F459414

General Info

Members Datasets Scaffolds Average Seq Length
526 353 1052 348

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10000105|Ga0207654_1000010557
Length 403
Sequence LQGQSQRLQVRPGHPDEEVINGGGWFCAATFDSVGLTLFTPGKNMTQTIFEHGTARRVMYAGVGVVMLMLGTLSEPACADEGGVSYWLPGRFSSLSATPQVPGWSMAEVYYHTTIGGSGAVAAAREIEIGKIPASANVSLNARLNAQADLVLLNPTYTFATPVLGGQLAIGVTSLFGRASASIDGTLTSAIGPLVTTRTGSVADSITSFGDLYPQATLKWNAGVHNFMTYVTGDIPVGAYESARLANLGIGHGAIDGGGGYTYFNPATGQEFSAVAGFTYNFKNQDTNYQNGIDFHIDWGASQFLSKQVFVGLVGYGYQQLTDDFGAHPILGGFRSRVLGIGPQIGFLFPVGDMQGYLNLKGYGEFDAANRASGWNTWLTFSISPTAPASTSASAPTRRIATK

Samples

Sample ID Description Type Environment
1 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
45 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
65 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
66 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
67 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
103 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
104 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
105 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
115 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
234 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
235 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
236 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
242 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
243 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
246 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
247 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
248 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
249 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
250 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
251 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
252 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
253 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
254 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
255 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
256 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
257 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
258 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
259 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
260 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
261 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
262 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
263 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
264 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
265 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
266 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
267 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
268 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
269 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
270 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
271 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
272 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
273 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
274 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
275 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
276 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
277 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
278 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
279 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
280 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
281 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
282 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
283 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
284 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
285 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
286 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
287 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
288 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
289 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
290 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
291 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
292 2922425934
293 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
294 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
295 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
296 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
297 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
298 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
299 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
300 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
301 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
302 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
303 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
304 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
305 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
306 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
307 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
308 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
309 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
310 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
311 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
312 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
313 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
314 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
315 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
316 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
317 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
318 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
