F459443

General Info

Members Datasets Scaffolds Average Seq Length
526 283 1052 110

Family's Representative Sequence

Representative Sequence 3300041496|Ga0451839_0490595|Ga0451839_0490595_28_429
Length 133
Sequence MQSTVPAPWISLFDGRTLTGWRGLGSSGVPTAHWVVENGAIRKIPSGKVPVQADGQPLEGTCEGQMACSTCHIIVDAADFDRLPRPSEDEEDMLDLAAGATRTSRLSCQIWLDETLDGLTVRIPGEVRNMQGR

Samples

Sample ID Description Type Environment
1 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
172 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
254 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
255 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
256 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
257 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
260 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
271 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
272 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
273 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
274 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
277 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
280 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
281 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 2643221605 Sphingomonas sp. Root710 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.19
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.46
Nodule 0
Rhizoplane 3.04
Rhizosphere 79.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451839_0490595 3300041496 Bacteria 551
2 JGI24736J21556_1015671 3300001904 Bacteria 1212
3 JGI24740J21852_10037046 3300001979 Bacteria 1509
4 JGI24740J21852_10097790 3300001979 Bacteria 750
5 JGI24739J22299_10021635 3300001989 Bacteria 2288
6 JGI24737J22298_10000699 3300001990 Bacteria 11786
7 JGI24737J22298_10000761 3300001990 Bacteria 11382
8 JGI24737J22298_10001359 3300001990 Bacteria 8661
9 JGI24737J22298_10041297 3300001990 Bacteria 1415
10 JGI24737J22298_10104173 3300001990 Bacteria 840
11 JGI24743J22301_10028117 3300001991 Bacteria 1100
12 JGI24735J21928_10001740 3300002067 Bacteria 7685
13 JGI24735J21928_10002608 3300002067 Bacteria 6230
14 JGI24735J21928_10016878 3300002067 Bacteria 2261
15 JGI24735J21928_10022189 3300002067 Bacteria 1935
16 JGI24735J21928_10096806 3300002067 Bacteria 847
17 JGI24738J21930_10000097 3300002075 Bacteria 19932
18 JGI24738J21930_10099099 3300002075 Bacteria 621
19 JGI24738J21930_10104343 3300002075 Bacteria 607
20 JGI24744J21845_10000233 3300002077 Bacteria 8942
21 JGI24742J22300_10076582 3300002244 Bacteria 628
22 JGI25165J46597_1000012 3300003214 Bacteria 421074
23 JGI25153J46596_10000016 3300003215 Bacteria 285917
24 rootH1_10139276 3300003316 Bacteria 2216
25 rootH2_10035101 3300003320 Bacteria 1039
26 rootL2_10091933 3300003322 Bacteria 1770
27 rootL2_10149426 3300003322 Bacteria 2334
28 rootL2_10158808 3300003322 Bacteria 2641
29 rootH1_10085343 3300003323 Bacteria 2701
30 Ga0055525_1000090 3300003759 Bacteria 141071
31 Ga0055542_1001886 3300003762 Bacteria 8337
32 Ga0065165_1001406 3300005262 Bacteria 26221
33 Ga0070658_10000900 3300005327 Bacteria 25471
34 Ga0070658_10008833 3300005327 Bacteria 8102
35 Ga0070658_10055210 3300005327 Bacteria 3227
36 Ga0070658_10199678 3300005327 Bacteria 1687
37 Ga0070658_10404575 3300005327 Bacteria 1173
38 Ga0070676_10052394 3300005328 Bacteria 2399
39 Ga0070683_100874627 3300005329 Bacteria 862
40 Ga0070670_100000371 3300005331 Bacteria 37336
41 Ga0070670_100216038 3300005331 Bacteria 1668
42 Ga0070670_102156074 3300005331 Bacteria 513
43 Ga0068869_100189621 3300005334 Bacteria 1616
44 Ga0070666_10066379 3300005335 Bacteria 2448
45 Ga0070680_101150036 3300005336 Bacteria 671
46 Ga0070660_100041096 3300005339 Bacteria 3523
47 Ga0070660_100092729 3300005339 Bacteria 2384
48 Ga0070660_100591302 3300005339 Bacteria 927
49 Ga0070660_101609913 3300005339 Bacteria 553
50 Ga0070661_100038478 3300005344 Bacteria 3482
51 Ga0070668_100000006 3300005347 Bacteria 176486
52 Ga0070668_100100122 3300005347 Bacteria 2296
53 Ga0070669_100004839 3300005353 Bacteria 9719
54 Ga0070675_100045483 3300005354 Bacteria 3592
55 Ga0070675_100814313 3300005354 Bacteria 854
56 Ga0070671_100000120 3300005355 Bacteria 50898
57 Ga0070671_100033488 3300005355 Bacteria 4250
58 Ga0070674_100044992 3300005356 Bacteria 3014
59 Ga0070674_100057220 3300005356 Bacteria 2706
60 Ga0070659_100009565 3300005366 Bacteria 7123
61 Ga0070659_100058401 3300005366 Bacteria 3044
62 Ga0070659_100058655 3300005366 Bacteria 3038
63 Ga0070667_100000003 3300005367 Bacteria 447715
64 Ga0070667_100130758 3300005367 Bacteria 2190
65 Ga0070700_100478893 3300005441 Bacteria 953
66 Ga0070663_100070615 3300005455 Bacteria 2540
67 Ga0070663_100096886 3300005455 Bacteria 2195
68 Ga0070678_100002410 3300005456 Bacteria 10240
69 Ga0070662_100006767 3300005457 Bacteria 7412
70 Ga0070662_100019466 3300005457 Bacteria 4607
71 Ga0070662_100078887 3300005457 Bacteria 2447
72 Ga0070681_10757460 3300005458 Bacteria 888
73 Ga0068867_101098400 3300005459 Bacteria 726
74 Ga0070679_101233957 3300005530 Bacteria 693
