 Bacteria 1079
505 Ga0500633_0138730 3300053160 Bacteria 910
506 Ga0500636_0408679 3300053177 Bacteria 627
507 Ga0500552_000077 3300053733 Bacteria 7977
508 Ga0500599_008291 3300053736 Bacteria 1346
509 Ga0500587_027480 3300053739 Bacteria 767
510 Ga0501084_0084206 3300054114 Bacteria 2669
511 Ga0501084_0344748 3300054114 Bacteria 1258
512 Ga0501082_0001872 3300060353 Bacteria 18517
513 Ga0501082_0019022 3300060353 Bacteria 5917
514 Ga0501082_0044084 3300060353 Bacteria 3848
515 Ga0501082_0636974 3300060353 Bacteria 933
516 Ga0501082_1544249 3300060353 Bacteria 580
517 Ga0501082_1807688 3300060353 Bacteria 533
518 Ga0501082_1986537 3300060353 Bacteria 507
519 Ga0530510_0016715 3300061734 Bacteria 5195
520 2512035016 2511231221 Bacteria 6846400
521 2599101160 2597490356 Bacteria 7030811
522 2837187467 2837183177 Bacteria 4637169
523 2846954120 2846952575 Bacteria 6587527
524 2848859592 2848858292 Bacteria 7391279
525 2883294172 2883291878 Bacteria 5894118
526 2883357301 2883354860 Bacteria 5865246
527 8054008977 8054002106 Bacteria 7987183
528 Ga0070705_100048878
529 JGI25153J46596_10000451
530 Ga0070658_10001821
531 Ga0070658_10056836
532 Ga0070690_101622329
533 Ga0070680_100005313
534 Ga0070680_100579232
535 Ga0070680_101177940
536 Ga0070660_100001961
537 Ga0070687_100637779
538 Ga0070673_100147461
539 Ga0070659_100218056
540 Ga0070659_101321481
541 Ga0070667_102102057
542 Ga0070714_100639064
543 Ga0070711_100335496
544 Ga0070705_101049491
545 Ga0070700_101765558
546 Ga0070694_100013168
547 Ga0070708_100070101
548 Ga0070708_101907032
549 Ga0070678_101119271
550 Ga0070662_100383018
551 Ga0070681_10895290
552 Ga0070706_100024966
553 Ga0070706_100409307
554 Ga0070707_100287699
555 Ga0070707_101316652
556 Ga0070698_100001083
557 Ga0070698_100342816
558 Ga0070699_100118916
559 Ga0070699_101062784
560 Ga0070679_100802905
561 Ga0070684_100962133
562 Ga0070697_100050795
563 Ga0070697_100306782
564 Ga0070686_100095985
565 Ga0070695_100004242
566 Ga0070693_100794761
567 Ga0070665_100006473
568 Ga0070665_100027897
569 Ga0070665_100056753
570 Ga0070704_100058147
571 Ga0070704_100433744
572 Ga0068855_100086099
573 Ga0068855_101423249
574 Ga0068855_101480804
575 Ga0068855_101576239
576 Ga0068855_102167684
577 Ga0070664_100752155
578 Ga0068856_100342876
579 Ga0068856_100486466
580 Ga0068856_101260175
581 Ga0068852_100042611
582 Ga0068852_100138269
583 Ga0068852_102100760
584 Ga0068864_100973876
585 Ga0068863_100313554
586 Ga0068860_100889588
587 Ga0068862_100015240
588 Ga0081455_10010925
589 Ga0081455_10319932
590 Ga0081540_1067027
591 Ga0081539_10090606
592 Ga0081539_10146214
593 Ga0081539_10464163
594 Ga0070716_100130047
595 Ga0070716_101413449
596 Ga0070712_100197004
597 Ga0075362_10414174
598 Ga0075362_10467897
599 Ga0075367_10054663
600 Ga0068871_100450058
601 Ga0075428_100724281
602 Ga0075431_100234340
603 Ga0075431_100333454
604 Ga0075431_100368933
605 Ga0075431_100943919
606 Ga0075433_11182351