319 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
320 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
321 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
322 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
323 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
324 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
325 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
326 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
327 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
328 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
329 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
330 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
331 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
332 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
333 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
334 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
335 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
336 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
337 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
338 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
339 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
340 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
341 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
342 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
343 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
344 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
345 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
346 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
347 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
348 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
349 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
350 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
351 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
352 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
353 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.52
Metatranscriptomes 0
Isolates 22.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.27
Nodule 19.58
Rhizoplane 7.03
Rhizosphere 51.14
Stem 0
Stem Tuber 0
Unclassified 1.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207654_10000105 3300025911 Bacteria 55481
2 JGI24740J21852_10002447 3300001979 Bacteria 8421
3 JGI25153J46596_10000910 3300003215 Bacteria 17982
4 rootH1_10075902 3300003316 Bacteria 1521
5 rootL2_10238319 3300003322 Bacteria 6294
6 rootH1_10121635 3300003323 Bacteria 2546
7 rootH1_10317870 3300003323 Bacteria 1523
8 rootH1_10378669 3300003323 Bacteria 1843
9 Ga0070658_10018663 3300005327 Bacteria 5555
10 Ga0070680_100191107 3300005336 Bacteria 1725
11 Ga0068868_100139004 3300005338 Bacteria 1992
12 Ga0070660_100263078 3300005339 Bacteria 1409
13 Ga0070668_100042016 3300005347 Bacteria 3503
14 Ga0070668_100133182 3300005347 Bacteria 1996
15 Ga0070671_100009546 3300005355 Bacteria 7793
16 Ga0070671_100094419 3300005355 Bacteria 2507
17 Ga0070709_10112161 3300005434 Bacteria 1834
18 Ga0070713_100060379 3300005436 Bacteria 3169
19 Ga0070711_100010496 3300005439 Bacteria 5735
20 Ga0070711_100035356 3300005439 Bacteria 3340
21 Ga0070663_100009311 3300005455 Bacteria 6078
22 Ga0070663_100029740 3300005455 Bacteria 3736
23 Ga0070663_100035922 3300005455 Bacteria 3441
24 Ga0070678_100140740 3300005456 Bacteria 1930
25 Ga0070679_100091781 3300005530 Bacteria 3025
26 Ga0068853_100002951 3300005539 Bacteria 12948
27 Ga0068853_100066587 3300005539 Bacteria 3128
28 Ga0070665_100027158 3300005548 Bacteria 5765
29 Ga0070665_100083599 3300005548 Bacteria 3197
30 Ga0070665_100229131 3300005548 Bacteria 1858
31 Ga0070665_100261427 3300005548 Bacteria 1732
32 Ga0068855_100230728 3300005563 Bacteria 2073
33 Ga0070664_100043433 3300005564 Bacteria 3793
34 Ga0068857_100011465 3300005577 Bacteria 7715
35 Ga0068854_100005250 3300005578 Bacteria 8170
36 Ga0068856_100004061 3300005614 Bacteria 14643
37 Ga0068852_100001475 3300005616 Bacteria 15928
38 Ga0068852_100258954 3300005616 Bacteria 1670
39 Ga0068851_10004435 3300005834 Bacteria 6327
40 Ga0068858_100198269 3300005842 Bacteria 1898
41 Ga0068860_100247278 3300005843 Bacteria 1736
42 Ga0081540_1015001 3300005983 Bacteria 4924
43 Ga0081540_1094808 3300005983 Bacteria 1302
44 Ga0075365_10041549 3300006038 Bacteria 3005
45 Ga0075365_10107953 3300006038 Bacteria 1911
46 Ga0075368_10039936 3300006042 Bacteria 1841
47 Ga0075364_10053926 3300006051 Bacteria 2628
48 Ga0070716_100023659 3300006173 Bacteria 3259
49 Ga0070712_100053060 3300006175 Bacteria 2830
50 Ga0075362_10081276 3300006177 Bacteria 1494
51 Ga0075367_10014654 3300006178 Bacteria 4245
52 Ga0075367_10059976 3300006178 Bacteria 2267
53 Ga0075367_10077249 3300006178 Bacteria 2010
54 Ga0075369_10017072 3300006186 Bacteria 2937
55 Ga0075366_10019881 3300006195 Bacteria 3890
56 Ga0097621_100055512 3300006237 Bacteria 3235
57 Ga0097621_100068901 3300006237 Bacteria 2919
58 Ga0075370_10016348 3300006353 Bacteria 3992
59 Ga0075370_10028446 3300006353 Bacteria 3107
60 Ga0075370_10135793 3300006353 Bacteria 1437
61 Ga0068871_100008830 3300006358 Bacteria 7260
62 Ga0075434_100373584 3300006871 Bacteria 1446
63 Ga0099825_1042328 3300006941 Bacteria 1265
64 Ga0099824_1009091 3300006942 Bacteria 12394
65 Ga0099795_10005185 3300007788 Bacteria 3440
66 Ga0105240_10017175 3300009093 Bacteria 9766
67 Ga0105240_10068495 3300009093 Bacteria 4395
68 Ga0105247_10006438 3300009101 Bacteria 7271
69 Ga0105241_10001917 3300009174 Bacteria 15754
70 Ga0105241_10097465 3300009174 Bacteria 2331
71 Ga0105248_10038394 3300009177 Bacteria 5359
