F459391

General Info

Members Datasets Scaffolds Average Seq Length
526 262 1052 248

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10001879|Ga0111539_1000187925
Length 273
Sequence MGSSSPGGVRVAAVGDVHAGADDESARRLHDGFAGLREHADVLLLAGDLTRCGGPDEAAVVARAVADGGVPAVAVLGNHDLHANRGDQVVATLEDAGVTVLEGGTAHIDVRGVRVGVAGVKGFGGGFAGACTSEFGEPETKAFARHARQVAERLGAAMGHVADADLRVALLHYAPVRDTLQGEPPEIFPFLGSYLLAEAIDATGADLAVHGHAHRGRERGITPGGVRVRNVAQPVIRAAYRVYEVHPAERTTVAAGAGSSPAATRPHDHQETT

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
103 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
104 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
105 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
106 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
107 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
140 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
232 2547132424 Nocardia nova SH22a Isolate Unclassified
233 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
234 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
235 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
236 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
237 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
238 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
239 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
240 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
241 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
242 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
243 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
244 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
245 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
246 2891562705 Microbispora tritici MT50 Isolate Unclassified
247 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
248 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
249 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
250 2922554459 Rhodococcus sp. 66b Isolate Unclassified
251 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
252 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
253 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
254 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
255 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
256 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
257 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
258 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
259 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
260 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
261 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
262 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.4
Metatranscriptomes 1.52
Isolates 6.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0.19
Rhizoplane 1.9
Rhizosphere 92.59
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10001879 3300009094 Bacteria 27894
2 JGI24737J22298_10015755 3300001990 Bacteria 2445
3 JGI24751J29686_10003199 3300002459 Bacteria 3297
4 Ga0006777J48905_1093077 3300003308 Bacteria 1018
5 JGI25407J50210_10000005 3300003373 Bacteria 19904
6 Ga0070658_10065034 3300005327 Bacteria 2976
7 Ga0070683_100000938 3300005329 Bacteria 21679
8 Ga0070683_100521687 3300005329 Bacteria 1135
9 Ga0070690_100106121 3300005330 Bacteria 1868
10 Ga0070670_100031532 3300005331 Bacteria 4565
11 Ga0068869_100054594 3300005334 Bacteria 2909
12 Ga0070687_100261975 3300005343 Bacteria 1079
13 Ga0070668_100465202 3300005347 Bacteria 1090
14 Ga0070669_100178685 3300005353 Bacteria 1659
15 Ga0070659_100046289 3300005366 Bacteria 3409
16 Ga0070659_100151358 3300005366 Bacteria 1893
17 Ga0070667_100459481 3300005367 Bacteria 1164
18 Ga0070667_100793682 3300005367 Bacteria 879
19 Ga0070709_10037723 3300005434 Bacteria 2953
20 Ga0070714_100015702 3300005435 Bacteria 6098
21 Ga0070714_100433724 3300005435 Bacteria 1246