607 Ga0075434_100185974
608 Ga0075436_100475543
609 Ga0075435_100663239
610 Ga0099794_10017677
611 Ga0099794_10387977
612 Ga0099795_10025043
613 Ga0099795_10307828
614 Ga0105240_10043860
615 Ga0105240_10125522
616 Ga0105240_10257278
617 Ga0105240_10356973
618 Ga0105240_10586167
619 Ga0105240_11000167
620 Ga0105240_11799776
621 Ga0111539_10738173
622 Ga0105245_10007375
623 Ga0105245_10171127
624 Ga0105245_10710340
625 Ga0105247_11221051
626 Ga0105243_11934628
627 Ga0105243_12386975
628 Ga0105242_10331483
629 Ga0105248_11481264
630 Ga0105248_11757877
631 Ga0105237_10131035
632 Ga0105237_10359068
633 Ga0105237_10502498
634 Ga0105238_10001150
635 Ga0105238_10005370
636 Ga0105238_10231768
637 Ga0105238_10339380
638 Ga0105238_10477184
639 Ga0105238_10702598
640 Ga0105238_10812930
641 Ga0105238_10842167
642 Ga0099796_10462810
643 Ga0105239_10040531
644 Ga0105239_10256960
645 Ga0105239_11084530
646 Ga0105239_12189648
647 Ga0157369_11424469
648 Ga0157374_10326509
649 Ga0157374_11821994
650 Ga0157378_11699753
651 Ga0157372_10236752
652 Ga0157372_12209947
653 Ga0157375_10291768
654 Ga0157375_13113729
655 Ga0163163_10261280
656 Ga0163163_10274609
657 Ga0163163_10585375
658 Ga0163163_10716415
659 Ga0163163_11377217
660 Ga0182008_10032678
661 Ga0157377_11287654
662 Ga0157379_10425236
663 Ga0157379_12547156
664 Ga0157376_10326515
665 Ga0197907_10553248
666 Ga0206350_11057715
667 Ga0206350_11533149
668 Ga0206354_11648484
669 Ga0206353_10866286
670 Ga0206353_11638641
671 Ga0213872_10062067
672 Ga0213872_10095321
673 Ga0213876_10013905
674 Ga0213871_10019972
675 Ga0224712_10187538
676 Ga0209675_1001973
677 Ga0209675_1079921
678 Ga0209676_1085327
679 Ga0209758_1000119
680 Ga0209758_1000128
681 Ga0209758_1066060
682 Ga0209758_1125264
683 Ga0209758_1183272
684 Ga0209051_1022454
685 Ga0209257_1000301
686 Ga0209257_1022650
687 Ga0207643_10191188
688 Ga0207705_10305855
689 Ga0207684_10210731
690 Ga0207684_10440111
691 Ga0207707_10133465
692 Ga0207707_11218187
693 Ga0207695_10141839
694 Ga0207695_10143673
695 Ga0207695_10373394
696 Ga0207695_10504001
697 Ga0207695_10940795
698 Ga0207695_11622580
699 Ga0207671_10327221
700 Ga0207693_10202230
701 Ga0207663_10113499
702 Ga0207660_10153638
703 Ga0207660_11217641
704 Ga0207657_10005707
705 Ga0207652_10799994
706 Ga0207652_10899089
707 Ga0207652_11142403
708 Ga0207646_10801715
709 Ga0207694_10000576
710 Ga0207694_10287829
711 Ga0207694_10306722
712 Ga0207694_10755010
713 Ga0207694_11289343
714 Ga0207694_11355637
715 Ga0207687_10015248
716 Ga0207687_10077012
717 Ga0207687_10083456
718 Ga0207700_10350196
719 Ga0207700_11086579
720 Ga0207700_11488032
721 Ga0207664_10522393
722 Ga0207690_10071037
723 Ga0207690_10190084
724 Ga0207686_10245254
725 Ga0207704_10430031
726 Ga0207711_10534766
727 Ga0207711_11506364
728 Ga0207661_10105485
729 Ga0207679_10609552
730 Ga0207667_10100577
731 Ga0207667_10361496
732 Ga0207667_10564544
733 Ga0207667_10927642