72 Ga0105248_10370201 3300009177 Bacteria 1613
73 Ga0105237_10004631 3300009545 Bacteria 15847
74 Ga0105237_10020496 3300009545 Bacteria 6812
75 Ga0105237_10040056 3300009545 Bacteria 4727
76 Ga0105238_10008776 3300009551 Bacteria 10111
77 Ga0105238_10014368 3300009551 Bacteria 8000
78 Ga0105238_10102902 3300009551 Bacteria 2837
79 Ga0099796_10005458 3300010159 Bacteria 3176
80 Ga0105239_10004642 3300010375 Bacteria 16328
81 Ga0105239_10007483 3300010375 Bacteria 12532
82 Ga0105239_10134530 3300010375 Bacteria 2752
83 Ga0105239_10210632 3300010375 Bacteria 2178
84 Ga0105246_10063717 3300011119 Bacteria 2572
85 Ga0105246_10085054 3300011119 Bacteria 2264
86 Ga0157374_10005055 3300013296 Bacteria 11060
87 Ga0157374_10040596 3300013296 Bacteria 4286
88 Ga0157378_10188776 3300013297 Bacteria 1942
89 Ga0163162_10028202 3300013306 Bacteria 5553
90 Ga0157372_10123656 3300013307 Bacteria 2974
91 Ga0157372_10441088 3300013307 Bacteria 1517
92 Ga0157375_10043051 3300013308 Bacteria 4375
93 Ga0157375_10078606 3300013308 Bacteria 3332
94 Ga0157375_10219818 3300013308 Bacteria 2058
95 Ga0163163_10012026 3300014325 Bacteria 7876
96 Ga0163163_10087451 3300014325 Bacteria 3127
97 Ga0157377_10123226 3300014745 Bacteria 1574
98 Ga0157376_10023738 3300014969 Bacteria 4805
99 Ga0214544_1000011 3300021320 Bacteria 262952
100 Ga0214542_1000009 3300021321 Bacteria 262861
101 Ga0214545_1000007 3300021324 Bacteria 262984
102 Ga0214543_1000020 3300021327 Bacteria 262861
103 Ga0209564_1007446 3300025295 Bacteria 5652
104 Ga0209758_1000097 3300025297 Bacteria 230529
105 Ga0209758_1000131 3300025297 Bacteria 184259
106 Ga0209758_1004491 3300025297 Bacteria 11585
107 Ga0207426_1000223 3300025302 Bacteria 132636
108 Ga0209257_1011291 3300025304 Bacteria 4326
109 Ga0207697_10066893 3300025315 Bacteria 1502
110 Ga0207710_10119350 3300025900 Bacteria 1258
111 Ga0207688_10153078 3300025901 Bacteria 1363
112 Ga0207647_10007505 3300025904 Bacteria 7876
113 Ga0207699_10024102 3300025906 Bacteria 3322
114 Ga0207699_10084693 3300025906 Bacteria 1975
115 Ga0207705_10053975 3300025909 Bacteria 2896
116 Ga0207707_10013392 3300025912 Bacteria 7151
117 Ga0207695_10001896 3300025913 Bacteria 32648
118 Ga0207671_10004597 3300025914 Bacteria 13106
119 Ga0207671_10275349 3300025914 Bacteria 1327
120 Ga0207663_10019023 3300025916 Bacteria 3860
121 Ga0207660_10053800 3300025917 Bacteria 2871
122 Ga0207649_10147243 3300025920 Bacteria 1618
123 Ga0207652_10017424 3300025921 Bacteria 5879
124 Ga0207694_10000386 3300025924 Bacteria 41080
125 Ga0207687_10137892 3300025927 Bacteria 1847
126 Ga0207700_10073966 3300025928 Bacteria 2634
127 Ga0207644_10053906 3300025931 Bacteria 2895
128 Ga0207644_10267250 3300025931 Bacteria 1369
129 Ga0207704_10351495 3300025938 Bacteria 1148
130 Ga0207711_10101515 3300025941 Bacteria 2546
131 Ga0207679_10102765 3300025945 Bacteria 2239
132 Ga0207667_10007940 3300025949 Bacteria 12666
133 Ga0207667_10136327 3300025949 Bacteria 2527
134 Ga0207677_10074996 3300026023 Bacteria 2402
135 Ga0207703_10065598 3300026035 Bacteria 2984
136 Ga0207639_10058912 3300026041 Bacteria 2956
137 Ga0207639_10097777 3300026041 Bacteria 2365
138 Ga0207639_10125247 3300026041 Bacteria 2118
139 Ga0207678_10006417 3300026067 Bacteria 10434
140 Ga0207678_10019207 3300026067 Bacteria 6000
141 Ga0207678_10040700 3300026067 Bacteria 4029
142 Ga0207678_10041566 3300026067 Bacteria 3986
143 Ga0207678_10075668 3300026067 Bacteria 2884
144 Ga0207702_10001423 3300026078 Bacteria 23907
145 Ga0207676_10097872 3300026095 Bacteria 2425
146 Ga0207674_10006297 3300026116 Bacteria 13990
147 Ga0207683_10050854 3300026121 Bacteria 3630
148 Ga0207698_10200907 3300026142 Bacteria 1785
149 Ga0209389_1000197 3300027296 Bacteria 43822
150 Ga0209589_1000006 3300027357 Bacteria 436292
151 Ga0209489_100007 3300027361 Bacteria 436292
152 Ga0209489_106166 3300027361 Bacteria 19636
153 Ga0209700_100008 3300027363 Bacteria 436292
154 Ga0209700_100010 3300027363 Bacteria 395269
155 Ga0268266_10037184 3300028379 Bacteria 4148
156 Ga0268265_10490054 3300028380 Bacteria 1156
157 Ga0265337_1013465 3300028556 Bacteria 2743
158 Ga0265326_10000653 3300028558 Bacteria 12865
159 Ga0265319_1001882 3300028563 Bacteria 11921
160 Ga0265334_10001804 3300028573 Bacteria 10200
161 Ga0265318_10002589 3300028577 Bacteria 9578
162 Ga0265323_10000182 3300028653 Bacteria 37830
163 Ga0265322_10001655 3300028654 Bacteria 7097
164 Ga0265336_10000090 3300028666 Bacteria 69623
165 Ga0307517_10000196 3300028786 Bacteria 102384
166 Ga0307515_10302175 3300028794 Bacteria 1284
167 Ga0265338_10000024 3300028800 Bacteria 297778
168 Ga0265324_10003074 3300029957 Bacteria 8139
169 Ga0265339_10019718 3300031249 Bacteria 3953
170 Ga0265331_10087273 3300031250 Bacteria 1445
171 Ga0307513_10214294 3300031456 Bacteria 1754
172 Ga0307508_10039089 3300031616 Bacteria 4263
173 Ga0307516_10000859 3300031730 Bacteria 41636
174 Ga0307516_10094691 3300031730 Bacteria 2810
175 Ga0307412_10034331 3300031911 Bacteria 3233
176 Ga0307409_100003279 3300031995 Bacteria 8740
177 Ga0307416_100048279 3300032002 Bacteria 3376
178 Ga0307416_100556974 3300032002 Bacteria 1221
179 Ga0307411_10062464 3300032005 Bacteria 2485
180 Ga0307510_10022486 3300033180 Bacteria 7323
181 Ga0307510_10076063 3300033180 Bacteria 3305
182 Ga0307510_10096571 3300033180 Bacteria 2770
183 Ga0373926_0010741 3300035083 Bacteria 3073
184 Ga0373944_0013696 3300035089 Bacteria 2254
185 Ga0373936_0052011 3300035113 Unclassified 1659
186 Ga0373946_0000458 3300035171 Bacteria 13474
187 Ga0373924_0046259 3300035410 Bacteria 1792
188 Ga0373924_0074254 3300035410 Bacteria 1438