75 Ga0070684_100559436 3300005535 Bacteria 1062
76 Ga0068853_100049687 3300005539 Bacteria 3605
77 Ga0068853_100271370 3300005539 Bacteria 1562
78 Ga0068853_100314979 3300005539 Bacteria 1449
79 Ga0068853_101184679 3300005539 Bacteria 737
80 Ga0068853_102151430 3300005539 Bacteria 541
81 Ga0070672_100024079 3300005543 Bacteria 4493
82 Ga0070672_100085151 3300005543 Bacteria 2540
83 Ga0070686_100584504 3300005544 Bacteria 878
84 Ga0070693_100025532 3300005547 Bacteria 3182
85 Ga0070665_100000044 3300005548 Bacteria 276702
86 Ga0070665_101194945 3300005548 Bacteria 771
87 Ga0070665_101482669 3300005548 Bacteria 687
88 Ga0068855_100000230 3300005563 Bacteria 71687
89 Ga0068855_100014825 3300005563 Bacteria 9387
90 Ga0068855_101509316 3300005563 Bacteria 690
91 Ga0068855_102037582 3300005563 Bacteria 579
92 Ga0070664_100871424 3300005564 Bacteria 843
93 Ga0068857_101719002 3300005577 Bacteria 613
94 Ga0068854_100005813 3300005578 Bacteria 7813
95 Ga0068854_100058020 3300005578 Bacteria 2793
96 Ga0068854_100082064 3300005578 Bacteria 2383
97 Ga0068854_100772509 3300005578 Bacteria 835
98 Ga0068854_101855054 3300005578 Bacteria 553
99 Ga0068856_100425218 3300005614 Bacteria 1348
100 Ga0068856_100529544 3300005614 Bacteria 1199
101 Ga0068852_100000145 3300005616 Bacteria 47983
102 Ga0068852_100188782 3300005616 Bacteria 1943
103 Ga0068852_100316966 3300005616 Bacteria 1513
104 Ga0068859_100029568 3300005617 Bacteria 5498
105 Ga0068859_100032913 3300005617 Bacteria 5207
106 Ga0068859_100457504 3300005617 Bacteria 1372
107 Ga0068864_100392504 3300005618 Bacteria 1317
108 Ga0068861_100198822 3300005719 Bacteria 1681
109 Ga0068861_100864703 3300005719 Bacteria 854
110 Ga0068851_10024203 3300005834 Bacteria 2972
111 Ga0068863_100001154 3300005841 Bacteria 26381
112 Ga0068863_100002036 3300005841 Bacteria 20033
113 Ga0068863_100119337 3300005841 Bacteria 2514
114 Ga0068858_100006136 3300005842 Bacteria 11721
115 Ga0068860_100000068 3300005843 Bacteria 179208
116 Ga0068862_100000179 3300005844 Bacteria 69539
117 Ga0068862_100000267 3300005844 Bacteria 58000
118 Ga0081539_10012235 3300005985 Bacteria 6653
119 Ga0075368_10000181 3300006042 Bacteria 17217
120 Ga0075363_100120478 3300006048 Bacteria 1465
121 Ga0075364_10175748 3300006051 Bacteria 1448
122 Ga0075367_10000814 3300006178 Bacteria 12310
123 Ga0075369_10101416 3300006186 Bacteria 1291
124 Ga0097621_100062171 3300006237 Bacteria 3065
125 Ga0097621_100945628 3300006237 Bacteria 804
126 Ga0075370_10014296 3300006353 Bacteria 4234
127 Ga0075370_10078046 3300006353 Bacteria 1901
128 Ga0068871_100018004 3300006358 Bacteria 5360
129 Ga0068871_101694910 3300006358 Bacteria 599
130 Ga0097620_100029568 3300006931 Bacteria 5498
131 Ga0097620_100032913 3300006931 Bacteria 5207
132 Ga0097620_100457516 3300006931 Bacteria 1372
133 Ga0097620_100884835 3300006931 Bacteria 978
134 Ga0105251_10098212 3300009011 Bacteria 1340
135 Ga0105240_10083291 3300009093 Bacteria 3925
136 Ga0105240_10157687 3300009093 Bacteria 2698
137 Ga0105240_10392462 3300009093 Bacteria 1565
138 Ga0105240_11356476 3300009093 Bacteria 748
139 Ga0105240_12032248 3300009093 Bacteria 597
140 Ga0105245_10003985 3300009098 Bacteria 13132
141 Ga0105243_10192187 3300009148 Bacteria 1783
142 Ga0105241_10007791 3300009174 Bacteria 7876
143 Ga0105241_10014976 3300009174 Bacteria 5679
144 Ga0105242_10367820 3300009176 Bacteria 1333
145 Ga0105242_13129124 3300009176 Bacteria 513
146 Ga0105237_10103211 3300009545 Bacteria 2843
147 Ga0105237_10136962 3300009545 Bacteria 2443
148 Ga0105238_10164389 3300009551 Bacteria 2195
149 Ga0105238_10492184 3300009551 Bacteria 1226
150 Ga0105238_10496872 3300009551 Bacteria 1220
151 Ga0105238_10587936 3300009551 Bacteria 1120
152 Ga0105249_10000004 3300009553 Bacteria 368014
153 Ga0105249_10112104 3300009553 Bacteria 2579
154 Ga0105239_10042781 3300010375 Bacteria 4963
155 Ga0105239_10153741 3300010375 Bacteria 2568
156 Ga0105239_10213362 3300010375 Bacteria 2164
157 Ga0105239_11569608 3300010375 Bacteria 761
158 Ga0157317_1011415 3300012475 Bacteria 692
159 Ga0157373_10030441 3300013100 Bacteria 3885
160 Ga0157373_10156247 3300013100 Bacteria 1604
161 Ga0157373_10229827 3300013100 Bacteria 1310
162 Ga0157373_10378509 3300013100 Bacteria 1012
163 Ga0157371_10002630 3300013102 Bacteria 17029
164 Ga0157371_10051879 3300013102 Bacteria 2914
165 Ga0157371_10057889 3300013102 Bacteria 2749
166 Ga0157371_10216492 3300013102 Bacteria 1375
167 Ga0157370_10453449 3300013104 Bacteria 1179
168 Ga0157369_10249566 3300013105 Bacteria 1852
169 Ga0157369_10829431 3300013105 Bacteria 949
170 Ga0157374_10230385 3300013296 Bacteria 1820
171 Ga0157374_11013728 3300013296 Bacteria 849
172 Ga0157378_10314271 3300013297 Bacteria 1520
173 Ga0163162_10082099 3300013306 Bacteria 3295
174 Ga0163162_10243920 3300013306 Bacteria 1928
175 Ga0163162_11340178 3300013306 Bacteria 814
176 Ga0157372_10009684 3300013307 Bacteria 10242
177 Ga0157372_10035394 3300013307 Bacteria 5497
178 Ga0157372_10209943 3300013307 Bacteria 2256
179 Ga0157372_10401832 3300013307 Bacteria 1596
