F459416

General Info

Members Datasets Scaffolds Average Seq Length
526 230 1052 200

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10201384|Ga0207665_102013842
Length 229
Sequence LHRAFTVSREKKQKRLTLVCAVVQGVLNKGMPDFAAPVERLIDELKHLPGIGQKTAQRLAFHLLRLAPEDALALADAIRDAKEKIRECSVCGNITDADPCLYCTGASRSKRTICVVEEPHNIMAIEKTRMYSGMYHVLGGSLAPLQGRGPDQLKIKQLIERLKGGSVEEIIIATNPTAEGEATAVYLSKLLKPLGVRVTRIGVGIPVGADLEYADEITMMKAMEGRRDL

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
226 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
227 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 2.28
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 23.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10201384 3300025939 Unclassified 1451
2 Ga0070680_100103172 3300005336 Bacteria 2369
3 Ga0070689_100342233 3300005340 Bacteria 1253
4 Ga0070661_100643284 3300005344 Unclassified 860
5 Ga0070675_100066865 3300005354 Bacteria 2973
6 Ga0070659_100013719 3300005366 Bacteria 6040
7 Ga0070659_100092758 3300005366 Bacteria 2422
8 Ga0070709_10007193 3300005434 Bacteria 6097
9 Ga0070709_10020104 3300005434 Unclassified 3870
10 Ga0070709_10155609 3300005434 Unclassified 1584
11 Ga0070714_100246704 3300005435 Unclassified 1650
12 Ga0070714_100988250 3300005435 Unclassified 819
13 Ga0070713_100022325 3300005436 Bacteria 4889
14 Ga0070713_100052151 3300005436 Unclassified 3386
15 Ga0070713_100598739 3300005436 Unclassified 1047
16 Ga0070710_10022247 3300005437 Bacteria 3313
17 Ga0070710_10077756 3300005437 Unclassified 1929
18 Ga0070711_100073374 3300005439 Bacteria 2417
19 Ga0070711_100233958 3300005439 Bacteria 1434
20 Ga0070711_100272106 3300005439 Bacteria 1337
21 Ga0070705_100013378 3300005440 Bacteria 4196
22 Ga0070705_100057062 3300005440 Bacteria 2302
23 Ga0070694_100014240 3300005444 Bacteria 4977
24 Ga0070694_100058812 3300005444 Bacteria 2616
25 Ga0070708_100006942 3300005445 Bacteria 9034
26 Ga0070708_100007749 3300005445 Bacteria 8604
27 Ga0070708_100078882 3300005445 Bacteria 2977
28 Ga0070708_100387729 3300005445 Bacteria 1317
29 Ga0070681_10066052 3300005458 Bacteria 3586
30 Ga0070681_10319898 3300005458 Unclassified 1461
31 Ga0068867_100629620 3300005459 Unclassified 939
32 Ga0070706_100008374 3300005467 Bacteria 9637
33 Ga0070706_100111978 3300005467 Bacteria 2540
34 Ga0070707_100000776 3300005468 Bacteria 31562
35 Ga0070707_100213489 3300005468 Bacteria 1881
36 Ga0070707_100494385 3300005468 Bacteria 1185
37 Ga0070698_100000682 3300005471 Bacteria 36296
38 Ga0070698_100121345 3300005471 Unclassified 2574
39 Ga0070698_100184035 3300005471 Unclassified 2027
40 Ga0070699_100002249 3300005518 Bacteria 17406
41 Ga0070699_100024776 3300005518 Bacteria 5173
42 Ga0070699_100079104 3300005518 Bacteria 2863
43 Ga0070699_100507696 3300005518 Unclassified 1096
44 Ga0070699_101032453 3300005518 Bacteria 754
45 Ga0070679_100005675 3300005530 Bacteria 11571
46 Ga0070679_100223079 3300005530 Unclassified 1845
47 Ga0070697_100000928 3300005536 Bacteria 22027
48 Ga0070697_100008528 3300005536 Bacteria 8001
49 Ga0070697_100024455 3300005536 Bacteria 4808
50 Ga0070697_100036717 3300005536 Unclassified 3958
51 Ga0070697_100129785 3300005536 Bacteria 2113
52 Ga0070697_100695181 3300005536 Bacteria 897
53 Ga0070696_100000476 3300005546 Bacteria 25173
54 Ga0070693_100000240 3300005547 Bacteria 25672
55 Ga0070693_100017103 3300005547 Unclassified 3764
56 Ga0070665_100030039 3300005548 Bacteria 5469
57 Ga0070704_100894762 3300005549 Bacteria 798
58 Ga0068855_100023314 3300005563 Bacteria 7413
59 Ga0068856_100001755 3300005614 Bacteria 22674
60 Ga0068856_100571105 3300005614 Bacteria 1152
61 Ga0068859_100741588 3300005617 Unclassified 1071
62 Ga0068861_100154007 3300005719 Bacteria 1889
63 Ga0068863_100011397 3300005841 Bacteria 8602
64 Ga0068860_100063890 3300005843 Unclassified 3496
65 Ga0068860_100471014 3300005843 Unclassified 1251
66 Ga0070717_10128740 3300006028 Unclassified 2175
67 Ga0070717_10308416 3300006028 Bacteria 1408
68 Ga0070717_10323270 3300006028 Bacteria 1375
69 Ga0070717_10719583 3300006028 Unclassified 907
70 Ga0070716_100004604 3300006173 Bacteria 6612
71 Ga0070716_100028067 3300006173 Unclassified 3031
72 Ga0070716_100054141 3300006173 Unclassified 2291
73 Ga0070716_100136413 3300006173 Bacteria 1559
74 Ga0070712_100164590 3300006175 Bacteria 1715
75 Ga0070712_100180899 3300006175 Bacteria 1643
76 Ga0070712_100448110 3300006175 Bacteria 1074
77 Ga0070712_100647334 3300006175 Bacteria 898
78 Ga0097621_100033233 3300006237 Bacteria 4106
79 Ga0075433_10629785 3300006852 Unclassified 941
80 Ga0075434_100016674 3300006871 Bacteria 7066
81 Ga0075434_100038488 3300006871 Bacteria 4737
82 Ga0075434_100535661 3300006871 Bacteria 1191
83 Ga0075434_100691849 3300006871 Unclassified 1037
84 Ga0075436_100003899 3300006914 Bacteria 10222
85 Ga0075436_100017049 3300006914 Unclassified 4971
86 Ga0075436_100110530 3300006914 Bacteria 1918
87 Ga0097620_100741782 3300006931 Unclassified 1071