189 Ga0373935_0006657 3300035692 Bacteria 6903
190 Ga0373927_0001108 3300035695 Bacteria 20449
191 Ga0373933_0196178 3300035724 Bacteria 1291
192 Ga0373947_0002780 3300035725 Bacteria 10462
193 Ga0373947_0005069 3300035725 Bacteria 7715
194 Ga0373937_0009350 3300036401 Bacteria 8514
195 Ga0373937_0094530 3300036401 Bacteria 2772
196 Ga0373925_0002018 3300037068 Bacteria 16810
197 Ga0373925_0030559 3300037068 Bacteria 3954
198 Ga0395901_0038010 3300038443 Bacteria 4979
199 Ga0395901_0412966 3300038443 Bacteria 1385
200 Ga0451789_0480730 3300041443 Bacteria 1596
201 Ga0466965_0008723 3300044683 Bacteria 4695
202 Ga0495592_0026398 3300046454 Bacteria 4403
203 Ga0495592_0031182 3300046454 Bacteria 4030
204 Ga0495629_0034194 3300046459 Bacteria 3593
205 Ga0495629_0120205 3300046459 Unclassified 1830
206 Ga0495638_0033175 3300046460 Bacteria 3303
207 Ga0495638_0040367 3300046460 Bacteria 2957
208 Ga0495651_0025537 3300046462 Bacteria 4599
209 Ga0495651_0056347 3300046462 Bacteria 3020
210 Ga0495653_0089390 3300046463 Bacteria 2257
211 Ga0495580_0099563 3300046472 Bacteria 2022
212 Ga0495664_0009170 3300046477 Bacteria 5530
213 Ga0495664_0015664 3300046477 Bacteria 4313
214 Ga0495664_0035761 3300046477 Unclassified 2926
215 Ga0495664_0038445 3300046477 Bacteria 2825
216 Ga0495606_0001547 3300046507 Bacteria 30291
217 Ga0495606_0038050 3300046507 Bacteria 3258
218 Ga0495606_0162813 3300046507 Bacteria 1300
219 Ga0495608_0119651 3300046511 Bacteria 1689
220 Ga0495608_0190638 3300046511 Bacteria 1294
221 Ga0495618_0006329 3300046514 Bacteria 7185
222 Ga0495628_0015987 3300046516 Bacteria 6261
223 Ga0495628_0033048 3300046516 Bacteria 4172
224 Ga0495628_0168835 3300046516 Bacteria 1659
225 Ga0495630_0014436 3300046517 Bacteria 5756
226 Ga0495630_0117174 3300046517 Bacteria 2019
227 Ga0495630_0174130 3300046517 Bacteria 1640
228 Ga0495643_0005555 3300046522 Bacteria 8494
229 Ga0495643_0120668 3300046522 Bacteria 1325
230 Ga0495648_0071354 3300046524 Bacteria 2014
231 Ga0495666_0043111 3300046526 Bacteria 2181
232 Ga0495652_0083039 3300046529 Bacteria 2638
233 Ga0495652_0094069 3300046529 Bacteria 2445
234 Ga0495652_0115408 3300046529 Bacteria 2151
235 Ga0495665_0006600 3300046531 Bacteria 6267
236 Ga0495665_0047000 3300046531 Bacteria 2290
237 Ga0495640_0032804 3300046533 Plasmid 3695
238 Ga0495640_0048892 3300046533 Bacteria 2919
239 Ga0495640_0078803 3300046533 Bacteria 2194
240 Ga0495587_0017804 3300046536 Bacteria 4407
241 Ga0495587_0099450 3300046536 Bacteria 1676
242 Ga0495645_0027268 3300046543 Bacteria 4148
243 Ga0495645_0042211 3300046543 Bacteria 3325
244 Ga0495645_0056062 3300046543 Bacteria 2861
245 Ga0495645_0160911 3300046543 Unclassified 1552
246 Ga0495645_0200931 3300046543 Bacteria 1352
247 Ga0495622_0029615 3300046557 Bacteria 2558
248 Ga0495668_0041289 3300046616 Bacteria 2570
249 Ga0495634_0041644 3300046642 Bacteria 3119
250 Ga0495634_0062512 3300046642 Unclassified 2472
251 Ga0495634_0158270 3300046642 Bacteria 1429
252 Ga0495611_0034530 3300046648 Bacteria 2236
253 Ga0495625_0162951 3300046660 Bacteria 1493
254 Ga0495635_0016793 3300046663 Bacteria 5112
255 Ga0495635_0022626 3300046663 Plasmid 4380
256 Ga0495635_0087059 3300046663 Bacteria 2137
257 Ga0495635_0136385 3300046663 Bacteria 1672
258 Ga0495588_0005903 3300046674 Bacteria 5491
259 Ga0495657_0014022 3300046675 Bacteria 5887
260 Ga0495657_0039702 3300046675 Bacteria 3233
261 Ga0495599_0027386 3300046678 Bacteria 3573
262 Ga0495599_0061355 3300046678 Bacteria 2350
263 Ga0495599_0119320 3300046678 Bacteria 1640
264 Ga0495623_0095537 3300046679 Bacteria 1817
265 Ga0495646_0040848 3300046680 Bacteria 2854
266 Ga0495646_0056623 3300046680 Bacteria 2350
267 Ga0495658_0179444 3300046683 Bacteria 1313
268 Ga0495613_0047217 3300046689 Bacteria 3181
269 Ga0495613_0245721 3300046689 Bacteria 1250
270 Ga0495624_0003447 3300046690 Bacteria 11731
271 Ga0495624_0085224 3300046690 Bacteria 1952
272 Ga0495624_0100506 3300046690 Bacteria 1781
273 Ga0495600_0030456 3300046809 Bacteria 3495
274 Ga0495600_0035725 3300046809 Bacteria 3230
275 Ga0495600_0066984 3300046809 Bacteria 2347
276 Ga0495600_0091914 3300046809 Bacteria 1979
277 Ga0495581_0072763 3300047315 Bacteria 1989
278 Ga0495581_0144864 3300047315 Bacteria 1386
279 Ga0495604_0007508 3300047317 Bacteria 8628
280 Ga0495604_0035398 3300047317 Bacteria 3943
281 Ga0495604_0039462 3300047317 Bacteria 3711
282 Ga0495604_0099680 3300047317 Bacteria 2137
283 Ga0495604_0237514 3300047317 Unclassified 1248
284 Ga0495674_0008248 3300047319 Bacteria 9939
285 Ga0495674_0033651 3300047319 Bacteria 4641
286 Ga0495674_0082225 3300047319 Unclassified 2761
287 Ga0495674_0107070 3300047319 Bacteria 2373
288 Ga0495672_0052146 3300047320 Bacteria 2404
289 Ga0495676_0052690 3300047321 Bacteria 3246
290 Ga0495680_0051514 3300047322 Bacteria 3213
291 Ga0495680_0088719 3300047322 Bacteria 2323
292 Ga0495687_017422 3300047443 Bacteria 3585
293 Ga0495675_0025890 3300047444 Bacteria 3738
294 Ga0495675_0048384 3300047444 Bacteria 2705
295 Ga0495684_0009542 3300047471 Bacteria 7482
296 Ga0495684_0013480 3300047471 Bacteria 6290
297 Ga0495684_0022852 3300047471 Bacteria 4810
298 Ga0495684_0063553 3300047471 Bacteria 2806
299 Ga0495686_0065935 3300047472 Bacteria 2238
300 Ga0495593_0054763 3300047673 Bacteria 2101
301 Ga0495602_0018892 3300048088 Bacteria 6863
302 Ga0495602_0098633 3300048088 Bacteria 2403
303 Ga0495602_0143371 3300048088 Bacteria 1888
304 Ga0495626_0024661 3300048091 Bacteria 2947
305 Ga0496100_0016414 3300048903 Bacteria 4349
306 Ga0496100_0153910 3300048903 Bacteria 1643
307 Ga0496101_0012615 3300048904 Bacteria 5643