180 Ga0157372_10814960 3300013307 Bacteria 1084
181 Ga0157372_10840215 3300013307 Bacteria 1066
182 Ga0157372_10847198 3300013307 Bacteria 1061
183 Ga0157372_10998173 3300013307 Bacteria 970
184 Ga0157375_10245944 3300013308 Bacteria 1949
185 Ga0157380_10001031 3300014326 Bacteria 17783
186 Ga0157376_11780920 3300014969 Bacteria 652
187 Ga0163161_10029991 3300017792 Bacteria 3868
188 Ga0163161_10068452 3300017792 Bacteria 2594
189 Ga0213876_10052628 3300021384 Bacteria 2152
190 Ga0209674_105535 3300025226 Bacteria 1850
191 Ga0209674_110116 3300025226 Bacteria 1020
192 Ga0209563_100111 3300025230 Bacteria 141123
193 Ga0209026_1028336 3300025250 Bacteria 837
194 Ga0209677_108624 3300025253 Bacteria 1946
195 Ga0209148_1000127 3300025254 Bacteria 181586
196 Ga0209233_1000058 3300025261 Bacteria 421872
197 Ga0209233_1070552 3300025261 Bacteria 647
198 Ga0209455_1013032 3300025272 Bacteria 1953
199 Ga0209758_1000035 3300025297 Bacteria 448190
200 Ga0209758_1079912 3300025297 Bacteria 993
201 Ga0207656_10042720 3300025321 Bacteria 1930
202 Ga0207682_10034472 3300025893 Bacteria 2040
203 Ga0207688_10085763 3300025901 Bacteria 1803
204 Ga0207647_10000916 3300025904 Bacteria 22756
205 Ga0207647_10037846 3300025904 Bacteria 3055
206 Ga0207647_10212099 3300025904 Bacteria 1118
207 Ga0207647_10253022 3300025904 Bacteria 1010
208 Ga0207647_10352603 3300025904 Bacteria 833
209 Ga0207645_10041332 3300025907 Bacteria 2952
210 Ga0207645_10155046 3300025907 Bacteria 1496
211 Ga0207705_10000027 3300025909 Bacteria 248863
212 Ga0207705_10000371 3300025909 Bacteria 40611
213 Ga0207705_10046735 3300025909 Bacteria 3112
214 Ga0207705_10172386 3300025909 Bacteria 1629
215 Ga0207705_10190948 3300025909 Bacteria 1549
216 Ga0207705_10210794 3300025909 Bacteria 1474
217 Ga0207654_10000535 3300025911 Bacteria 21712
218 Ga0207695_10022017 3300025913 Bacteria 7253
219 Ga0207695_10633255 3300025913 Bacteria 951
220 Ga0207671_10036876 3300025914 Bacteria 3626
221 Ga0207671_10351738 3300025914 Bacteria 1168
222 Ga0207671_10743357 3300025914 Bacteria 779
223 Ga0207671_11484842 3300025914 Bacteria 524
224 Ga0207657_10017473 3300025919 Bacteria 6874
225 Ga0207657_10022838 3300025919 Bacteria 5839
226 Ga0207657_10130240 3300025919 Bacteria 2062
227 Ga0207649_10000616 3300025920 Bacteria 24069
228 Ga0207649_10529037 3300025920 Bacteria 900
229 Ga0207649_10802983 3300025920 Bacteria 734
230 Ga0207652_10783070 3300025921 Bacteria 848
231 Ga0207652_11294405 3300025921 Bacteria 631
232 Ga0207681_10002686 3300025923 Bacteria 11265
233 Ga0207681_10098244 3300025923 Bacteria 2106
234 Ga0207694_10153297 3300025924 Bacteria 1857
235 Ga0207650_10001839 3300025925 Bacteria 14979
236 Ga0207650_10070032 3300025925 Bacteria 2636
237 Ga0207650_10193600 3300025925 Bacteria 1626
238 Ga0207659_10004692 3300025926 Bacteria 8279
239 Ga0207687_10004882 3300025927 Bacteria 8910
240 Ga0207687_10982257 3300025927 Bacteria 724
241 Ga0207644_10000442 3300025931 Bacteria 26820
242 Ga0207644_10050073 3300025931 Bacteria 2993
243 Ga0207644_10322643 3300025931 Bacteria 1249
244 Ga0207644_10481185 3300025931 Bacteria 1022
245 Ga0207690_10003772 3300025932 Bacteria 8973
246 Ga0207690_10004361 3300025932 Bacteria 8353
247 Ga0207690_10274736 3300025932 Bacteria 1310
248 Ga0207706_10008441 3300025933 Bacteria 9505
249 Ga0207706_10169498 3300025933 Bacteria 1918
250 Ga0207706_10335591 3300025933 Bacteria 1315
251 Ga0207706_10402367 3300025933 Bacteria 1187
252 Ga0207709_10237490 3300025935 Bacteria 1324
253 Ga0207669_10062619 3300025937 Bacteria 2292
254 Ga0207691_10043007 3300025940 Bacteria 4164
255 Ga0207691_10151574 3300025940 Bacteria 2038
256 Ga0207689_10222018 3300025942 Bacteria 1561
257 Ga0207689_11813591 3300025942 Bacteria 503
258 Ga0207679_10787774 3300025945 Bacteria 866
259 Ga0207667_10000010 3300025949 Bacteria 477432
260 Ga0207667_10000072 3300025949 Bacteria 177312
261 Ga0207667_10016495 3300025949 Bacteria 8345
262 Ga0207667_10751669 3300025949 Bacteria 974
263 Ga0207667_10991845 3300025949 Bacteria 828
264 Ga0207712_10000008 3300025961 Bacteria 527957
265 Ga0207668_10000110 3300025972 Bacteria 58891
266 Ga0207640_10000366 3300025981 Bacteria 29388
267 Ga0207640_10001641 3300025981 Bacteria 11988
268 Ga0207640_10014787 3300025981 Bacteria 4501
269 Ga0207640_10042547 3300025981 Bacteria 2897
270 Ga0207658_10000002 3300025986 Bacteria 1364188
271 Ga0207658_10038721 3300025986 Bacteria 3437
272 Ga0207703_10000489 3300026035 Bacteria 41162
273 Ga0207703_10001758 3300026035 Bacteria 19365
274 Ga0207639_10008154 3300026041 Bacteria 7163
275 Ga0207639_10037108 3300026041 Bacteria 3618
276 Ga0207639_10845964 3300026041 Bacteria 854
277 Ga0207639_11172041 3300026041 Bacteria 721
278 Ga0207678_10007193 3300026067 Bacteria 9867
279 Ga0207678_10013250 3300026067 Bacteria 7235
280 Ga0207702_10003263 3300026078 Bacteria 14976
281 Ga0207702_10021336 3300026078 Bacteria 5361
282 Ga0207641_10000282 3300026088 Bacteria 63828
283 Ga0207641_10005995 3300026088 Bacteria 10299