88 Ga0075435_100123014 3300007076 Unclassified 2166
89 Ga0075435_100254338 3300007076 Bacteria 1496
90 Ga0075435_100338491 3300007076 Unclassified 1289
91 Ga0099794_10006680 3300007265 Bacteria 4686
92 Ga0099794_10007464 3300007265 Bacteria 4495
93 Ga0099794_10010436 3300007265 Bacteria 3944
94 Ga0099794_10031993 3300007265 Bacteria 2467
95 Ga0099794_10040410 3300007265 Bacteria 2217
96 Ga0099794_10063571 3300007265 Unclassified 1797
97 Ga0099794_10157549 3300007265 Bacteria 1154
98 Ga0099794_10216424 3300007265 Unclassified 983
99 Ga0099794_10306712 3300007265 Unclassified 822
100 Ga0099794_10379435 3300007265 Unclassified 737
101 Ga0099795_10248911 3300007788 Bacteria 766
102 Ga0105240_10032651 3300009093 Bacteria 6738
103 Ga0105240_10254351 3300009093 Bacteria 2030
104 Ga0105245_10098038 3300009098 Bacteria 2708
105 Ga0105247_10492454 3300009101 Bacteria 892
106 Ga0105242_10284813 3300009176 Bacteria 1502
107 Ga0105242_10541546 3300009176 Unclassified 1114
108 Ga0105248_10412162 3300009177 Bacteria 1521
109 Ga0105237_10074510 3300009545 Bacteria 3386
110 Ga0105237_10138636 3300009545 Bacteria 2427
111 Ga0105237_10252193 3300009545 Unclassified 1767
112 Ga0105237_10491976 3300009545 Bacteria 1233
113 Ga0099796_10039400 3300010159 Bacteria 1590
114 Ga0099796_10054446 3300010159 Bacteria 1399
115 Ga0099796_10122281 3300010159 Bacteria 1001
116 Ga0157373_10055773 3300013100 Bacteria 2807
117 Ga0157373_10111036 3300013100 Unclassified 1927
118 Ga0157371_10113175 3300013102 Unclassified 1927
119 Ga0157370_10328202 3300013104 Bacteria 1411
120 Ga0157369_10079538 3300013105 Bacteria 3511
121 Ga0157374_10018232 3300013296 Bacteria 6193
122 Ga0157374_10050226 3300013296 Bacteria 3876
123 Ga0157374_10374188 3300013296 Unclassified 1418
124 Ga0157378_10000506 3300013297 Bacteria 37030
125 Ga0157378_10000659 3300013297 Bacteria 32533
126 Ga0163162_10126135 3300013306 Unclassified 2666
127 Ga0163162_11277381 3300013306 Unclassified 834
128 Ga0157372_10101910 3300013307 Bacteria 3278
129 Ga0157372_10231329 3300013307 Bacteria 2143
130 Ga0157375_10176320 3300013308 Bacteria 2287
131 Ga0163163_10259502 3300014325 Bacteria 1789
132 Ga0163163_10379604 3300014325 Bacteria 1471
133 Ga0163163_10933556 3300014325 Bacteria 931
134 Ga0157380_10676279 3300014326 Bacteria 1033
135 Ga0157379_10005520 3300014968 Bacteria 10868
136 Ga0157379_10350470 3300014968 Unclassified 1351
137 Ga0157376_10000036 3300014969 Bacteria 145496
138 Ga0157376_10004257 3300014969 Bacteria 9932
139 Ga0157376_10015634 3300014969 Bacteria 5739
140 Ga0163161_10636155 3300017792 Bacteria 883
141 Ga0213873_10024799 3300021358 Bacteria 1442
142 Ga0213872_10000138 3300021361 Bacteria 65490
143 Ga0213874_10064643 3300021377 Bacteria 1154
144 Ga0213876_10001745 3300021384 Bacteria 13192
145 Ga0213876_10017583 3300021384 Unclassified 3774
146 Ga0213876_10104571 3300021384 Bacteria 1502
147 Ga0213875_10024424 3300021388 Bacteria 2882
148 Ga0213875_10027022 3300021388 Bacteria 2730
149 Ga0213875_10183214 3300021388 Bacteria 984
150 Ga0213871_10002042 3300021441 Bacteria 3614
151 Ga0228598_1003380 3300024227 Bacteria 3435
152 Ga0207682_10075492 3300025893 Bacteria 1435
153 Ga0207647_10217247 3300025904 Unclassified 1102
154 Ga0207685_10056726 3300025905 Bacteria 1534
155 Ga0207685_10154342 3300025905 Bacteria 1042
156 Ga0207699_10001715 3300025906 Bacteria 10379
157 Ga0207699_10573552 3300025906 Unclassified 820
158 Ga0207643_10108056 3300025908 Bacteria 1636
159 Ga0207684_10060011 3300025910 Unclassified 3230
160 Ga0207684_10077011 3300025910 Unclassified 2835
161 Ga0207684_10141755 3300025910 Bacteria 2066
162 Ga0207695_10134322 3300025913 Unclassified 2429
163 Ga0207671_10305166 3300025914 Bacteria 1258
164 Ga0207671_10398834 3300025914 Bacteria 1094
165 Ga0207693_10025266 3300025915 Unclassified 4710
166 Ga0207693_10026607 3300025915 Bacteria 4577
167 Ga0207693_10066919 3300025915 Bacteria 2813
168 Ga0207693_10106832 3300025915 Bacteria 2196
169 Ga0207693_10147699 3300025915 Bacteria 1849
170 Ga0207693_10283322 3300025915 Bacteria 1299
171 Ga0207693_10504015 3300025915 Bacteria 945
172 Ga0207663_10021378 3300025916 Bacteria 3683
173 Ga0207663_10033122 3300025916 Unclassified 3075
174 Ga0207663_10105464 3300025916 Bacteria 1902
175 Ga0207663_10188846 3300025916 Unclassified 1478
176 Ga0207663_10269652 3300025916 Bacteria 1260
177 Ga0207663_10453489 3300025916 Bacteria 989
178 Ga0207657_10177339 3300025919 Bacteria 1724
179 Ga0207649_10479738 3300025920 Unclassified 943
180 Ga0207652_10214557 3300025921 Bacteria 1733
181 Ga0207646_10000005 3300025922 Bacteria 523896
182 Ga0207646_10072726 3300025922 Bacteria 3071
183 Ga0207646_10106242 3300025922 Unclassified 2518
184 Ga0207646_10112642 3300025922 Unclassified 2442
185 Ga0207646_10399199 3300025922 Bacteria 1242
186 Ga0207659_10104524 3300025926 Bacteria 2141
187 Ga0207659_10465913 3300025926 Bacteria 1066
188 Ga0207687_10077896 3300025927 Bacteria 2385
189 Ga0207700_10091340 3300025928 Bacteria 2405