308 Ga0496101_0056755 3300048904 Bacteria 2831
309 Ga0496102_0257669 3300048905 Bacteria 1645
310 Ga0496103_0020632 3300048906 Bacteria 3959
311 Ga0496104_0001998 3300048907 Bacteria 17696
312 Ga0496104_0008975 3300048907 Bacteria 8890
313 Ga0496104_0014492 3300048907 Bacteria 7121
314 Ga0496104_0017052 3300048907 Bacteria 6608
315 Ga0496105_0000273 3300048908 Bacteria 34154
316 Ga0496105_0012795 3300048908 Bacteria 6649
317 Ga0496105_0013970 3300048908 Bacteria 6385
318 Ga0496105_0016084 3300048908 Bacteria 5966
319 Ga0496105_0039520 3300048908 Bacteria 3888
320 Ga0496105_0115063 3300048908 Bacteria 2219
321 Ga0496106_0001684 3300048909 Bacteria 16527
322 Ga0496106_0007770 3300048909 Bacteria 7935
323 Ga0496107_0017929 3300048910 Bacteria 4983
324 Ga0496108_0040644 3300048911 Bacteria 3879
325 Ga0496108_0144787 3300048911 Bacteria 2048
326 Ga0496109_0032589 3300048912 Bacteria 4684
327 Ga0496109_0129057 3300048912 Bacteria 2359
328 Ga0496111_0218103 3300048914 Bacteria 1417
329 Ga0496112_0030575 3300048915 Bacteria 5213
330 Ga0496112_0149700 3300048915 Bacteria 2301
331 Ga0496113_0002553 3300048916 Bacteria 10628
332 Ga0496113_0016875 3300048916 Bacteria 5054
333 Ga0496114_0053438 3300048917 Bacteria 3367
334 Ga0496114_0156932 3300048917 Bacteria 1976
335 Ga0496114_0172852 3300048917 Bacteria 1884
336 Ga0496115_0004253 3300048918 Bacteria 10354
337 Ga0496115_0010549 3300048918 Bacteria 6909
338 Ga0496115_0076511 3300048918 Bacteria 2720
339 Ga0496115_0189345 3300048918 Bacteria 1700
340 Ga0496115_0198510 3300048918 Bacteria 1657
341 Ga0496116_0018415 3300048919 Bacteria 5386
342 Ga0496117_0086095 3300048920 Bacteria 2043
343 Ga0496118_0046322 3300048921 Bacteria 3385
344 Ga0496118_0052601 3300048921 Bacteria 3104
345 Ga0496118_0084072 3300048921 Bacteria 2222
346 Ga0496119_0007234 3300048922 Bacteria 10047
347 Ga0496119_0054027 3300048922 Bacteria 2449
348 Ga0496120_0026168 3300048923 Bacteria 3607
349 Ga0496121_0018669 3300048924 Bacteria 6980
350 Ga0496121_0082376 3300048924 Bacteria 2544
351 Ga0496122_0012670 3300048925 Bacteria 8356
352 Ga0496123_0002788 3300048926 Bacteria 20780
353 Ga0496125_0009087 3300048928 Bacteria 10280
354 Ga0496125_0021745 3300048928 Bacteria 5971
355 Ga0496125_0109966 3300048928 Bacteria 2000
356 Ga0496126_0011065 3300048929 Bacteria 9378
357 Ga0496126_0031642 3300048929 Bacteria 4993
358 Ga0496126_0043147 3300048929 Bacteria 4162
359 Ga0496126_0066026 3300048929 Bacteria 3236
360 Ga0496126_0074465 3300048929 Bacteria 3015
361 Ga0496126_0100937 3300048929 Bacteria 2525
362 Ga0495682_0067209 3300049460 Bacteria 1292
363 nmdc:mga03n38_18156_c1 3300050490 Bacteria 2771
364 nmdc:mga0yw44_39081_c1 3300050492 Bacteria 2811
365 nmdc:mga0yw44_43791_c2 3300050492 Bacteria 1999
366 nmdc:mga0k408_11482_c1 3300050493 Bacteria 4826
367 nmdc:mga0k408_32911_c1 3300050493 Bacteria 2962
368 nmdc:mga06z11_113511_c1 3300050494 Bacteria 1503
369 nmdc:mga06z11_152623_c1 3300050494 Bacteria 1314
370 nmdc:mga06z11_60616_c1 3300050494 Bacteria 1971
371 nmdc:mga04h51_16877_c1 3300050495 Bacteria 2126
372 nmdc:mga07m45_109910_c1 3300050496 Bacteria 1587
373 nmdc:mga07m45_26654_c1 3300050496 Bacteria 3178
374 nmdc:mga08y16_227317_c1 3300050511 Bacteria 1930
375 nmdc:mga0sz30_18433_c1 3300050516 Bacteria 2793
376 nmdc:mga0sz30_70410_c1 3300050516 Bacteria 1505
377 Ga0495601_0000379 3300053077 Bacteria 23511
378 Ga0495601_0051044 3300053077 Bacteria 2610
379 Ga0495612_0017793 3300053078 Bacteria 2845
380 Ga0495612_0018426 3300053078 Bacteria 2797
381 Ga0495612_0031352 3300053078 Bacteria 2143
382 Ga0495612_0060058 3300053078 Unclassified 1573
383 Ga0495595_0134271 3300053084 Bacteria 1211
384 Ga0495619_0000401 3300053085 Bacteria 29541
385 Ga0495619_0024370 3300053085 Bacteria 3881
386 Ga0495619_0121168 3300053085 Bacteria 1793
387 Ga0500643_000068 3300053087 Bacteria 117369
388 Ga0500643_012251 3300053087 Bacteria 3078
389 Ga0500651_0003223 3300053093 Bacteria 8868
390 Ga0500651_0084923 3300053093 Bacteria 1957
391 Ga0500566_0022223 3300053094 Bacteria 3727
392 Ga0500641_0012919 3300053096 Bacteria 3059
393 Ga0500650_0135651 3300053098 Bacteria 1143
394 Ga0500556_0000005 3300053104 Bacteria 581135
395 Ga0500556_0075463 3300053104 Bacteria 1266
396 Ga0500595_000800 3300053119 Bacteria 18227
397 Ga0500559_0046260 3300053136 Bacteria 1907
398 Ga0500573_0016744 3300053140 Bacteria 4165
399 Ga0500577_0010707 3300053142 Bacteria 2711
400 Ga0500616_0036659 3300053153 Bacteria 2660
401 Ga0500638_001386 3300053162 Bacteria 7536
402 Ga0500636_0018614 3300053177 Bacteria 4105
403 Ga0500636_0026675 3300053177 Bacteria 3412
404 Ga0500637_0000225 3300053178 Bacteria 20962
405 Ga0500645_005044 3300053730 Bacteria 4936
406 Ga0500645_019985 3300053730 Bacteria 2078
407 Ga0500661_000657 3300055283 Bacteria 6461
408 2508539823 2508501009 Bacteria 7784016
409 2508541163 2508501009 Bacteria 7784016
410 2508697230 2508501042 Bacteria 8719808
411 2513646841 2513237095 Bacteria 8976980
412 2513652452 2513237095 Bacteria 8976980
413 2513695994 2513237101 Bacteria 7952346
414 2513856771 2513237137 Bacteria 9558895
415 2513880172 2513237139 Bacteria 8737671
416 2513918359 2513237145 Bacteria 8979722
417 2517887937 2517572143 Bacteria 9484767
418 2617347541 2617270735 Bacteria 9163226
419 2617376758 2617270741 Bacteria 8201522
420 2723846228 2721755755 Bacteria 8322773
421 2805916929 2802429603 Bacteria 8777136
422 2818236841 2816332527 Bacteria 8933356
423 2818242681 2816332527 Bacteria 8933356
424 2824604996 2824600985 Bacteria 8488197
425 2824613872 2824609381 Bacteria 8672835
426 2824620412 2824617872 Bacteria 8814715