284 Ga0207641_10011182 3300026088 Bacteria 7362
285 Ga0207648_11001334 3300026089 Bacteria 783
286 Ga0207676_12025246 3300026095 Bacteria 574
287 Ga0207674_10025270 3300026116 Bacteria 6338
288 Ga0207674_10052197 3300026116 Bacteria 4170
289 Ga0207674_10140532 3300026116 Bacteria 2374
290 Ga0207674_11167916 3300026116 Bacteria 739
291 Ga0207675_100216381 3300026118 Bacteria 1845
292 Ga0207675_102394585 3300026118 Bacteria 540
293 Ga0207683_10006133 3300026121 Bacteria 10296
294 Ga0207683_10465455 3300026121 Bacteria 1166
295 Ga0207698_10000106 3300026142 Bacteria 52547
296 Ga0207698_10039682 3300026142 Bacteria 3490
297 Ga0207698_10291374 3300026142 Bacteria 1515
298 Ga0207698_10729995 3300026142 Bacteria 988
299 Ga0207698_10829673 3300026142 Bacteria 928
300 Ga0209813_10000099 3300027866 Bacteria 32132
301 Ga0268266_10000002 3300028379 Bacteria 3059047
302 Ga0268266_10288865 3300028379 Bacteria 1527
303 Ga0268266_11501037 3300028379 Bacteria 649
304 Ga0268265_10000199 3300028380 Bacteria 69539
305 Ga0268265_10002621 3300028380 Bacteria 13371
306 Ga0268264_10000103 3300028381 Bacteria 222439
307 Ga0268264_11079255 3300028381 Bacteria 811
308 Ga0307513_10062617 3300031456 Bacteria 3931
309 Ga0307408_100517781 3300031548 Bacteria 1047
310 Ga0307408_101523983 3300031548 Bacteria 633
311 Ga0307408_101539095 3300031548 Bacteria 630
312 Ga0307508_10008660 3300031616 Bacteria 9392
313 Ga0307405_10470380 3300031731 Bacteria 1001
314 Ga0307405_10786228 3300031731 Bacteria 796
315 Ga0307413_10879393 3300031824 Bacteria 759
316 Ga0307410_10475706 3300031852 Bacteria 1024
317 Ga0307406_10379116 3300031901 Bacteria 1114
318 Ga0307412_10120355 3300031911 Bacteria 1889
319 Ga0307412_10301302 3300031911 Bacteria 1267
320 Ga0307409_100564244 3300031995 Bacteria 1120
321 Ga0307416_100606231 3300032002 Bacteria 1175
322 Ga0307416_100670534 3300032002 Bacteria 1124
323 Ga0307414_10021010 3300032004 Bacteria 4083
324 Ga0307414_10195275 3300032004 Bacteria 1641
325 Ga0307414_11341367 3300032004 Bacteria 664
326 Ga0307411_10136848 3300032005 Bacteria 1800
327 Ga0307411_10402434 3300032005 Bacteria 1132
328 Ga0307411_10650722 3300032005 Bacteria 912
329 Ga0307415_100140098 3300032126 Bacteria 1846
330 Ga0307415_101514670 3300032126 Bacteria 642
331 Ga0307510_10090381 3300033180 Bacteria 2909
332 Ga0307510_10228411 3300033180 Bacteria 1366
333 Ga0395899_0857311 3300037312 Bacteria 557
334 Ga0395900_0038491 3300037418 Bacteria 4929
335 Ga0395900_0322487 3300037418 Bacteria 1525
336 Ga0395898_0081010 3300037466 Bacteria 3131
337 Ga0395905_0035062 3300037471 Bacteria 4711
338 Ga0395905_1099925 3300037471 Bacteria 698
339 Ga0395901_0018682 3300038443 Bacteria 7081
340 Ga0395901_0050049 3300038443 Bacteria 4342
341 Ga0395901_0152092 3300038443 Bacteria 2432
342 Ga0395901_0299879 3300038443 Bacteria 1666
343 Ga0395901_0417259 3300038443 Bacteria 1377
344 Ga0237819_00861 3300038705 Bacteria 9536
345 Ga0436365_0171816 3300039437 Bacteria 2194
346 Ga0439447_054009 3300041407 Bacteria 954
347 Ga0439461_0014668 3300041410 Bacteria 1493
348 Ga0439465_0004347 3300041413 Bacteria 4593
349 Ga0451793_1327359 3300041452 Bacteria 524
350 Ga0451795_0207842 3300041456 Bacteria 897
351 Ga0451807_0433198 3300041486 Bacteria 686
352 Ga0451807_2158118 3300041486 Bacteria 810
353 Ga0439431_0020510 3300041997 Bacteria 1579
354 Ga0439448_0008267 3300042005 Bacteria 3042
355 Ga0439448_0036380 3300042005 Bacteria 1579
356 Ga0439448_0129427 3300042005 Bacteria 869
357 Ga0439432_050711 3300042006 Bacteria 1295
358 Ga0439455_0001896 3300042012 Bacteria 3665
359 Ga0439455_0086007 3300042012 Bacteria 858
360 Ga0439462_0013898 3300042015 Bacteria 2066
361 Ga0450894_034011 3300042131 Bacteria 718
362 Ga0439446_0024521 3300042156 Bacteria 1721
363 Ga0439446_0129712 3300042156 Bacteria 817
364 Ga0466965_0114075 3300044683 Bacteria 1391
365 Ga0466966_0784533 3300044684 Bacteria 574
366 Ga0466961_0034273 3300044693 Bacteria 3259
367 Ga0466963_0303095 3300044694 Bacteria 1124
368 Ga0466963_0980372 3300044694 Bacteria 595
369 Ga0466964_0061775 3300044706 Bacteria 1561
370 Ga0466971_0005725 3300044719 Bacteria 5402
371 Ga0466970_0203443 3300044765 Bacteria 1102
372 Ga0466970_0321950 3300044765 Bacteria 874
373 Ga0466957_0011550 3300044842 Bacteria 5101
374 Ga0466959_0032432 3300045049 Bacteria 3866
375 Ga0466959_0685490 3300045049 Bacteria 687
376 Ga0466958_0005316 3300045836 Bacteria 6912
377 Ga0466958_0100001 3300045836 Bacteria 1802
378 Ga0466967_0224242 3300045976 Bacteria 1787
379 Ga0466967_0766750 3300045976 Bacteria 957
380 Ga0466967_1948619 3300045976 Bacteria 584
381 Ga0495638_0006452 3300046460 Bacteria 8533
382 Ga0495650_0080326 3300046471 Bacteria 1259
383 Ga0495584_0037843 3300046491 Bacteria 2439
384 Ga0495584_0233888 3300046491 Bacteria 934
385 Ga0495584_0724712 3300046491 Bacteria 507
386 Ga0495585_0087910 3300046492 Bacteria 1677
387 Ga0495585_0205476 3300046492 Bacteria 1001
388 Ga0495585_0328733 3300046492 Bacteria 746
389 Ga0495596_0123181 3300046500 Bacteria 1006
390 Ga0495583_0032822 3300046506 Bacteria 2503