190 Ga0207700_10170797 3300025928 Unclassified 1814
191 Ga0207700_10367875 3300025928 Unclassified 1255
192 Ga0207690_10024516 3300025932 Bacteria 3779
193 Ga0207686_10413604 3300025934 Unclassified 1030
194 Ga0207670_10536093 3300025936 Bacteria 955
195 Ga0207665_10000119 3300025939 Bacteria 51930
196 Ga0207665_10016805 3300025939 Unclassified 4805
197 Ga0207665_10027725 3300025939 Bacteria 3742
198 Ga0207665_10152987 3300025939 Bacteria 1654
199 Ga0207665_10331928 3300025939 Unclassified 1144
200 Ga0207711_10124802 3300025941 Bacteria 2302
201 Ga0207689_10088605 3300025942 Bacteria 2542
202 Ga0207679_10069901 3300025945 Bacteria 2644
203 Ga0207667_10010408 3300025949 Bacteria 10874
204 Ga0207702_10012972 3300026078 Bacteria 6932
205 Ga0207702_10170476 3300026078 Bacteria 1995
206 Ga0207702_10211796 3300026078 Bacteria 1802
207 Ga0207641_10011796 3300026088 Bacteria 7174
208 Ga0207641_10178433 3300026088 Bacteria 1944
209 Ga0207648_10325635 3300026089 Unclassified 1382
210 Ga0207675_100059968 3300026118 Bacteria 3551
211 Ga0209970_1049369 3300027614 Bacteria 759
212 Ga0209588_1011734 3300027671 Bacteria 2651
213 Ga0209588_1032735 3300027671 Bacteria 1666
214 Ga0209588_1071085 3300027671 Bacteria 1124
215 Ga0209588_1076944 3300027671 Bacteria 1078
216 Ga0209588_1135409 3300027671 Unclassified 785
217 Ga0209974_10137102 3300027876 Bacteria 876
218 Ga0265354_1000371 3300028016 Bacteria 7929
219 Ga0265354_1000399 3300028016 Bacteria 7650
220 Ga0268266_10001160 3300028379 Bacteria 32587
221 Ga0268265_11155941 3300028380 Bacteria 770
222 Ga0265319_1021402 3300028563 Bacteria 2375
223 Ga0265319_1042770 3300028563 Unclassified 1523
224 Ga0265318_10010951 3300028577 Bacteria 3929
225 Ga0265318_10131959 3300028577 Unclassified 918
226 Ga0265322_10058090 3300028654 Bacteria 1097
227 Ga0265338_10020622 3300028800 Bacteria 6922
228 Ga0265338_10090275 3300028800 Unclassified 2536
229 Ga0265338_10223794 3300028800 Unclassified 1404
230 Ga0265338_10443797 3300028800 Bacteria 919
231 Ga0265770_1001511 3300030878 Bacteria 3189
232 Ga0265770_1005130 3300030878 Bacteria 1798
233 Ga0265765_1000030 3300030879 Bacteria 6600
234 Ga0265760_10007460 3300031090 Bacteria 3124
235 Ga0265760_10062068 3300031090 Unclassified 1137
236 Ga0265760_10065034 3300031090 Unclassified 1112
237 Ga0265320_10002139 3300031240 Bacteria 13861
238 Ga0265325_10001923 3300031241 Bacteria 14328
239 Ga0265325_10035451 3300031241 Unclassified 2650
240 Ga0265325_10055774 3300031241 Unclassified 2019
241 Ga0265325_10155209 3300031241 Unclassified 1080
242 Ga0265325_10182934 3300031241 Bacteria 975
243 Ga0265329_10000189 3300031242 Bacteria 31671
244 Ga0265329_10007541 3300031242 Unclassified 4199
245 Ga0265340_10007367 3300031247 Bacteria 5977
246 Ga0265340_10226873 3300031247 Bacteria 836
247 Ga0265339_10008748 3300031249 Bacteria 6417
248 Ga0265339_10130575 3300031249 Bacteria 1285
249 Ga0265331_10000503 3300031250 Bacteria 36817
250 Ga0265331_10024304 3300031250 Bacteria 3066
251 Ga0265331_10067598 3300031250 Bacteria 1676
252 Ga0265316_10001492 3300031344 Bacteria 25083
253 Ga0265316_10006438 3300031344 Bacteria 11218
254 Ga0265316_10291174 3300031344 Unclassified 1191
255 Ga0265316_10581688 3300031344 Bacteria 795
256 Ga0265313_10001371 3300031595 Bacteria 22911
257 Ga0265313_10025822 3300031595 Unclassified 3106
258 Ga0265313_10244955 3300031595 Bacteria 732
259 Ga0265314_10110274 3300031711 Bacteria 1750
260 Ga0265314_10170923 3300031711 Unclassified 1312
261 Ga0265314_10398490 3300031711 Unclassified 745
262 Ga0265342_10000864 3300031712 Bacteria 30236
263 Ga0265342_10163892 3300031712 Bacteria 1227
264 Ga0307414_10856354 3300032004 Bacteria 831
265 Ga0307411_11009005 3300032005 Bacteria 745
266 Ga0316593_10028366 3300032168 Bacteria 1804
267 Ga0316592_1073338 3300033524 Unclassified 775
268 Ga0316212_1000477 3300033547 Unclassified 4881
269 Ga0316212_1005670 3300033547 Bacteria 1813
270 Ga0373926_0000587 3300035083 Bacteria 9825
271 Ga0373926_0005279 3300035083 Bacteria 4252
272 Ga0373934_0001307 3300035086 Bacteria 9075
273 Ga0373934_0013306 3300035086 Bacteria 3109
274 Ga0373923_0055659 3300035111 Bacteria 1668
275 Ga0373945_0122484 3300035116 Bacteria 1035
276 Ga0373953_0009118 3300035117 Bacteria 3396
277 Ga0373954_0000343 3300035118 Bacteria 17061
278 Ga0373954_0105196 3300035118 Bacteria 1363
279 Ga0373956_0000675 3300035119 Bacteria 14006
280 Ga0373956_0165016 3300035119 Bacteria 1044
281 Ga0373957_0018377 3300035120 Bacteria 2448
282 Ga0373946_0036228 3300035171 Bacteria 1999
283 Ga0373955_0002660 3300035172 Bacteria 7813
284 Ga0373955_0013848 3300035172 Bacteria 3913
285 Ga0373955_0146800 3300035172 Bacteria 1386
286 Ga0373955_0573084 3300035172 Bacteria 691
287 Ga0316574_0136407 3300035398 Bacteria 1580
288 Ga0373924_0052486 3300035410 Bacteria 1692
289 Ga0373931_0260541 3300035691 Unclassified 1058
290 Ga0373935_0013093 3300035692 Bacteria 5000
291 Ga0373935_0090684 3300035692 Bacteria 2001