427 2824628540 2824626560 Bacteria 8813858
428 2824639108 2824635225 Bacteria 8785348
429 2824647333 2824644064 Bacteria 8743947
430 2824657025 2824653114 Bacteria 8493680
431 2824717771 2824714736 Bacteria 8717648
432 2824728029 2824723954 Bacteria 8758240
433 2824749762 2824746037 Bacteria 7911610
434 2824779568 2824773399 Bacteria 8360218
435 2847935815 2847930680 Bacteria 9342022
436 2849079364 2849076700 Bacteria 7039503
437 2857513756 2857509624 Bacteria 7472071
438 2874596599 2874590934 Bacteria 8299676
439 2874653167 2874645413 Bacteria 8214782
440 2876777105 2876771140 Bacteria 8287509
441 2876808883 2876808645 Bacteria 8824342
442 2876810377 2876808645 Bacteria 8824342
443 2876825145 2876818435 Bacteria 8274608
444 2879081242 2879074833 Bacteria 8279565
445 2879085202 2879083081 Bacteria 8587928
446 2879108461 2879099564 Bacteria 10442239
447 2879110313 2879110137 Bacteria 8907982
448 2879115606 2879110137 Bacteria 8907982
449 2879131924 2879127579 Bacteria 8294491
450 2879148958 2879142872 Bacteria 8267021
451 2885367941 2885366525 Bacteria 8326213
452 2885384066 2885383462 Bacteria 9473874
453 2888383510 2888378607 Bacteria 9652610
454 2888423935 2888419890 Bacteria 7857137
455 2889038956 2889033259 Bacteria 9099371
456 2906633157 2906626472 Bacteria 8826946
457 2906666914 2906660503 Bacteria 8595048
458 2908782654 2908775508 Bacteria 8092255
459 2922433287
460 2929618087 2929615660 Bacteria 9193770
461 2929627768 2929624759 Bacteria 9339455
462 2932802752 2932801729 Bacteria 7987968
463 2932803883 2932801729 Bacteria 7987968
464 2932819019 2932818245 Bacteria 9955613
465 2935611264 2935608549 Bacteria 8203142
466 2935630883 2935630451 Bacteria 8169952
467 2935654642 2935648319 Bacteria 8801166
468 2935663581 2935656913 Bacteria 8965014
469 2935683444 2935675223 Bacteria 9928132
470 2935768177 2935760218 Bacteria 9817913
471 2935774525 2935769743 Bacteria 7878163
472 2935781816 2935777560 Bacteria 8077691
473 2935789460 2935785616 Bacteria 7962367
474 2935797497 2935793552 Bacteria 8012592
475 2935811332 2935810662 Bacteria 9401221
476 2935820742 2935819856 Bacteria 8261050
477 2935849240 2935847175 Bacteria 8228321
478 2935889846 2935883170 Bacteria 7964738
479 2935916650 2935908558 Bacteria 8568796
480 2935920391 2935916978 Bacteria 9113783
481 2935920658 2935916978 Bacteria 9113783
482 2935922972 2935916978 Bacteria 9113783
483 2935934157 2935926038 Bacteria 8601059
484 2935942611 2935934488 Bacteria 8602579
485 2935951051 2935942939 Bacteria 8599779
486 2935959512 2935951376 Bacteria 8602333
487 2935964630 2935959822 Bacteria 7869783
488 2935975602 2935967501 Bacteria 8603075
489 2935990884 2935984226 Bacteria 8302647
490 2936017737 2936011229 Bacteria 8801034
491 2936026181 2936019824 Bacteria 8804134
492 2936035171 2936028420 Bacteria 8965941
493 2936053079 2936046547 Bacteria 8903709
494 2936059321 2936055302 Bacteria 8785755
495 2941507535 2941507105 Bacteria 8166816
496 2941515962 2941515067 Bacteria 8166720
497 2941523330 2941523033 Bacteria 8169134
498 3005512839 3005506211 Bacteria 6943378
499 8006929727 8006926726 Bacteria 6749210
500 8006967967 8006964411 Bacteria 8966052
501 8006999040 8006994254 Bacteria 8309700
502 8006999981 8006994254 Bacteria 8309700
503 8016524205 8016522445 Bacteria 8156687
504 8016537753 8016530956 Bacteria 8155261
505 8016542035 8016539877 Bacteria 8155419
506 8016551249 8016548790 Bacteria 8155074
507 8016559643 8016557553 Bacteria 8154380
508 8016567411 8016566248 Bacteria 8158151
509 8016580117 8016575299 Bacteria 8154085
510 8016597582 8016595262 Bacteria 8149947
511 8016629723 8016622563 Bacteria 7999408
512 8016633649 8016630954 Bacteria 9217207
513 8019537426 8019530166 Bacteria 8155624
514 8019539138 8019538911 Bacteria 7872763
515 8019548662 8019547302 Bacteria 7996444
516 8019563503 8019555841 Bacteria 9642137
517 8019573579 8019565922 Bacteria 9639779
518 8019649647 8019648815 Bacteria 10014479
519 8019655205 8019648815 Bacteria 10014479
520 8019670306 8019668869 Bacteria 8791617
521 8019692291 8019687851 Bacteria 8712826
522 8046767789 8046767195 Bacteria 7547379
523 8055746324 8055742211 Bacteria 9226248
524 8056675498 8056673599 Bacteria 7871253
525 8056677555 8056673599 Bacteria 7871253
526 8056693233 8056689827 Bacteria 6712655
527 Ga0207654_10000105
528 JGI24740J21852_10002447
529 JGI25153J46596_10000910
530 rootH1_10075902
531 rootL2_10238319
532 rootH1_10121635
533 rootH1_10317870
534 rootH1_10378669
535 Ga0070658_10018663
536 Ga0070680_100191107
537 Ga0068868_100139004
538 Ga0070660_100263078
539 Ga0070668_100042016
540 Ga0070668_100133182
541 Ga0070671_100009546
542 Ga0070671_100094419
543 Ga0070709_10112161
544 Ga0070713_100060379
545 Ga0070711_100010496
546 Ga0070711_100035356
547 Ga0070663_100009311
548 Ga0070663_100029740
549 Ga0070663_100035922
550 Ga0070678_100140740
551 Ga0070679_100091781
552 Ga0068853_100002951
553 Ga0068853_100066587
554 Ga0070665_100027158
555 Ga0070665_100083599
556 Ga0070665_100229131
557 Ga0070665_100261427
558 Ga0068855_100230728
559 Ga0070664_100043433
560 Ga0068857_100011465
561 Ga0068854_100005250
562 Ga0068856_100004061
563 Ga0068852_100001475
564 Ga0068852_100258954
565 Ga0068851_10004435
566 Ga0068858_100198269
567 Ga0068860_100247278
568 Ga0081540_1015001
569 Ga0081540_1094808
570 Ga0075365_10041549
571 Ga0075365_10107953
572 Ga0075368_10039936
573 Ga0075364_10053926
574 Ga0070716_100023659
575 Ga0070712_100053060
576 Ga0075362_10081276
577 Ga0075367_10014654
578 Ga0075367_10059976
579 Ga0075367_10077249
580 Ga0075369_10017072
581 Ga0075366_10019881
582 Ga0097621_100055512
583 Ga0097621_100068901
584 Ga0075370_10016348