391 Ga0495583_0221531 3300046506 Bacteria 764
392 Ga0495606_0130815 3300046507 Bacteria 1492
393 Ga0495616_0088095 3300046513 Bacteria 1474
394 Ga0495620_0126066 3300046515 Bacteria 1007
395 Ga0495631_0016830 3300046518 Bacteria 3474
396 Ga0495631_0036968 3300046518 Bacteria 2177
397 Ga0495637_0069542 3300046520 Bacteria 1424
398 Ga0495637_0114194 3300046520 Bacteria 1044
399 Ga0495637_0173510 3300046520 Bacteria 803
400 Ga0495637_0261984 3300046520 Bacteria 620
401 Ga0495643_0005510 3300046522 Bacteria 8540
402 Ga0495643_0048795 3300046522 Bacteria 2286
403 Ga0495643_0208517 3300046522 Bacteria 934
404 Ga0495643_0272143 3300046522 Bacteria 782
405 Ga0495648_0034800 3300046524 Bacteria 3273
406 Ga0495648_0291921 3300046524 Bacteria 768
407 Ga0495663_0000978 3300046525 Bacteria 9450
408 Ga0495666_0114570 3300046526 Bacteria 1265
409 Ga0495654_0100901 3300046530 Bacteria 1329
410 Ga0495598_0021099 3300046537 Bacteria 1728
411 Ga0495622_0525251 3300046557 Bacteria 505
412 Ga0495633_0000064 3300046558 Bacteria 140407
413 Ga0495633_0001836 3300046558 Bacteria 15611
414 Ga0495668_0000258 3300046616 Bacteria 75022
415 Ga0495668_0124537 3300046616 Bacteria 1410
416 Ga0495668_0134447 3300046616 Bacteria 1353
417 Ga0495668_0215844 3300046616 Bacteria 1050
418 Ga0495611_0007518 3300046648 Bacteria 4625
419 Ga0495611_0183182 3300046648 Bacteria 978
420 Ga0495625_0000332 3300046660 Bacteria 71947
421 Ga0495625_0018257 3300046660 Bacteria 5482
422 Ga0495625_0045929 3300046660 Bacteria 3154
423 Ga0495625_0118310 3300046660 Bacteria 1805
424 Ga0495625_0143091 3300046660 Bacteria 1612
425 Ga0495625_0188980 3300046660 Bacteria 1366
426 Ga0495625_0336534 3300046660 Bacteria 957
427 Ga0495669_0000038 3300046684 Bacteria 93166
428 Ga0495670_0143083 3300046691 Bacteria 1251
429 Ga0495670_0543136 3300046691 Bacteria 632
430 Ga0495671_0138406 3300046692 Bacteria 1187
431 Ga0495660_0039498 3300046810 Bacteria 2621
432 Ga0495660_0109411 3300046810 Bacteria 1412
433 Ga0495683_0026653 3300047323 Bacteria 2957
434 Ga0495683_0265907 3300047323 Bacteria 747
435 Ga0495683_0344584 3300047323 Bacteria 630
436 Ga0495687_000045 3300047443 Bacteria 211968
437 Ga0495687_001633 3300047443 Bacteria 20197
438 Ga0495677_0401916 3300047445 Bacteria 542
439 Ga0495681_0362784 3300047470 Bacteria 548
440 Ga0495686_0001500 3300047472 Bacteria 25251
441 Ga0495686_0004398 3300047472 Bacteria 11610
442 Ga0495686_0032039 3300047472 Bacteria 3404
443 Ga0496102_0000067 3300048905 Bacteria 156790
444 Ga0496102_0969139 3300048905 Bacteria 771
445 Ga0496103_0000207 3300048906 Bacteria 58942
446 Ga0496104_0038550 3300048907 Bacteria 4472
447 Ga0496105_0020485 3300048908 Bacteria 5344
448 Ga0496107_0131423 3300048910 Bacteria 1848
449 Ga0496107_0678585 3300048910 Bacteria 759
450 Ga0496110_0131839 3300048913 Bacteria 2257
451 Ga0496111_0004443 3300048914 Bacteria 8868
452 Ga0496114_0017717 3300048917 Bacteria 5755
453 Ga0496115_0000545 3300048918 Bacteria 29339
454 Ga0496115_0006093 3300048918 Bacteria 8809
455 Ga0496116_0006885 3300048919 Bacteria 10205
456 Ga0496117_0000114 3300048920 Bacteria 180658
457 Ga0496117_0210733 3300048920 Bacteria 1089
458 Ga0496117_0502019 3300048920 Bacteria 588
459 Ga0496118_0000082 3300048921 Bacteria 185820
460 Ga0496118_0006852 3300048921 Bacteria 12356
461 Ga0496119_0005868 3300048922 Bacteria 11594
462 Ga0496119_0064841 3300048922 Bacteria 2167
463 Ga0496120_0069755 3300048923 Bacteria 1935
464 Ga0496120_0208430 3300048923 Bacteria 941
465 Ga0496120_0502644 3300048923 Bacteria 520
466 Ga0496121_0000529 3300048924 Bacteria 72533
467 Ga0496121_0000758 3300048924 Bacteria 59289
468 Ga0496121_0009461 3300048924 Bacteria 11198
469 Ga0496121_0159394 3300048924 Bacteria 1652
470 Ga0496121_0293951 3300048924 Bacteria 1105
471 Ga0496122_0002027 3300048925 Bacteria 30082
472 Ga0496122_0189707 3300048925 Bacteria 1215
473 Ga0496123_0001684 3300048926 Bacteria 29590
474 Ga0496123_0007147 3300048926 Bacteria 10607
475 Ga0496124_0000068 3300048927 Bacteria 221819
476 Ga0496125_0023936 3300048928 Bacteria 5627
477 Ga0496126_0000157 3300048929 Bacteria 156203
478 Ga0501307_042699 3300049162 Bacteria 663
479 Ga0501032_0324437 3300049569 Bacteria 993
480 Ga0501033_0705926 3300049570 Bacteria 686
481 Ga0501034_0016729 3300049571 Bacteria 7520
482 Ga0501036_0463625 3300049572 Bacteria 1055
483 Ga0501070_0793440 3300049586 Bacteria 744
484 Ga0501071_0373816 3300049587 Bacteria 1086
485 Ga0501223_000078 3300049663 Bacteria 29605
486 Ga0501224_000001 3300049664 Bacteria 308131
487 Ga0501233_000371 3300049668 Bacteria 7086
488 Ga0501235_081102 3300049669 Bacteria 775
489 Ga0501249_001469 3300049679 Bacteria 4846
490 Ga0501225_0000179 3300049705 Bacteria 19590
491 Ga0501234_003243 3300049707 Bacteria 2557
492 Ga0501226_000043 3300049853 Bacteria 58106
493 nmdc:mga03n38_584594_c1 3300050490 Bacteria 635
494 nmdc:mga00v17_136956_c1 3300050491 Bacteria 1568
495 nmdc:mga0k408_200276_c1 3300050493 Bacteria 1192
496 nmdc:mga06z11_280_c1 3300050494 Bacteria 19957
497 nmdc:mga04h51_176_c1 3300050495 Bacteria 18091