734 Ga0207667_11112731
735 Ga0207667_11492639
736 Ga0207651_10504746
737 Ga0207658_11162679
738 Ga0207677_10186994
739 Ga0207703_10427977
740 Ga0207703_10932933
741 Ga0207639_10884433
742 Ga0207702_10803660
743 Ga0207702_11228728
744 Ga0207702_11367128
745 Ga0207702_11812444
746 Ga0207641_11214449
747 Ga0207648_10355650
748 Ga0207676_10788596
749 Ga0207676_10847413
750 Ga0207674_10336661
751 Ga0207674_10871971
752 Ga0207683_10561904
753 Ga0207698_10874021
754 Ga0207698_11169847
755 Ga0209813_10153910
756 Ga0268266_10000234
757 Ga0268266_10004819
758 Ga0268266_10030239
759 Ga0268266_11404999
760 Ga0268264_10648736
761 Ga0268264_11046381
762 Ga0265337_1006137
763 Ga0307517_10242089
764 Ga0307517_10302991
765 Ga0265338_10100187
766 Ga0307512_10247690
767 Ga0265332_10090659
768 Ga0265332_10420608
769 Ga0265320_10267647
770 Ga0265325_10000522
771 Ga0265325_10180129
772 Ga0265325_10322177
773 Ga0265325_10353626
774 Ga0265329_10074263
775 Ga0265340_10182001
776 Ga0265340_10303744
777 Ga0265339_10321551
778 Ga0265339_10524811
779 Ga0265339_10545681
780 Ga0265327_10008743
781 Ga0265316_10145852
782 Ga0265316_10222129
783 Ga0265316_10619756
784 Ga0307513_10569121
785 Ga0307408_100932989
786 Ga0265313_10158627
787 Ga0265313_10196383
788 Ga0265314_10000279
789 Ga0265314_10057416
790 Ga0265314_10476372
791 Ga0265342_10001077
792 Ga0265342_10085159
793 Ga0265342_10277595
794 Ga0307516_10456339
795 Ga0307410_11197413
796 Ga0307416_100220252
797 Ga0307510_10167430
798 Ga0373930_0041938
799 Ga0373950_0129567
800 Ga0373944_0298283
801 Ga0373932_0438985
802 Ga0373943_0378462
803 Ga0373946_0113004
804 Ga0373931_0289387
805 Ga0373935_0062972
806 Ga0373947_0266648
807 Ga0373947_0288294
808 Ga0373947_1224685
809 Ga0373937_0130753
810 Ga0373937_0230901
811 Ga0316584_0709493
812 Ga0373925_0020893
813 Ga0373925_0121151
814 Ga0395899_0047236
815 Ga0395899_0118539
816 Ga0395899_0250260
817 Ga0395899_0332656
818 Ga0395900_0003491
819 Ga0395900_0061940
820 Ga0395900_0383909
821 Ga0395898_0027205
822 Ga0395898_0061525
823 Ga0395898_0104298
824 Ga0395901_0001490
825 Ga0395901_0037081
826 Ga0395901_0062532
827 Ga0395901_0070242
828 Ga0395901_0352239
829 Ga0395901_0708752
830 Ga0436365_1881475
831 Ga0436360_0123786
832 Ga0436360_0312387
833 Ga0436361_0402996
834 Ga0436361_0712055
835 Ga0436363_0263637
836 Ga0439461_0052683
837 Ga0451804_0331918
838 Ga0451807_1903504
839 Ga0451853_1116895
840 Ga0451577_1991599
841 Ga0466969_0021347
842 Ga0466972_0625427
843 Ga0466966_0095554
844 Ga0466963_0362364
845 Ga0466963_0743317
846 Ga0466970_0263127
847 Ga0466959_0585590
848 Ga0451576_0200553
849 Ga0495638_0005489
850 Ga0495638_0102192
851 Ga0495580_0387344
852 Ga0495584_0570860
853 Ga0495606_0583122
854 Ga0495606_0634947
855 Ga0495608_0677461
856 Ga0495645_0705823
857 Ga0495656_0071319
858 Ga0495634_0440594
859 Ga0495625_0116857
860 Ga0495625_0792735
861 Ga0495659_0229906
862 Ga0495670_0618596
863 Ga0495672_0297559
864 Ga0495680_0859064