292 Ga0373927_0000851 3300035695 Bacteria 23292
293 Ga0373927_0084695 3300035695 Bacteria 2056
294 Ga0373927_0109801 3300035695 Unclassified 1797
295 Ga0373933_0000923 3300035724 Bacteria 17927
296 Ga0373933_0002440 3300035724 Bacteria 10479
297 Ga0373947_0002491 3300035725 Bacteria 11073
298 Ga0373947_0236928 3300035725 Bacteria 1203
299 Ga0373947_0429450 3300035725 Bacteria 893
300 Ga0373937_0002177 3300036401 Bacteria 16404
301 Ga0373937_0002271 3300036401 Bacteria 16047
302 Ga0373937_0027792 3300036401 Bacteria 5118
303 Ga0373937_0073040 3300036401 Bacteria 3164
304 Ga0373937_0508003 3300036401 Bacteria 1145
305 Ga0373925_0000566 3300037068 Bacteria 36269
306 Ga0373925_0405529 3300037068 Bacteria 1112
307 Ga0373925_0888515 3300037068 Bacteria 734
308 Ga0436364_0205700 3300037853 Bacteria 3053
309 Ga0436364_0271230 3300037853 Bacteria 1738
310 Ga0436364_0622909 3300037853 Bacteria 3250
311 Ga0436364_1298431 3300037853 Bacteria 5096
312 Ga0436364_1348647 3300037853 Unclassified 682
313 Ga0436364_1548942 3300037853 Bacteria 22734
314 Ga0395901_0602103 3300038443 Unclassified 1108
315 Ga0436365_0023156 3300039437 Unclassified 972
316 Ga0436365_0202626 3300039437 Bacteria 36993
317 Ga0436365_0570143 3300039437 Bacteria 2205
318 Ga0436365_0865439 3300039437 Bacteria 3499
319 Ga0436365_1617620 3300039437 Bacteria 4713
320 Ga0436365_1829002 3300039437 Bacteria 2668
321 Ga0436365_1852011 3300039437 Unclassified 3524
322 Ga0436360_0477583 3300039438 Bacteria 47726
323 Ga0436361_0444282 3300039447 Bacteria 5811
324 Ga0436361_0574297 3300039447 Bacteria 2040
325 Ga0436361_1089336 3300039447 Bacteria 150546
326 Ga0436363_0480496 3300039450 Bacteria 5735
327 Ga0436363_1588665 3300039450 Bacteria 6417
328 Ga0436362_0315222 3300039453 Unclassified 1905
329 Ga0436362_0734721 3300039453 Unclassified 1624
330 Ga0436362_1208510 3300039453 Bacteria 9192
331 Ga0451853_0526503 3300041512 Bacteria 2261
332 Ga0451577_0020498 3300042876 Bacteria 6066
333 Ga0451577_0370255 3300042876 Bacteria 1300
334 Ga0453683_0004020 3300044673 Bacteria 10606
335 Ga0453683_0006078 3300044673 Bacteria 8317
336 Ga0453683_0429672 3300044673 Bacteria 853
337 Ga0453683_0742226 3300044673 Bacteria 644
338 Ga0453684_0013997 3300044712 Bacteria 12919
339 Ga0466957_0205634 3300044842 Bacteria 1295
340 Ga0451576_0024948 3300045051 Bacteria 6450
341 Ga0495592_0025100 3300046454 Bacteria 4526
342 Ga0495592_0077784 3300046454 Bacteria 2404
343 Ga0495592_0164733 3300046454 Bacteria 1522
344 Ga0495592_0210865 3300046454 Bacteria 1304
345 Ga0495603_0140931 3300046455 Bacteria 1402
346 Ga0495629_0011280 3300046459 Bacteria 6492
347 Ga0495651_0000096 3300046462 Bacteria 64781
348 Ga0495651_0000672 3300046462 Bacteria 26582
349 Ga0495651_0015503 3300046462 Bacteria 5896
350 Ga0495651_0053613 3300046462 Bacteria 3104
351 Ga0495651_0066837 3300046462 Bacteria 2743
352 Ga0495651_0267572 3300046462 Bacteria 1160
353 Ga0495651_0532564 3300046462 Unclassified 748
354 Ga0495653_0016759 3300046463 Bacteria 5963
355 Ga0495653_0055462 3300046463 Unclassified 3024
356 Ga0495653_0364312 3300046463 Bacteria 927
357 Ga0495580_0000163 3300046472 Bacteria 49180
358 Ga0495580_0021868 3300046472 Bacteria 4716
359 Ga0495580_0038671 3300046472 Bacteria 3416
360 Ga0495580_0270732 3300046472 Bacteria 1160
361 Ga0495580_0349823 3300046472 Bacteria 1001
362 Ga0495582_0000517 3300046473 Bacteria 21232
363 Ga0495582_0465490 3300046473 Bacteria 730
364 Ga0495639_0023320 3300046475 Bacteria 2719
365 Ga0495639_0409729 3300046475 Unclassified 685
366 Ga0495664_0279681 3300046477 Bacteria 1008
367 Ga0495594_0028862 3300046499 Bacteria 2995
368 Ga0495594_0093596 3300046499 Bacteria 1686
369 Ga0495594_0146483 3300046499 Bacteria 1340
370 Ga0495608_0246229 3300046511 Bacteria 1115
371 Ga0495608_0298588 3300046511 Unclassified 997
372 Ga0495618_0399205 3300046514 Bacteria 841
373 Ga0495618_0500713 3300046514 Bacteria 732
374 Ga0495628_0002142 3300046516 Bacteria 17885
375 Ga0495628_0045572 3300046516 Bacteria 3485
376 Ga0495628_0058322 3300046516 Bacteria 3034
377 Ga0495628_0113145 3300046516 Unclassified 2086
378 Ga0495630_0008238 3300046517 Bacteria 7486
379 Ga0495630_0011640 3300046517 Bacteria 6375
380 Ga0495630_0026115 3300046517 Bacteria 4322
381 Ga0495630_0035444 3300046517 Bacteria 3728
382 Ga0495630_0058622 3300046517 Unclassified 2887
383 Ga0495630_0174109 3300046517 Bacteria 1640
384 Ga0495630_0264802 3300046517 Bacteria 1313
385 Ga0495630_0500352 3300046517 Unclassified 932
386 Ga0495630_0503143 3300046517 Bacteria 929
387 Ga0495630_0666049 3300046517 Unclassified 797
388 Ga0495666_0004073 3300046526 Bacteria 7385
389 Ga0495652_0008631 3300046529 Bacteria 9289
390 Ga0495652_0013985 3300046529 Bacteria 7213
391 Ga0495652_0663993 3300046529 Bacteria 705
392 Ga0495652_0665667 3300046529 Unclassified 704
393 Ga0495665_0009226 3300046531 Bacteria 5345
394 Ga0495640_0054295 3300046533 Bacteria 2745
395 Ga0495640_0089581 3300046533 Bacteria 2032