498 nmdc:mga07m45_200458_c1 3300050496 Bacteria 1161
499 nmdc:mga07m45_24503_c1 3300050496 Bacteria 3306
500 nmdc:mga0sz30_59824_c1 3300050516 Bacteria 1626
501 Ga0500610_0000053 3300053079 Bacteria 36671
502 Ga0500643_000115 3300053087 Bacteria 84126
503 Ga0500643_019208 3300053087 Bacteria 2255
504 Ga0500643_146300 3300053087 Bacteria 634
505 Ga0500651_0152343 3300053093 Bacteria 1387
506 Ga0500641_0013303 3300053096 Bacteria 3021
507 Ga0500641_0384615 3300053096 Bacteria 555
508 Ga0500642_0000288 3300053130 Bacteria 18351
509 Ga0500658_0000967 3300053134 Bacteria 11730
510 Ga0500658_0002145 3300053134 Bacteria 7675
511 Ga0500559_0160415 3300053136 Bacteria 1057
512 Ga0500559_0168923 3300053136 Bacteria 1029
513 Ga0500559_0181078 3300053136 Bacteria 993
514 Ga0500568_0141753 3300053139 Bacteria 891
515 Ga0500573_0254254 3300053140 Bacteria 903
516 Ga0500604_0002133 3300053151 Bacteria 5437
517 Ga0500604_0082507 3300053151 Bacteria 1040
518 Ga0500616_0129336 3300053153 Bacteria 1195
519 Ga0500627_0182606 3300053158 Bacteria 944
520 Ga0500627_0332098 3300053158 Bacteria 659
521 Ga0500645_000008 3300053730 Bacteria 212254
522 Ga0500645_014693 3300053730 Bacteria 2491
523 Ga0500645_048410 3300053730 Bacteria 1245
524 Ga0500596_000374 3300053735 Bacteria 8118
525 Ga0466962_0010668 3300061719 Bacteria 4419
526 2644037463 2643221605 Bacteria 4772303
527 Ga0451839_0490595
528 JGI24736J21556_1015671
529 JGI24740J21852_10037046
530 JGI24740J21852_10097790
531 JGI24739J22299_10021635
532 JGI24737J22298_10000699
533 JGI24737J22298_10000761
534 JGI24737J22298_10001359
535 JGI24737J22298_10041297
536 JGI24737J22298_10104173
537 JGI24743J22301_10028117
538 JGI24735J21928_10001740
539 JGI24735J21928_10002608
540 JGI24735J21928_10016878
541 JGI24735J21928_10022189
542 JGI24735J21928_10096806
543 JGI24738J21930_10000097
544 JGI24738J21930_10099099
545 JGI24738J21930_10104343
546 JGI24744J21845_10000233
547 JGI24742J22300_10076582
548 JGI25165J46597_1000012
549 JGI25153J46596_10000016
550 rootH1_10139276
551 rootH2_10035101
552 rootL2_10091933
553 rootL2_10149426
554 rootL2_10158808
555 rootH1_10085343
556 Ga0055525_1000090
557 Ga0055542_1001886
558 Ga0065165_1001406
559 Ga0070658_10000900
560 Ga0070658_10008833
561 Ga0070658_10055210
562 Ga0070658_10199678
563 Ga0070658_10404575
564 Ga0070676_10052394
565 Ga0070683_100874627
566 Ga0070670_100000371
567 Ga0070670_100216038
568 Ga0070670_102156074
569 Ga0068869_100189621
570 Ga0070666_10066379
571 Ga0070680_101150036
572 Ga0070660_100041096
573 Ga0070660_100092729
574 Ga0070660_100591302
575 Ga0070660_101609913
576 Ga0070661_100038478
577 Ga0070668_100000006
578 Ga0070668_100100122
579 Ga0070669_100004839
580 Ga0070675_100045483
581 Ga0070675_100814313
582 Ga0070671_100000120
583 Ga0070671_100033488
584 Ga0070674_100044992
585 Ga0070674_100057220
586 Ga0070659_100009565
587 Ga0070659_100058401
588 Ga0070659_100058655
589 Ga0070667_100000003
590 Ga0070667_100130758
591 Ga0070700_100478893
592 Ga0070663_100070615
593 Ga0070663_100096886
594 Ga0070678_100002410
595 Ga0070662_100006767
596 Ga0070662_100019466
597 Ga0070662_100078887
598 Ga0070681_10757460
599 Ga0068867_101098400
600 Ga0070679_101233957
601 Ga0070684_100559436
602 Ga0068853_100049687
603 Ga0068853_100271370
604 Ga0068853_100314979
605 Ga0068853_101184679
606 Ga0068853_102151430
607 Ga0070672_100024079
608 Ga0070672_100085151
609 Ga0070686_100584504
610 Ga0070693_100025532
611 Ga0070665_100000044
612 Ga0070665_101194945
613 Ga0070665_101482669
614 Ga0068855_100000230
615 Ga0068855_100014825
616 Ga0068855_101509316
617 Ga0068855_102037582
618 Ga0070664_100871424
619 Ga0068857_101719002
620 Ga0068854_100005813
621 Ga0068854_100058020
622 Ga0068854_100082064
623 Ga0068854_100772509
624 Ga0068854_101855054
625 Ga0068856_100425218
626 Ga0068856_100529544
627 Ga0068852_100000145
628 Ga0068852_100188782
629 Ga0068852_100316966
630 Ga0068859_100029568
631 Ga0068859_100032913
632 Ga0068859_100457504
633 Ga0068864_100392504
634 Ga0068861_100198822
635 Ga0068861_100864703
636 Ga0068851_10024203
637 Ga0068863_100001154
638 Ga0068863_100002036
639 Ga0068863_100119337
640 Ga0068858_100006136
641 Ga0068860_100000068
642 Ga0068862_100000179
643 Ga0068862_100000267
644 Ga0081539_10012235
645 Ga0075368_10000181
646 Ga0075363_100120478
647 Ga0075364_10175748
648 Ga0075367_10000814
649 Ga0075369_10101416
650 Ga0097621_100062171
651 Ga0097621_100945628
652 Ga0075370_10014296
653 Ga0075370_10078046
654 Ga0068871_100018004
655 Ga0068871_101694910
656 Ga0097620_100029568
657 Ga0097620_100032913
658 Ga0097620_100457516
659 Ga0097620_100884835
660 Ga0105251_10098212
661 Ga0105240_10083291
662 Ga0105240_10157687
663 Ga0105240_10392462
664 Ga0105240_11356476
665 Ga0105240_12032248
666 Ga0105245_10003985
667 Ga0105243_10192187
668 Ga0105241_10007791
669 Ga0105241_10014976
670 Ga0105242_10367820
671 Ga0105242_13129124
672 Ga0105237_10103211
673 Ga0105237_10136962
674 Ga0105238_10164389
675 Ga0105238_10492184
676 Ga0105238_10496872
677 Ga0105238_10587936