865 Ga0495686_0262387
866 Ga0495686_0611779
867 Ga0496104_0684236
868 Ga0496112_1749178
869 Ga0496125_0312296
870 Ga0496126_0015930
871 Ga0496126_0209046
872 Ga0496126_0700417
873 Ga0501031_0167961
874 Ga0501032_0137718
875 Ga0501032_0478223
876 Ga0501033_0120082
877 Ga0501033_0181480
878 Ga0501033_0656186
879 Ga0501034_0092659
880 Ga0501034_0138579
881 Ga0501034_0153806
882 Ga0501034_0154054
883 Ga0501034_0586535
884 Ga0501034_1128374
885 Ga0501034_1185493
886 Ga0501036_0185250
887 Ga0501036_0870353
888 Ga0501036_1513685
889 Ga0501036_1731125
890 Ga0501037_0092366
891 Ga0501037_0213514
892 Ga0501037_0306454
893 Ga0501037_0470765
894 Ga0501038_0057149
895 Ga0501038_0305548
896 Ga0501038_0853899
897 Ga0501038_1368814
898 Ga0501039_0021178
899 Ga0501039_0290764
900 Ga0501039_0442817
901 Ga0501040_0226658
902 Ga0501041_0033218
903 Ga0501042_1410822
904 Ga0501043_0010963
905 Ga0501046_0107882
906 Ga0501047_0165673
907 Ga0501047_0197418
908 Ga0501047_0198480
909 Ga0501047_0419048
910 Ga0501047_0453350
911 Ga0501047_1189566
912 Ga0501048_0549635
913 Ga0501067_0182266
914 Ga0501067_0324631
915 Ga0501067_0807054
916 Ga0501068_0021845
917 Ga0501069_0025833
918 Ga0501069_0071681
919 Ga0501069_0190415
920 Ga0501069_0962320
921 Ga0501070_0023022
922 Ga0501070_0035260
923 Ga0501070_0052498
924 Ga0501070_0059852
925 Ga0501070_0115664
926 Ga0501070_0141990
927 Ga0501070_0358511
928 Ga0501071_0033988
929 Ga0501071_0397049
930 Ga0501072_0024958
931 Ga0501072_0107076
932 Ga0501072_0801710
933 Ga0501072_1143253
934 Ga0501073_0030427
935 Ga0501073_0051226
936 Ga0501073_0275754
937 Ga0501073_0307957
938 Ga0501073_0342411
939 Ga0501075_0111871
940 Ga0501076_0017903
941 Ga0501076_0526477
942 Ga0501076_1240065
943 Ga0501077_0766398
944 Ga0501079_0066433
945 Ga0501079_0218485
946 Ga0501079_0619347
947 Ga0501080_0055641
948 Ga0501080_0062951
949 Ga0501080_0380045
950 Ga0501080_0476629
951 Ga0501080_0599049
952 Ga0501080_0721134
953 Ga0501080_1840205
954 Ga0501081_0057473
955 Ga0501081_0253238
956 Ga0501081_0370573
957 Ga0501081_0777971
958 Ga0501083_0009203
959 Ga0501083_0023666
960 Ga0501083_0078250
961 Ga0501083_0479178
962 Ga0501035_0017061
963 Ga0501035_0091353
964 Ga0501035_0098212
965 Ga0501035_0171489
966 Ga0501035_0420390
967 Ga0501035_0612786
968 Ga0501044_0043654
969 Ga0501044_0083170
970 Ga0501044_0085720
971 Ga0501044_0124181
972 Ga0501044_0214668
973 Ga0501044_0264272
974 Ga0501044_0309598
975 Ga0501044_0373810
976 Ga0501044_0839766
977 Ga0501044_0968425
978 Ga0501044_1132026
979 Ga0501044_1281865
980 Ga0501044_1310197
981 Ga0501045_0102828
982 Ga0501045_1057156
983 nmdc:mga03n38_758819_c1
984 nmdc:mga0yw44_232615_c1
985 nmdc:mga0k408_100243_c1
986 nmdc:mga06z11_1028846_c1
987 nmdc:mga04h51_179065_c1
988 nmdc:mga09592_1100667_c1
989 nmdc:mga0qj67_208862_c1
990 nmdc:mga06r32_1886019_c1
991 nmdc:mga06r32_454390_c1
992 nmdc:mga06r32_70105_c1
993 nmdc:mga06r32_95580_c1
994 nmdc:mga0n895_123090_c1