585 Ga0075370_10028446
586 Ga0075370_10135793
587 Ga0068871_100008830
588 Ga0075434_100373584
589 Ga0099825_1042328
590 Ga0099824_1009091
591 Ga0099795_10005185
592 Ga0105240_10017175
593 Ga0105240_10068495
594 Ga0105247_10006438
595 Ga0105241_10001917
596 Ga0105241_10097465
597 Ga0105248_10038394
598 Ga0105248_10370201
599 Ga0105237_10004631
600 Ga0105237_10020496
601 Ga0105237_10040056
602 Ga0105238_10008776
603 Ga0105238_10014368
604 Ga0105238_10102902
605 Ga0099796_10005458
606 Ga0105239_10004642
607 Ga0105239_10007483
608 Ga0105239_10134530
609 Ga0105239_10210632
610 Ga0105246_10063717
611 Ga0105246_10085054
612 Ga0157374_10005055
613 Ga0157374_10040596
614 Ga0157378_10188776
615 Ga0163162_10028202
616 Ga0157372_10123656
617 Ga0157372_10441088
618 Ga0157375_10043051
619 Ga0157375_10078606
620 Ga0157375_10219818
621 Ga0163163_10012026
622 Ga0163163_10087451
623 Ga0157377_10123226
624 Ga0157376_10023738
625 Ga0214544_1000011
626 Ga0214542_1000009
627 Ga0214545_1000007
628 Ga0214543_1000020
629 Ga0209564_1007446
630 Ga0209758_1000097
631 Ga0209758_1000131
632 Ga0209758_1004491
633 Ga0207426_1000223
634 Ga0209257_1011291
635 Ga0207697_10066893
636 Ga0207710_10119350
637 Ga0207688_10153078
638 Ga0207647_10007505
639 Ga0207699_10024102
640 Ga0207699_10084693
641 Ga0207705_10053975
642 Ga0207707_10013392
643 Ga0207695_10001896
644 Ga0207671_10004597
645 Ga0207671_10275349
646 Ga0207663_10019023
647 Ga0207660_10053800
648 Ga0207649_10147243
649 Ga0207652_10017424
650 Ga0207694_10000386
651 Ga0207687_10137892
652 Ga0207700_10073966
653 Ga0207644_10053906
654 Ga0207644_10267250
655 Ga0207704_10351495
656 Ga0207711_10101515
657 Ga0207679_10102765
658 Ga0207667_10007940
659 Ga0207667_10136327
660 Ga0207677_10074996
661 Ga0207703_10065598
662 Ga0207639_10058912
663 Ga0207639_10097777
664 Ga0207639_10125247
665 Ga0207678_10006417
666 Ga0207678_10019207
667 Ga0207678_10040700
668 Ga0207678_10041566
669 Ga0207678_10075668
670 Ga0207702_10001423
671 Ga0207676_10097872
672 Ga0207674_10006297
673 Ga0207683_10050854
674 Ga0207698_10200907
675 Ga0209389_1000197
676 Ga0209589_1000006
677 Ga0209489_100007
678 Ga0209489_106166
679 Ga0209700_100008
680 Ga0209700_100010
681 Ga0268266_10037184
682 Ga0268265_10490054
683 Ga0265337_1013465
684 Ga0265326_10000653
685 Ga0265319_1001882
686 Ga0265334_10001804
687 Ga0265318_10002589
688 Ga0265323_10000182
689 Ga0265322_10001655
690 Ga0265336_10000090
691 Ga0307517_10000196
692 Ga0307515_10302175
693 Ga0265338_10000024
694 Ga0265324_10003074
695 Ga0265339_10019718
696 Ga0265331_10087273
697 Ga0307513_10214294
698 Ga0307508_10039089
699 Ga0307516_10000859
700 Ga0307516_10094691
701 Ga0307412_10034331
702 Ga0307409_100003279
703 Ga0307416_100048279
704 Ga0307416_100556974
705 Ga0307411_10062464
706 Ga0307510_10022486
707 Ga0307510_10076063
708 Ga0307510_10096571
709 Ga0373926_0010741
710 Ga0373944_0013696
711 Ga0373936_0052011
712 Ga0373946_0000458
713 Ga0373924_0046259
714 Ga0373924_0074254
715 Ga0373935_0006657
716 Ga0373927_0001108
717 Ga0373933_0196178
718 Ga0373947_0002780
719 Ga0373947_0005069
720 Ga0373937_0009350
721 Ga0373937_0094530
722 Ga0373925_0002018
723 Ga0373925_0030559
724 Ga0395901_0038010
725 Ga0395901_0412966
726 Ga0451789_0480730
727 Ga0466965_0008723
728 Ga0495592_0026398
729 Ga0495592_0031182
730 Ga0495629_0034194
731 Ga0495629_0120205
732 Ga0495638_0033175
733 Ga0495638_0040367
734 Ga0495651_0025537
735 Ga0495651_0056347
736 Ga0495653_0089390
737 Ga0495580_0099563
738 Ga0495664_0009170
739 Ga0495664_0015664
740 Ga0495664_0035761
741 Ga0495664_0038445
742 Ga0495606_0001547
743 Ga0495606_0038050
744 Ga0495606_0162813
745 Ga0495608_0119651
746 Ga0495608_0190638
747 Ga0495618_0006329
748 Ga0495628_0015987
749 Ga0495628_0033048
750 Ga0495628_0168835
751 Ga0495630_0014436
752 Ga0495630_0117174
753 Ga0495630_0174130
754 Ga0495643_0005555
755 Ga0495643_0120668
756 Ga0495648_0071354
757 Ga0495666_0043111
758 Ga0495652_0083039
759 Ga0495652_0094069
760 Ga0495652_0115408
761 Ga0495665_0006600
762 Ga0495665_0047000
763 Ga0495640_0032804
764 Ga0495640_0048892
765 Ga0495640_0078803
766 Ga0495587_0017804
767 Ga0495587_0099450
768 Ga0495645_0027268
769 Ga0495645_0042211
770 Ga0495645_0056062
771 Ga0495645_0160911
772 Ga0495645_0200931
773 Ga0495622_0029615
774 Ga0495668_0041289
775 Ga0495634_0041644
776 Ga0495634_0062512
777 Ga0495634_0158270
778 Ga0495611_0034530
779 Ga0495625_0162951
780 Ga0495635_0016793
781 Ga0495635_0022626
782 Ga0495635_0087059
783 Ga0495635_0136385
784 Ga0495588_0005903
785 Ga0495657_0014022
786 Ga0495657_0039702
787 Ga0495599_0027386
788 Ga0495599_0061355
789 Ga0495599_0119320
790 Ga0495623_0095537
791 Ga0495646_0040848
792 Ga0495646_0056623
793 Ga0495658_0179444
794 Ga0495613_0047217
795 Ga0495613_0245721
796 Ga0495624_0003447
797 Ga0495624_0085224
798 Ga0495624_0100506
799 Ga0495600_0030456
800 Ga0495600_0035725
801 Ga0495600_0066984
802 Ga0495600_0091914
803 Ga0495581_0072763
804 Ga0495581_0144864
805 Ga0495604_0007508
806 Ga0495604_0035398
807 Ga0495604_0039462
808 Ga0495604_0099680
809 Ga0495604_0237514
810 Ga0495674_0008248
811 Ga0495674_0033651
812 Ga0495674_0082225
813 Ga0495674_0107070
814 Ga0495672_0052146
815 Ga0495676_0052690
816 Ga0495680_0051514
817 Ga0495680_0088719
818 Ga0495687_017422
819 Ga0495675_0025890
820 Ga0495675_0048384
821 Ga0495684_0009542
822 Ga0495684_0013480
823 Ga0495684_0022852
824 Ga0495684_0063553
825 Ga0495686_0065935
826 Ga0495593_0054763
827 Ga0495602_0018892
828 Ga0495602_0098633
829 Ga0495602_0143371
830 Ga0495626_0024661
831 Ga0496100_0016414
832 Ga0496100_0153910
833 Ga0496101_0012615
834 Ga0496101_0056755
835 Ga0496102_0257669