678 Ga0105249_10000004
679 Ga0105249_10112104
680 Ga0105239_10042781
681 Ga0105239_10153741
682 Ga0105239_10213362
683 Ga0105239_11569608
684 Ga0157317_1011415
685 Ga0157373_10030441
686 Ga0157373_10156247
687 Ga0157373_10229827
688 Ga0157373_10378509
689 Ga0157371_10002630
690 Ga0157371_10051879
691 Ga0157371_10057889
692 Ga0157371_10216492
693 Ga0157370_10453449
694 Ga0157369_10249566
695 Ga0157369_10829431
696 Ga0157374_10230385
697 Ga0157374_11013728
698 Ga0157378_10314271
699 Ga0163162_10082099
700 Ga0163162_10243920
701 Ga0163162_11340178
702 Ga0157372_10009684
703 Ga0157372_10035394
704 Ga0157372_10209943
705 Ga0157372_10401832
706 Ga0157372_10814960
707 Ga0157372_10840215
708 Ga0157372_10847198
709 Ga0157372_10998173
710 Ga0157375_10245944
711 Ga0157380_10001031
712 Ga0157376_11780920
713 Ga0163161_10029991
714 Ga0163161_10068452
715 Ga0213876_10052628
716 Ga0209674_105535
717 Ga0209674_110116
718 Ga0209563_100111
719 Ga0209026_1028336
720 Ga0209677_108624
721 Ga0209148_1000127
722 Ga0209233_1000058
723 Ga0209233_1070552
724 Ga0209455_1013032
725 Ga0209758_1000035
726 Ga0209758_1079912
727 Ga0207656_10042720
728 Ga0207682_10034472
729 Ga0207688_10085763
730 Ga0207647_10000916
731 Ga0207647_10037846
732 Ga0207647_10212099
733 Ga0207647_10253022
734 Ga0207647_10352603
735 Ga0207645_10041332
736 Ga0207645_10155046
737 Ga0207705_10000027
738 Ga0207705_10000371
739 Ga0207705_10046735
740 Ga0207705_10172386
741 Ga0207705_10190948
742 Ga0207705_10210794
743 Ga0207654_10000535
744 Ga0207695_10022017
745 Ga0207695_10633255
746 Ga0207671_10036876
747 Ga0207671_10351738
748 Ga0207671_10743357
749 Ga0207671_11484842
750 Ga0207657_10017473
751 Ga0207657_10022838
752 Ga0207657_10130240
753 Ga0207649_10000616
754 Ga0207649_10529037
755 Ga0207649_10802983
756 Ga0207652_10783070
757 Ga0207652_11294405
758 Ga0207681_10002686
759 Ga0207681_10098244
760 Ga0207694_10153297
761 Ga0207650_10001839
762 Ga0207650_10070032
763 Ga0207650_10193600
764 Ga0207659_10004692
765 Ga0207687_10004882
766 Ga0207687_10982257
767 Ga0207644_10000442
768 Ga0207644_10050073
769 Ga0207644_10322643
770 Ga0207644_10481185
771 Ga0207690_10003772
772 Ga0207690_10004361
773 Ga0207690_10274736
774 Ga0207706_10008441
775 Ga0207706_10169498
776 Ga0207706_10335591
777 Ga0207706_10402367
778 Ga0207709_10237490
779 Ga0207669_10062619
780 Ga0207691_10043007
781 Ga0207691_10151574
782 Ga0207689_10222018
783 Ga0207689_11813591
784 Ga0207679_10787774
785 Ga0207667_10000010
786 Ga0207667_10000072
787 Ga0207667_10016495
788 Ga0207667_10751669
789 Ga0207667_10991845
790 Ga0207712_10000008
791 Ga0207668_10000110
792 Ga0207640_10000366
793 Ga0207640_10001641
794 Ga0207640_10014787
795 Ga0207640_10042547
796 Ga0207658_10000002
797 Ga0207658_10038721
798 Ga0207703_10000489
799 Ga0207703_10001758
800 Ga0207639_10008154
801 Ga0207639_10037108
802 Ga0207639_10845964
803 Ga0207639_11172041
804 Ga0207678_10007193
805 Ga0207678_10013250
806 Ga0207702_10003263
807 Ga0207702_10021336
808 Ga0207641_10000282
809 Ga0207641_10005995
810 Ga0207641_10011182
811 Ga0207648_11001334
812 Ga0207676_12025246
813 Ga0207674_10025270
814 Ga0207674_10052197
815 Ga0207674_10140532
816 Ga0207674_11167916
817 Ga0207675_100216381
818 Ga0207675_102394585
819 Ga0207683_10006133
820 Ga0207683_10465455
821 Ga0207698_10000106
822 Ga0207698_10039682
823 Ga0207698_10291374
824 Ga0207698_10729995
825 Ga0207698_10829673
826 Ga0209813_10000099
827 Ga0268266_10000002
828 Ga0268266_10288865
829 Ga0268266_11501037
830 Ga0268265_10000199
831 Ga0268265_10002621
832 Ga0268264_10000103
833 Ga0268264_11079255
834 Ga0307513_10062617
835 Ga0307408_100517781
836 Ga0307408_101523983
837 Ga0307408_101539095
838 Ga0307508_10008660
839 Ga0307405_10470380
840 Ga0307405_10786228
841 Ga0307413_10879393
842 Ga0307410_10475706
843 Ga0307406_10379116
844 Ga0307412_10120355
845 Ga0307412_10301302
846 Ga0307409_100564244
847 Ga0307416_100606231
848 Ga0307416_100670534
849 Ga0307414_10021010
850 Ga0307414_10195275
851 Ga0307414_11341367
852 Ga0307411_10136848
853 Ga0307411_10402434
854 Ga0307411_10650722
855 Ga0307415_100140098
856 Ga0307415_101514670
857 Ga0307510_10090381
858 Ga0307510_10228411
859 Ga0395899_0857311
860 Ga0395900_0038491
861 Ga0395900_0322487
862 Ga0395898_0081010
863 Ga0395905_0035062
864 Ga0395905_1099925
865 Ga0395901_0018682
866 Ga0395901_0050049
867 Ga0395901_0152092
868 Ga0395901_0299879
869 Ga0395901_0417259
870 Ga0237819_00861
871 Ga0436365_0171816
872 Ga0439447_054009
873 Ga0439461_0014668
874 Ga0439465_0004347
875 Ga0451793_1327359
876 Ga0451795_0207842
877 Ga0451807_0433198
878 Ga0451807_2158118
879 Ga0439431_0020510
880 Ga0439448_0008267
881 Ga0439448_0036380
882 Ga0439448_0129427
883 Ga0439432_050711
884 Ga0439455_0001896
885 Ga0439455_0086007
886 Ga0439462_0013898
887 Ga0450894_034011
888 Ga0439446_0024521
889 Ga0439446_0129712
890 Ga0466965_0114075
891 Ga0466966_0784533
892 Ga0466961_0034273
893 Ga0466963_0303095
894 Ga0466963_0980372
895 Ga0466964_0061775
896 Ga0466971_0005725
897 Ga0466970_0203443
898 Ga0466970_0321950
899 Ga0466957_0011550