995 nmdc:mga08x19_152017_c2
996 nmdc:mga0a205_1075949_c1
997 Ga0495619_0606847
998 Ga0500578_0038900
999 Ga0500643_060060
1000 Ga0500644_0141490
1001 Ga0500646_0008967
1002 Ga0500651_0005136
1003 Ga0500651_0094320
1004 Ga0500651_0653751
1005 Ga0500641_0006651
1006 Ga0500641_0007714
1007 Ga0500641_0019815
1008 Ga0500641_0060961
1009 Ga0500650_0211021
1010 Ga0500555_004436
1011 Ga0500595_000354
1012 Ga0500595_024954
1013 Ga0500628_171547
1014 Ga0500642_0001634
1015 Ga0500642_0079750
1016 Ga0500642_0161388
1017 Ga0500652_141732
1018 Ga0500655_027099
1019 Ga0500658_0031049
1020 Ga0500658_0282182
1021 Ga0500658_0442404
1022 Ga0500658_0583764
1023 Ga0500577_0051044
1024 Ga0500577_0194842
1025 Ga0500588_0003375
1026 Ga0500588_0179644
1027 Ga0500588_0268508
1028 Ga0500588_0272912
1029 Ga0500616_0000846
1030 Ga0500616_0063398
1031 Ga0500622_0155102
1032 Ga0500633_0138730
1033 Ga0500636_0408679
1034 Ga0500552_000077
1035 Ga0500599_008291
1036 Ga0500587_027480
1037 Ga0501084_0084206
1038 Ga0501084_0344748
1039 Ga0501082_0001872
1040 Ga0501082_0019022
1041 Ga0501082_0044084
1042 Ga0501082_0636974
1043 Ga0501082_1544249
1044 Ga0501082_1807688
1045 Ga0501082_1986537
1046 Ga0530510_0016715
1047 2512035016
1048 2599101160
1049 2837187467
1050 2846954120
1051 2848859592
1052 2883294172
1053 2883357301
1054 8054008977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02625

XdhC_CoxI

XdhC and CoxI family

24

91

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2we8-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.9101 7 106
2we7-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.9059 6 106
2we8-assembly2.cif.gz_B-3 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.8823 6 106
2we7-assembly2.cif.gz_B-3 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.863 6 106
3on5-assembly1.cif.gz_B crystal structure of a xanthine dehydrogenase (bh1974) from bacillus halodurans at 2.80 a resolution 0.7883 9 107
ID Description Score Start End Superfamily
3da7B00 Alpha Beta;3-Layer(aba) Sandwich;Severin; 0.5917 19 55 3.40.20.20
af_P38177_10_203_3.30.70.3250 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribonuclease P, Pop5 subunit 0.536 70 106 3.30.70.3250
af_Q6PE55_273_375_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5359 72 107 2.60.40.10
af_Q4D0I3_89_163_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.4793 39 73 3.30.310.10
af_O73878_199_258_2.60.40.1770 Mainly Beta;Sandwich;Immunoglobulin-like;ephrin a2 ectodomain 0.4769 22 55 2.60.40.1770
ID Description Score Start End GO Terms
AF-A0A6J4MFV2-F1-model_v4 Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family 0.9491 1 107
AF-A0A7L5XZ15-F1-model_v4 XdhC family protein 0.9462 1 107
AF-A0A7W4YXT7-F1-model_v4 Xanthine/CO dehydrogenase XdhC/CoxF family maturation factor 0.945 1 107
AF-A0A7X5F4A8-F1-model_v4 XdhC family protein 0.9418 6 107
AF-A0A2E6GLP0-F1-model_v4 Xanthine dehydrogenase 0.9413 5 107

Map