396 Ga0495586_0005939 3300046535 Bacteria 6535
397 Ga0495586_0024472 3300046535 Bacteria 3228
398 Ga0495586_0031399 3300046535 Bacteria 2845
399 Ga0495586_0400927 3300046535 Unclassified 789
400 Ga0495587_0000806 3300046536 Bacteria 20889
401 Ga0495587_0001016 3300046536 Bacteria 18436
402 Ga0495587_0009195 3300046536 Bacteria 6340
403 Ga0495587_0017593 3300046536 Unclassified 4440
404 Ga0495587_0317575 3300046536 Unclassified 870
405 Ga0495645_0010519 3300046543 Bacteria 6488
406 Ga0495645_0019921 3300046543 Unclassified 4836
407 Ga0495667_0003669 3300046559 Bacteria 10332
408 Ga0495667_0005779 3300046559 Bacteria 8376
409 Ga0495667_0141502 3300046559 Unclassified 1550
410 Ga0495667_0225880 3300046559 Bacteria 1194
411 Ga0495634_0036413 3300046642 Bacteria 3366
412 Ga0495634_0129717 3300046642 Bacteria 1608
413 Ga0495635_0019083 3300046663 Bacteria 4787
414 Ga0495635_0414510 3300046663 Bacteria 893
415 Ga0495659_0188197 3300046664 Unclassified 843
416 Ga0495588_0376613 3300046674 Bacteria 745
417 Ga0495657_0005455 3300046675 Bacteria 10072
418 Ga0495657_0065773 3300046675 Bacteria 2383
419 Ga0495657_0088185 3300046675 Unclassified 1995
420 Ga0495657_0154977 3300046675 Bacteria 1420
421 Ga0495657_0314868 3300046675 Bacteria 931
422 Ga0495599_0101912 3300046678 Bacteria 1789
423 Ga0495599_0117194 3300046678 Bacteria 1656
424 Ga0495599_0209373 3300046678 Bacteria 1196
425 Ga0495623_0020524 3300046679 Bacteria 4269
426 Ga0495623_0032870 3300046679 Bacteria 3332
427 Ga0495623_0131189 3300046679 Bacteria 1500
428 Ga0495623_0178804 3300046679 Bacteria 1234
429 Ga0495623_0388217 3300046679 Bacteria 753
430 Ga0495646_0004263 3300046680 Bacteria 9000
431 Ga0495646_0011976 3300046680 Bacteria 5517
432 Ga0495647_0249668 3300046681 Bacteria 789
433 Ga0495658_0005953 3300046683 Bacteria 5988
434 Ga0495658_0097438 3300046683 Bacteria 1750
435 Ga0495658_0415103 3300046683 Bacteria 858
436 Ga0495613_0013697 3300046689 Bacteria 6016
437 Ga0495613_0026289 3300046689 Bacteria 4337
438 Ga0495613_0098650 3300046689 Bacteria 2111
439 Ga0495613_0102259 3300046689 Unclassified 2069
440 Ga0495613_0218955 3300046689 Bacteria 1337
441 Ga0495624_0004387 3300046690 Bacteria 10320
442 Ga0495624_0330636 3300046690 Bacteria 917
443 Ga0495600_0009959 3300046809 Bacteria 5888
444 Ga0495600_0178619 3300046809 Unclassified 1368
445 Ga0495581_0027458 3300047315 Bacteria 3301
446 Ga0495581_0139312 3300047315 Bacteria 1415
447 Ga0495604_0000576 3300047317 Bacteria 32119
448 Ga0495604_0002583 3300047317 Bacteria 14505
449 Ga0495604_0005994 3300047317 Bacteria 9651
450 Ga0495604_0015002 3300047317 Bacteria 6181
451 Ga0495604_0043561 3300047317 Bacteria 3512
452 Ga0495604_0319259 3300047317 Bacteria 1038
453 Ga0495674_0009734 3300047319 Bacteria 9124
454 Ga0495674_0016477 3300047319 Bacteria 6893
455 Ga0495674_0039517 3300047319 Bacteria 4228
456 Ga0495674_0079363 3300047319 Bacteria 2818
457 Ga0495674_0204262 3300047319 Unclassified 1638
458 Ga0495674_0794728 3300047319 Bacteria 736
459 Ga0495672_0002923 3300047320 Bacteria 15089
460 Ga0495676_0008903 3300047321 Bacteria 9167
461 Ga0495680_0000034 3300047322 Bacteria 107708
462 Ga0495680_0006713 3300047322 Bacteria 10647
463 Ga0495680_0036858 3300047322 Bacteria 3922
464 Ga0495680_0121929 3300047322 Unclassified 1924
465 Ga0495675_0001342 3300047444 Bacteria 14908
466 Ga0495675_0001424 3300047444 Bacteria 14498
467 Ga0495675_0033695 3300047444 Bacteria 3269
468 Ga0495675_0049820 3300047444 Bacteria 2661
469 Ga0495675_0134862 3300047444 Unclassified 1533
470 Ga0495675_0191204 3300047444 Bacteria 1249
471 Ga0495684_0000646 3300047471 Bacteria 28009
472 Ga0495684_0014713 3300047471 Bacteria 6023
473 Ga0495684_0040653 3300047471 Bacteria 3564
474 Ga0495684_0241284 3300047471 Bacteria 1318
475 Ga0495684_0360999 3300047471 Bacteria 1029
476 Ga0495684_0426647 3300047471 Bacteria 926
477 Ga0495593_0066813 3300047673 Bacteria 1873
478 Ga0495593_0261881 3300047673 Bacteria 865
479 Ga0495602_0000595 3300048088 Bacteria 33887
480 Ga0495602_0021642 3300048088 Bacteria 6322
481 Ga0495602_0030322 3300048088 Bacteria 5132
482 Ga0495602_0042050 3300048088 Bacteria 4166
483 Ga0495602_0380982 3300048088 Bacteria 1010
484 Ga0495614_0019855 3300048089 Bacteria 2907
485 Ga0496100_0700917 3300048903 Unclassified 790
486 Ga0496100_0805980 3300048903 Unclassified 736
487 Ga0496101_0383266 3300048904 Unclassified 1106
488 Ga0496102_0001855 3300048905 Bacteria 18206
489 Ga0496106_0136024 3300048909 Unclassified 1930
490 Ga0496112_0011140 3300048915 Bacteria 8199
491 Ga0496112_0583292 3300048915 Unclassified 1050
492 Ga0496114_0002601 3300048917 Bacteria 13776
493 Ga0496114_0400681 3300048917 Bacteria 1215
494 Ga0496115_0005959 3300048918 Bacteria 8894
495 Ga0496115_0014350 3300048918 Bacteria 5997
496 Ga0496115_0021073 3300048918 Bacteria 5030
497 Ga0496126_0048076 3300048929 Bacteria 3902
498 Ga0496126_0229301 3300048929 Bacteria 1557
499 Ga0501034_0226317 3300049571 Bacteria 1821
500 Ga0501080_0384767 3300049742 Bacteria 1264