900 Ga0466959_0032432
901 Ga0466959_0685490
902 Ga0466958_0005316
903 Ga0466958_0100001
904 Ga0466967_0224242
905 Ga0466967_0766750
906 Ga0466967_1948619
907 Ga0495638_0006452
908 Ga0495650_0080326
909 Ga0495584_0037843
910 Ga0495584_0233888
911 Ga0495584_0724712
912 Ga0495585_0087910
913 Ga0495585_0205476
914 Ga0495585_0328733
915 Ga0495596_0123181
916 Ga0495583_0032822
917 Ga0495583_0221531
918 Ga0495606_0130815
919 Ga0495616_0088095
920 Ga0495620_0126066
921 Ga0495631_0016830
922 Ga0495631_0036968
923 Ga0495637_0069542
924 Ga0495637_0114194
925 Ga0495637_0173510
926 Ga0495637_0261984
927 Ga0495643_0005510
928 Ga0495643_0048795
929 Ga0495643_0208517
930 Ga0495643_0272143
931 Ga0495648_0034800
932 Ga0495648_0291921
933 Ga0495663_0000978
934 Ga0495666_0114570
935 Ga0495654_0100901
936 Ga0495598_0021099
937 Ga0495622_0525251
938 Ga0495633_0000064
939 Ga0495633_0001836
940 Ga0495668_0000258
941 Ga0495668_0124537
942 Ga0495668_0134447
943 Ga0495668_0215844
944 Ga0495611_0007518
945 Ga0495611_0183182
946 Ga0495625_0000332
947 Ga0495625_0018257
948 Ga0495625_0045929
949 Ga0495625_0118310
950 Ga0495625_0143091
951 Ga0495625_0188980
952 Ga0495625_0336534
953 Ga0495669_0000038
954 Ga0495670_0143083
955 Ga0495670_0543136
956 Ga0495671_0138406
957 Ga0495660_0039498
958 Ga0495660_0109411
959 Ga0495683_0026653
960 Ga0495683_0265907
961 Ga0495683_0344584
962 Ga0495687_000045
963 Ga0495687_001633
964 Ga0495677_0401916
965 Ga0495681_0362784
966 Ga0495686_0001500
967 Ga0495686_0004398
968 Ga0495686_0032039
969 Ga0496102_0000067
970 Ga0496102_0969139
971 Ga0496103_0000207
972 Ga0496104_0038550
973 Ga0496105_0020485
974 Ga0496107_0131423
975 Ga0496107_0678585
976 Ga0496110_0131839
977 Ga0496111_0004443
978 Ga0496114_0017717
979 Ga0496115_0000545
980 Ga0496115_0006093
981 Ga0496116_0006885
982 Ga0496117_0000114
983 Ga0496117_0210733
984 Ga0496117_0502019
985 Ga0496118_0000082
986 Ga0496118_0006852
987 Ga0496119_0005868
988 Ga0496119_0064841
989 Ga0496120_0069755
990 Ga0496120_0208430
991 Ga0496120_0502644
992 Ga0496121_0000529
993 Ga0496121_0000758
994 Ga0496121_0009461
995 Ga0496121_0159394
996 Ga0496121_0293951
997 Ga0496122_0002027
998 Ga0496122_0189707
999 Ga0496123_0001684
1000 Ga0496123_0007147
1001 Ga0496124_0000068
1002 Ga0496125_0023936
1003 Ga0496126_0000157
1004 Ga0501307_042699
1005 Ga0501032_0324437
1006 Ga0501033_0705926
1007 Ga0501034_0016729
1008 Ga0501036_0463625
1009 Ga0501070_0793440
1010 Ga0501071_0373816
1011 Ga0501223_000078
1012 Ga0501224_000001
1013 Ga0501233_000371
1014 Ga0501235_081102
1015 Ga0501249_001469
1016 Ga0501225_0000179
1017 Ga0501234_003243
1018 Ga0501226_000043
1019 nmdc:mga03n38_584594_c1
1020 nmdc:mga00v17_136956_c1
1021 nmdc:mga0k408_200276_c1
1022 nmdc:mga06z11_280_c1
1023 nmdc:mga04h51_176_c1
1024 nmdc:mga07m45_200458_c1
1025 nmdc:mga07m45_24503_c1
1026 nmdc:mga0sz30_59824_c1
1027 Ga0500610_0000053
1028 Ga0500643_000115
1029 Ga0500643_019208
1030 Ga0500643_146300
1031 Ga0500651_0152343
1032 Ga0500641_0013303
1033 Ga0500641_0384615
1034 Ga0500642_0000288
1035 Ga0500658_0000967
1036 Ga0500658_0002145
1037 Ga0500559_0160415
1038 Ga0500559_0168923
1039 Ga0500559_0181078
1040 Ga0500568_0141753
1041 Ga0500573_0254254
1042 Ga0500604_0002133
1043 Ga0500604_0082507
1044 Ga0500616_0129336
1045 Ga0500627_0182606
1046 Ga0500627_0332098
1047 Ga0500645_000008
1048 Ga0500645_014693
1049 Ga0500645_048410
1050 Ga0500596_000374
1051 Ga0466962_0010668
1052 2644037463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

8

65

0.85

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

49

113

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xlq-assembly4.cif.gz_A crystal structure of reduced c73s putidaredoxin from pseudomonas putida 0.9102 1 101
1r7s-assembly3.cif.gz_C putidaredoxin (fe2s2 ferredoxin), c73g mutant 0.9092 1 104
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.9085 1 104
2wlb-assembly2.cif.gz_B adrenodoxin-like ferredoxin etp1fd(516-618) of schizosaccharomyces pombe mitochondria 0.9049 2 101
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.9042 2 104
ID Description Score Start End Superfamily
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9085 1 104 3.10.20.30
2wlbB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9049 2 101 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8983 2 107 3.10.20.30
1uwmA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8974 1 101 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8918 1 103 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A520HF75-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9442 1 89 GO:0009055
GO:0051537
GO:0140647
AF-A0A0Q4EDQ0-F1-model_v4 2Fe-2S ferredoxin 0.944 1 101 GO:0009055
GO:0051537
GO:0140647
AF-A0A2A2SKV2-F1-model_v4 2Fe-2S ferredoxin 0.9361 1 101 GO:0009055
GO:0051537
GO:0140647
AF-A0A4V1ZRF0-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9339 16 101 GO:0009055
GO:0051537
GO:0140647
AF-A0A7S1K221-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9318 2 104 GO:0005739
GO:0009055
GO:0051537
GO:0140647

Map