836 Ga0496103_0020632
837 Ga0496104_0001998
838 Ga0496104_0008975
839 Ga0496104_0014492
840 Ga0496104_0017052
841 Ga0496105_0000273
842 Ga0496105_0012795
843 Ga0496105_0013970
844 Ga0496105_0016084
845 Ga0496105_0039520
846 Ga0496105_0115063
847 Ga0496106_0001684
848 Ga0496106_0007770
849 Ga0496107_0017929
850 Ga0496108_0040644
851 Ga0496108_0144787
852 Ga0496109_0032589
853 Ga0496109_0129057
854 Ga0496111_0218103
855 Ga0496112_0030575
856 Ga0496112_0149700
857 Ga0496113_0002553
858 Ga0496113_0016875
859 Ga0496114_0053438
860 Ga0496114_0156932
861 Ga0496114_0172852
862 Ga0496115_0004253
863 Ga0496115_0010549
864 Ga0496115_0076511
865 Ga0496115_0189345
866 Ga0496115_0198510
867 Ga0496116_0018415
868 Ga0496117_0086095
869 Ga0496118_0046322
870 Ga0496118_0052601
871 Ga0496118_0084072
872 Ga0496119_0007234
873 Ga0496119_0054027
874 Ga0496120_0026168
875 Ga0496121_0018669
876 Ga0496121_0082376
877 Ga0496122_0012670
878 Ga0496123_0002788
879 Ga0496125_0009087
880 Ga0496125_0021745
881 Ga0496125_0109966
882 Ga0496126_0011065
883 Ga0496126_0031642
884 Ga0496126_0043147
885 Ga0496126_0066026
886 Ga0496126_0074465
887 Ga0496126_0100937
888 Ga0495682_0067209
889 nmdc:mga03n38_18156_c1
890 nmdc:mga0yw44_39081_c1
891 nmdc:mga0yw44_43791_c2
892 nmdc:mga0k408_11482_c1
893 nmdc:mga0k408_32911_c1
894 nmdc:mga06z11_113511_c1
895 nmdc:mga06z11_152623_c1
896 nmdc:mga06z11_60616_c1
897 nmdc:mga04h51_16877_c1
898 nmdc:mga07m45_109910_c1
899 nmdc:mga07m45_26654_c1
900 nmdc:mga08y16_227317_c1
901 nmdc:mga0sz30_18433_c1
902 nmdc:mga0sz30_70410_c1
903 Ga0495601_0000379
904 Ga0495601_0051044
905 Ga0495612_0017793
906 Ga0495612_0018426
907 Ga0495612_0031352
908 Ga0495612_0060058
909 Ga0495595_0134271
910 Ga0495619_0000401
911 Ga0495619_0024370
912 Ga0495619_0121168
913 Ga0500643_000068
914 Ga0500643_012251
915 Ga0500651_0003223
916 Ga0500651_0084923
917 Ga0500566_0022223
918 Ga0500641_0012919
919 Ga0500650_0135651
920 Ga0500556_0000005
921 Ga0500556_0075463
922 Ga0500595_000800
923 Ga0500559_0046260
924 Ga0500573_0016744
925 Ga0500577_0010707
926 Ga0500616_0036659
927 Ga0500638_001386
928 Ga0500636_0018614
929 Ga0500636_0026675
930 Ga0500637_0000225
931 Ga0500645_005044
932 Ga0500645_019985
933 Ga0500661_000657
934 2508539823
935 2508541163
936 2508697230
937 2513646841
938 2513652452
939 2513695994
940 2513856771
941 2513880172
942 2513918359
943 2517887937
944 2617347541
945 2617376758
946 2723846228
947 2805916929
948 2818236841
949 2818242681
950 2824604996
951 2824613872
952 2824620412
953 2824628540
954 2824639108
955 2824647333
956 2824657025
957 2824717771
958 2824728029
959 2824749762
960 2824779568
961 2847935815
962 2849079364
963 2857513756
964 2874596599
965 2874653167
966 2876777105
967 2876808883
968 2876810377
969 2876825145
970 2879081242
971 2879085202
972 2879108461
973 2879110313
974 2879115606
975 2879131924
976 2879148958
977 2885367941
978 2885384066
979 2888383510
980 2888423935
981 2889038956
982 2906633157
983 2906666914
984 2908782654
985 2922433287
986 2929618087
987 2929627768
988 2932802752
989 2932803883
990 2932819019
991 2935611264
992 2935630883
993 2935654642
994 2935663581
995 2935683444
996 2935768177
997 2935774525
998 2935781816
999 2935789460
1000 2935797497
1001 2935811332
1002 2935820742
1003 2935849240
1004 2935889846
1005 2935916650
1006 2935920391
1007 2935920658
1008 2935922972
1009 2935934157
1010 2935942611
1011 2935951051
1012 2935959512
1013 2935964630
1014 2935975602
1015 2935990884
1016 2936017737
1017 2936026181
1018 2936035171
1019 2936053079
1020 2936059321
1021 2941507535
1022 2941515962
1023 2941523330
1024 3005512839
1025 8006929727
1026 8006967967
1027 8006999040
1028 8006999981
1029 8016524205
1030 8016537753
1031 8016542035
1032 8016551249
1033 8016559643
1034 8016567411
1035 8016580117
1036 8016597582
1037 8016629723
1038 8016633649
1039 8019537426
1040 8019539138
1041 8019548662
1042 8019563503
1043 8019573579
1044 8019649647
1045 8019655205
1046 8019670306
1047 8019692291
1048 8046767789
1049 8055746324
1050 8056675498
1051 8056677555
1052 8056693233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13557

Phenol_MetA_deg

Putative MetA-pathway of phenol degradation

128

381

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rl8-assembly2.cif.gz_B crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 0.7788 43 339
4rl8-assembly2.cif.gz_B crystal structure of the cog4313 outer membrane channel from pseudomonas putida f1 0.7706 43 339
5o68-assembly4.cif.gz_L crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.7001 51 338
5o68-assembly2.cif.gz_D crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.699 52 340
5o68-assembly2.cif.gz_F crystal structure of the pseudomonas functional amyloid secretion protein fapf - r157a mutant 0.6954 58 338
ID Description Score Start End Superfamily
6n1nA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6564 294 342 3.40.710.10
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.6132 292 341 3.10.129.10
af_Q2QXF5_66_170_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.5892 133 162 2.60.40.1180
4e1tA00 Mainly Beta;Beta Barrel;Porin;Inverse autotransporter, beta-domain 0.5703 57 339 2.40.160.160
af_P76773_24_229_2.40.160.40 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.57 96 342 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A3N5VE16-F1-model_v4 Transporter 0.9259 164 337
AF-A0A3N5VE16-F1-model_v4 Transporter 0.8907 164 337
AF-A0A0Q4X7Y2-F1-model_v4 Phenol degradation protein meta 0.8902 1 343
AF-A0A0Q4X7Y2-F1-model_v4 Phenol degradation protein meta 0.8694 1 343
AF-A0A521QGN6-F1-model_v4 Transporter 0.8503 37 338

Map