501 nmdc:mga0n895_139293_c1 3300050512 Bacteria 2454
502 nmdc:mga0n895_421156_c1 3300050512 Unclassified 1350
503 nmdc:mga0n895_948683_c1 3300050512 Unclassified 844
504 nmdc:mga0rr50_17256_c1 3300050513 Unclassified 4815
505 nmdc:mga0rr50_319629_c1 3300050513 Unclassified 1301
506 nmdc:mga0rr50_541213_c1 3300050513 Unclassified 991
507 nmdc:mga08x19_126612_c1 3300050514 Unclassified 1716
508 nmdc:mga08x19_18208_c1 3300050514 Unclassified 4304
509 nmdc:mga08x19_36866_c1 3300050514 Bacteria 3099
510 nmdc:mga0a205_242532_c1 3300050515 Bacteria 1683
511 nmdc:mga0a205_613784_c1 3300050515 Unclassified 940
512 Ga0495601_0127443 3300053077 Bacteria 1656
513 Ga0495601_0315326 3300053077 Unclassified 1018
514 Ga0495612_0009361 3300053078 Bacteria 3978
515 Ga0495612_0028468 3300053078 Unclassified 2250
516 Ga0495595_0364907 3300053084 Bacteria 730
517 Ga0495619_0057441 3300053085 Bacteria 2583
518 Ga0495619_0277639 3300053085 Unclassified 1161
519 Ga0495619_0510788 3300053085 Unclassified 826
520 Ga0500641_0009114 3300053096 Bacteria 3560
521 Ga0500568_0000591 3300053139 Bacteria 26375
522 Ga0500616_0139731 3300053153 Bacteria 1134
523 Ga0590071_005366 3300059421 Bacteria 3085
524 Ga0590075_006824 3300059424 Unclassified 2702
525 Ga0590077_011459 3300059426 Bacteria 1831
526 Ga0501082_0275303 3300060353 Bacteria 1465
527 Ga0207665_10201384
528 Ga0070680_100103172
529 Ga0070689_100342233
530 Ga0070661_100643284
531 Ga0070675_100066865
532 Ga0070659_100013719
533 Ga0070659_100092758
534 Ga0070709_10007193
535 Ga0070709_10020104
536 Ga0070709_10155609
537 Ga0070714_100246704
538 Ga0070714_100988250
539 Ga0070713_100022325
540 Ga0070713_100052151
541 Ga0070713_100598739
542 Ga0070710_10022247
543 Ga0070710_10077756
544 Ga0070711_100073374
545 Ga0070711_100233958
546 Ga0070711_100272106
547 Ga0070705_100013378
548 Ga0070705_100057062
549 Ga0070694_100014240
550 Ga0070694_100058812
551 Ga0070708_100006942
552 Ga0070708_100007749
553 Ga0070708_100078882
554 Ga0070708_100387729
555 Ga0070681_10066052
556 Ga0070681_10319898
557 Ga0068867_100629620
558 Ga0070706_100008374
559 Ga0070706_100111978
560 Ga0070707_100000776
561 Ga0070707_100213489
562 Ga0070707_100494385
563 Ga0070698_100000682
564 Ga0070698_100121345
565 Ga0070698_100184035
566 Ga0070699_100002249
567 Ga0070699_100024776
568 Ga0070699_100079104
569 Ga0070699_100507696
570 Ga0070699_101032453
571 Ga0070679_100005675
572 Ga0070679_100223079
573 Ga0070697_100000928
574 Ga0070697_100008528
575 Ga0070697_100024455
576 Ga0070697_100036717
577 Ga0070697_100129785
578 Ga0070697_100695181
579 Ga0070696_100000476
580 Ga0070693_100000240
581 Ga0070693_100017103
582 Ga0070665_100030039
583 Ga0070704_100894762
584 Ga0068855_100023314
585 Ga0068856_100001755
586 Ga0068856_100571105
587 Ga0068859_100741588
588 Ga0068861_100154007
589 Ga0068863_100011397
590 Ga0068860_100063890
591 Ga0068860_100471014
592 Ga0070717_10128740
593 Ga0070717_10308416
594 Ga0070717_10323270
595 Ga0070717_10719583
596 Ga0070716_100004604
597 Ga0070716_100028067
598 Ga0070716_100054141
599 Ga0070716_100136413
600 Ga0070712_100164590
601 Ga0070712_100180899
602 Ga0070712_100448110
603 Ga0070712_100647334
604 Ga0097621_100033233
605 Ga0075433_10629785
606 Ga0075434_100016674
607 Ga0075434_100038488
608 Ga0075434_100535661
609 Ga0075434_100691849
610 Ga0075436_100003899
611 Ga0075436_100017049
612 Ga0075436_100110530
613 Ga0097620_100741782
614 Ga0075435_100123014
615 Ga0075435_100254338
616 Ga0075435_100338491
617 Ga0099794_10006680
618 Ga0099794_10007464
619 Ga0099794_10010436
620 Ga0099794_10031993
621 Ga0099794_10040410
622 Ga0099794_10063571
623 Ga0099794_10157549
624 Ga0099794_10216424
625 Ga0099794_10306712
626 Ga0099794_10379435
627 Ga0099795_10248911
628 Ga0105240_10032651
629 Ga0105240_10254351
630 Ga0105245_10098038
631 Ga0105247_10492454
632 Ga0105242_10284813
633 Ga0105242_10541546
634 Ga0105248_10412162
635 Ga0105237_10074510
636 Ga0105237_10138636
637 Ga0105237_10252193
638 Ga0105237_10491976
639 Ga0099796_10039400
640 Ga0099796_10054446
641 Ga0099796_10122281
642 Ga0157373_10055773
643 Ga0157373_10111036
644 Ga0157371_10113175
645 Ga0157370_10328202
646 Ga0157369_10079538
647 Ga0157374_10018232
648 Ga0157374_10050226
649 Ga0157374_10374188
650 Ga0157378_10000506
651 Ga0157378_10000659
652 Ga0163162_10126135
653 Ga0163162_11277381
654 Ga0157372_10101910
655 Ga0157372_10231329
656 Ga0157375_10176320
657 Ga0163163_10259502
658 Ga0163163_10379604
659 Ga0163163_10933556
660 Ga0157380_10676279
661 Ga0157379_10005520
662 Ga0157379_10350470
663 Ga0157376_10000036
664 Ga0157376_10004257
665 Ga0157376_10015634
666 Ga0163161_10636155
667 Ga0213873_10024799
668 Ga0213872_10000138
669 Ga0213874_10064643
670 Ga0213876_10001745
671 Ga0213876_10017583
672 Ga0213876_10104571
673 Ga0213875_10024424
674 Ga0213875_10027022
675 Ga0213875_10183214
676 Ga0213871_10002042
677 Ga0228598_1003380
678 Ga0207682_10075492
679 Ga0207647_10217247
680 Ga0207685_10056726
681 Ga0207685_10154342
682 Ga0207699_10001715
683 Ga0207699_10573552
684 Ga0207643_10108056
685 Ga0207684_10060011
686 Ga0207684_10077011
687 Ga0207684_10141755
688 Ga0207695_10134322
689 Ga0207671_10305166
690 Ga0207671_10398834
691 Ga0207693_10025266
692 Ga0207693_10026607
693 Ga0207693_10066919
694 Ga0207693_10106832
695 Ga0207693_10147699
696 Ga0207693_10283322
697 Ga0207693_10504015
698 Ga0207663_10021378
699 Ga0207663_10033122
700 Ga0207663_10105464
701 Ga0207663_10188846
702 Ga0207663_10269652
703 Ga0207663_10453489
704 Ga0207657_10177339
705 Ga0207649_10479738
706 Ga0207652_10214557
707 Ga0207646_10000005
708 Ga0207646_10072726
709 Ga0207646_10106242
710 Ga0207646_10112642
711 Ga0207646_10399199
712 Ga0207659_10104524
713 Ga0207659_10465913
714 Ga0207687_10077896
715 Ga0207700_10091340
716 Ga0207700_10170797
717 Ga0207700_10367875
718 Ga0207690_10024516
719 Ga0207686_10413604
720 Ga0207670_10536093
721 Ga0207665_10000119
722 Ga0207665_10016805
723 Ga0207665_10027725
724 Ga0207665_10152987
725 Ga0207665_10331928
726 Ga0207711_10124802
727 Ga0207689_10088605
728 Ga0207679_10069901
729 Ga0207667_10010408
730 Ga0207702_10012972
731 Ga0207702_10170476
732 Ga0207702_10211796
733 Ga0207641_10011796
734 Ga0207641_10178433
735 Ga0207648_10325635
736 Ga0207675_100059968
737 Ga0209970_1049369
738 Ga0209588_1011734
739 Ga0209588_1032735
740 Ga0209588_1071085
741 Ga0209588_1076944
742 Ga0209588_1135409
743 Ga0209974_10137102
744 Ga0265354_1000371
745 Ga0265354_1000399
746 Ga0268266_10001160
747 Ga0268265_11155941
748 Ga0265319_1021402
749 Ga0265319_1042770
750 Ga0265318_10010951
751 Ga0265318_10131959
752 Ga0265322_10058090
753 Ga0265338_10020622
754 Ga0265338_10090275
755 Ga0265338_10223794
756 Ga0265338_10443797
757 Ga0265770_1001511
758 Ga0265770_1005130
759 Ga0265765_1000030
760 Ga0265760_10007460
761 Ga0265760_10062068
762 Ga0265760_10065034
763 Ga0265320_10002139
764 Ga0265325_10001923
765 Ga0265325_10035451
766 Ga0265325_10055774
767 Ga0265325_10155209
768 Ga0265325_10182934
769 Ga0265329_10000189
770 Ga0265329_10007541
771 Ga0265340_10007367
772 Ga0265340_10226873
773 Ga0265339_10008748
774 Ga0265339_10130575
775 Ga0265331_10000503
776 Ga0265331_10024304
777 Ga0265331_10067598
778 Ga0265316_10001492
779 Ga0265316_10006438
780 Ga0265316_10291174
781 Ga0265316_10581688
782 Ga0265313_10001371
783 Ga0265313_10025822
784 Ga0265313_10244955
785 Ga0265314_10110274
786 Ga0265314_10170923
787 Ga0265314_10398490
788 Ga0265342_10000864
789 Ga0265342_10163892
790 Ga0307414_10856354
791 Ga0307411_11009005
792 Ga0316593_10028366
793 Ga0316592_1073338
794 Ga0316212_1000477
795 Ga0316212_1005670
796 Ga0373926_0000587
797 Ga0373926_0005279
798 Ga0373934_0001307
799 Ga0373934_0013306
800 Ga0373923_0055659
801 Ga0373945_0122484
802 Ga0373953_0009118
803 Ga0373954_0000343
804 Ga0373954_0105196
805 Ga0373956_0000675
806 Ga0373956_0165016
807 Ga0373957_0018377
808 Ga0373946_0036228
809 Ga0373955_0002660
810 Ga0373955_0013848
811 Ga0373955_0146800
812 Ga0373955_0573084
813 Ga0316574_0136407
814 Ga0373924_0052486
815 Ga0373931_0260541
816 Ga0373935_0013093
817 Ga0373935_0090684
818 Ga0373927_0000851
819 Ga0373927_0084695
820 Ga0373927_0109801
821 Ga0373933_0000923
822 Ga0373933_0002440
823 Ga0373947_0002491
824 Ga0373947_0236928
825 Ga0373947_0429450
826 Ga0373937_0002177
827 Ga0373937_0002271
828 Ga0373937_0027792
829 Ga0373937_0073040
830 Ga0373937_0508003
831 Ga0373925_0000566
832 Ga0373925_0405529
833 Ga0373925_0888515
834 Ga0436364_0205700
835 Ga0436364_0271230
836 Ga0436364_0622909
837 Ga0436364_1298431
838 Ga0436364_1348647
839 Ga0436364_1548942
840 Ga0395901_0602103
841 Ga0436365_0023156
842 Ga0436365_0202626
843 Ga0436365_0570143
844 Ga0436365_0865439
845 Ga0436365_1617620
846 Ga0436365_1829002
847 Ga0436365_1852011
848 Ga0436360_0477583
849 Ga0436361_0444282
850 Ga0436361_0574297
851 Ga0436361_1089336
852 Ga0436363_0480496
853 Ga0436363_1588665
854 Ga0436362_0315222
855 Ga0436362_0734721
856 Ga0436362_1208510
857 Ga0451853_0526503
858 Ga0451577_0020498
859 Ga0451577_0370255
860 Ga0453683_0004020
861 Ga0453683_0006078
862 Ga0453683_0429672
863 Ga0453683_0742226
864 Ga0453684_0013997
865 Ga0466957_0205634
866 Ga0451576_0024948
867 Ga0495592_0025100
868 Ga0495592_0077784
869 Ga0495592_0164733
870 Ga0495592_0210865
871 Ga0495603_0140931
872 Ga0495629_0011280
873 Ga0495651_0000096
874 Ga0495651_0000672
875 Ga0495651_0015503
876 Ga0495651_0053613
877 Ga0495651_0066837
878 Ga0495651_0267572
879 Ga0495651_0532564
880 Ga0495653_0016759
881 Ga0495653_0055462
882 Ga0495653_0364312
883 Ga0495580_0000163
884 Ga0495580_0021868
885 Ga0495580_0038671
886 Ga0495580_0270732
887 Ga0495580_0349823
888 Ga0495582_0000517
889 Ga0495582_0465490
890 Ga0495639_0023320
891 Ga0495639_0409729
892 Ga0495664_0279681
893 Ga0495594_0028862
894 Ga0495594_0093596
895 Ga0495594_0146483
896 Ga0495608_0246229
897 Ga0495608_0298588
898 Ga0495618_0399205
899 Ga0495618_0500713
900 Ga0495628_0002142
901 Ga0495628_0045572
902 Ga0495628_0058322
903 Ga0495628_0113145
904 Ga0495630_0008238
905 Ga0495630_0011640
906 Ga0495630_0026115
907 Ga0495630_0035444
908 Ga0495630_0058622
909 Ga0495630_0174109
910 Ga0495630_0264802
911 Ga0495630_0500352
912 Ga0495630_0503143
913 Ga0495630_0666049
914 Ga0495666_0004073
915 Ga0495652_0008631
916 Ga0495652_0013985
917 Ga0495652_0663993
918 Ga0495652_0665667
919 Ga0495665_0009226
920 Ga0495640_0054295
921 Ga0495640_0089581
922 Ga0495586_0005939
923 Ga0495586_0024472
924 Ga0495586_0031399
925 Ga0495586_0400927
926 Ga0495587_0000806
927 Ga0495587_0001016
928 Ga0495587_0009195
929 Ga0495587_0017593
930 Ga0495587_0317575
931 Ga0495645_0010519
932 Ga0495645_0019921
933 Ga0495667_0003669
934 Ga0495667_0005779
935 Ga0495667_0141502
936 Ga0495667_0225880
937 Ga0495634_0036413
938 Ga0495634_0129717
939 Ga0495635_0019083
940 Ga0495635_0414510
941 Ga0495659_0188197
942 Ga0495588_0376613
943 Ga0495657_0005455
944 Ga0495657_0065773
945 Ga0495657_0088185
946 Ga0495657_0154977
947 Ga0495657_0314868
948 Ga0495599_0101912
949 Ga0495599_0117194
950 Ga0495599_0209373
951 Ga0495623_0020524
952 Ga0495623_0032870
953 Ga0495623_0131189
954 Ga0495623_0178804
955 Ga0495623_0388217
956 Ga0495646_0004263
957 Ga0495646_0011976
958 Ga0495647_0249668
959 Ga0495658_0005953
960 Ga0495658_0097438
961 Ga0495658_0415103
962 Ga0495613_0013697
963 Ga0495613_0026289
964 Ga0495613_0098650
965 Ga0495613_0102259
966 Ga0495613_0218955
967 Ga0495624_0004387
968 Ga0495624_0330636
969 Ga0495600_0009959
970 Ga0495600_0178619
971 Ga0495581_0027458
972 Ga0495581_0139312
973 Ga0495604_0000576
974 Ga0495604_0002583
975 Ga0495604_0005994
976 Ga0495604_0015002
977 Ga0495604_0043561
978 Ga0495604_0319259
979 Ga0495674_0009734
980 Ga0495674_0016477
981 Ga0495674_0039517
982 Ga0495674_0079363
983 Ga0495674_0204262
984 Ga0495674_0794728
985 Ga0495672_0002923
986 Ga0495676_0008903
987 Ga0495680_0000034
988 Ga0495680_0006713
989 Ga0495680_0036858
990 Ga0495680_0121929
991 Ga0495675_0001342
992 Ga0495675_0001424
993 Ga0495675_0033695
994 Ga0495675_0049820
995 Ga0495675_0134862
996 Ga0495675_0191204
997 Ga0495684_0000646
998 Ga0495684_0014713
999 Ga0495684_0040653
1000 Ga0495684_0241284
1001 Ga0495684_0360999
1002 Ga0495684_0426647
1003 Ga0495593_0066813
1004 Ga0495593_0261881
1005 Ga0495602_0000595
1006 Ga0495602_0021642
1007 Ga0495602_0030322
1008 Ga0495602_0042050
1009 Ga0495602_0380982
1010 Ga0495614_0019855
1011 Ga0496100_0700917
1012 Ga0496100_0805980
1013 Ga0496101_0383266
1014 Ga0496102_0001855
1015 Ga0496106_0136024
1016 Ga0496112_0011140
1017 Ga0496112_0583292
1018 Ga0496114_0002601
1019 Ga0496114_0400681
1020 Ga0496115_0005959
1021 Ga0496115_0014350
1022 Ga0496115_0021073
1023 Ga0496126_0048076
1024 Ga0496126_0229301
1025 Ga0501034_0226317
1026 Ga0501080_0384767
1027 nmdc:mga0n895_139293_c1
1028 nmdc:mga0n895_421156_c1
1029 nmdc:mga0n895_948683_c1
1030 nmdc:mga0rr50_17256_c1
1031 nmdc:mga0rr50_319629_c1
1032 nmdc:mga0rr50_541213_c1
1033 nmdc:mga08x19_126612_c1
1034 nmdc:mga08x19_18208_c1
1035 nmdc:mga08x19_36866_c1
1036 nmdc:mga0a205_242532_c1
1037 nmdc:mga0a205_613784_c1
1038 Ga0495601_0127443
1039 Ga0495601_0315326
1040 Ga0495612_0009361
1041 Ga0495612_0028468
1042 Ga0495595_0364907
1043 Ga0495619_0057441
1044 Ga0495619_0277639
1045 Ga0495619_0510788
1046 Ga0500641_0009114
1047 Ga0500568_0000591
1048 Ga0500616_0139731
1049 Ga0590071_005366
1050 Ga0590075_006824
1051 Ga0590077_011459
1052 Ga0501082_0275303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

204

227

0.99

PF13662

Toprim_4

Toprim domain

111

202

0.98

PF21176

RecR_HhH

RecR, helix-hairpin-helix

38

82

0.97

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

85

104

0.95

PF01751

Toprim

Toprim domain

112

202

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9396 82 172
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9199 82 172
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8951 19 199
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8904 19 199
8a93-assembly1.cif.gz_D complex of recf-recr-dna from thermus thermophilus. 0.8901 5 47
ID Description Score Start End Superfamily
3vdpA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9953 4 54 1.10.8.420
3vdpB01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9946 5 54 1.10.8.420
3vdpC01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9922 4 54 1.10.8.420
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9857 78 199 3.40.1360.10
3vduA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9834 5 54 1.10.8.420
ID Description Score Start End GO Terms
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9821 71 172 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.9798 60 156 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.97 60 156 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-W4U8H3-F1-model_v4 deleted 0.9566 53 145
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9545 71 172 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Map