22 Ga0070714_100847028 3300005435 Bacteria 886
23 Ga0070713_100391741 3300005436 Bacteria 1296
24 Ga0070713_100593013 3300005436 Bacteria 1052
25 Ga0070710_10039460 3300005437 Bacteria 2598
26 Ga0070711_100179013 3300005439 Bacteria 1622
27 Ga0070694_100076460 3300005444 Bacteria 2318
28 Ga0070694_100628358 3300005444 Bacteria 867
29 Ga0070708_100002695 3300005445 Bacteria 13759
30 Ga0070708_100005308 3300005445 Bacteria 10213
31 Ga0070678_100548681 3300005456 Bacteria 1026
32 Ga0070662_100456875 3300005457 Bacteria 1061
33 Ga0068867_100307383 3300005459 Bacteria 1309
34 Ga0070706_100000226 3300005467 Bacteria 68801
35 Ga0070706_100202642 3300005467 Bacteria 1853
36 Ga0070706_100781089 3300005467 Bacteria 884
37 Ga0070707_100000276 3300005468 Bacteria 50554
38 Ga0070707_100000917 3300005468 Bacteria 29218
39 Ga0070707_100003424 3300005468 Bacteria 14999
40 Ga0070707_100011586 3300005468 Bacteria 8225
41 Ga0070707_100126148 3300005468 Bacteria 2487
42 Ga0070698_100001078 3300005471 Bacteria 29970
43 Ga0070698_100005402 3300005471 Bacteria 13968
44 Ga0070698_100029377 3300005471 Bacteria 5707
45 Ga0070698_100090235 3300005471 Bacteria 3048
46 Ga0070698_100147697 3300005471 Bacteria 2299
47 Ga0070698_100272568 3300005471 Bacteria 1624
48 Ga0070698_100299914 3300005471 Bacteria 1537
49 Ga0070699_100007362 3300005518 Bacteria 9584
50 Ga0070699_100134562 3300005518 Bacteria 2180
51 Ga0070699_100193450 3300005518 Bacteria 1807
52 Ga0070679_100120605 3300005530 Bacteria 2607
53 Ga0070684_100022978 3300005535 Bacteria 5208
54 Ga0070684_100387764 3300005535 Bacteria 1287
55 Ga0070697_100000060 3300005536 Bacteria 86138
56 Ga0070697_100003590 3300005536 Bacteria 11926
57 Ga0070697_100138117 3300005536 Bacteria 2048
58 Ga0070672_100043995 3300005543 Bacteria 3447
59 Ga0070704_100923298 3300005549 Unclassified 786
60 Ga0068855_100385930 3300005563 Bacteria 1537
61 Ga0068857_100091593 3300005577 Bacteria 2722
62 Ga0068857_100133289 3300005577 Bacteria 2242
63 Ga0068857_100281895 3300005577 Bacteria 1529
64 Ga0068857_100404573 3300005577 Bacteria 1270
65 Ga0068859_100002323 3300005617 Bacteria 19323
66 Ga0068859_100022669 3300005617 Bacteria 6295
67 Ga0068859_100194641 3300005617 Bacteria 2112
68 Ga0068866_10442590 3300005718 Bacteria 848
69 Ga0068870_10192955 3300005840 Bacteria 1230
70 Ga0068860_100101243 3300005843 Bacteria 2749
71 Ga0081455_10012848 3300005937 Bacteria 8316
72 Ga0081455_10044587 3300005937 Bacteria 3867
73 Ga0081455_10115339 3300005937 Bacteria 2126
74 Ga0081455_10158143 3300005937 Bacteria 1740
75 Ga0081538_10000251 3300005981 Bacteria 60776
76 Ga0081538_10005996 3300005981 Bacteria 10815
77 Ga0081538_10016255 3300005981 Bacteria 5717
78 Ga0081538_10022308 3300005981 Bacteria 4590
79 Ga0081539_10085191 3300005985 Bacteria 1649
80 Ga0070717_10015467 3300006028 Bacteria 5895
81 Ga0070717_10418742 3300006028 Bacteria 1205
82 Ga0070717_10544445 3300006028 Bacteria 1051
83 Ga0075363_100004963 3300006048 Bacteria 5886
84 Ga0075367_10054749 3300006178 Bacteria 2366
85 Ga0075428_100000315 3300006844 Bacteria 47699
86 Ga0075428_100010182 3300006844 Bacteria 10440
87 Ga0075428_100012201 3300006844 Bacteria 9555
88 Ga0075428_100286936 3300006844 Bacteria 1771
89 Ga0075428_100491125 3300006844 Bacteria 1314
90 Ga0075428_100580326 3300006844 Bacteria 1198
91 Ga0075430_100005211 3300006846 Bacteria 10959
92 Ga0075430_100008022 3300006846 Bacteria 8928
93 Ga0075430_100008872 3300006846 Bacteria 8485
94 Ga0075430_100051864 3300006846 Bacteria 3455
95 Ga0075430_100161868 3300006846 Bacteria 1863
96 Ga0075430_100206517 3300006846 Bacteria 1630
97 Ga0075431_100000967 3300006847 Bacteria 25519
98 Ga0075431_100001049 3300006847 Bacteria 24673
99 Ga0075431_100005261 3300006847 Bacteria 12748
100 Ga0075431_100075298 3300006847 Bacteria 3483
101 Ga0075431_100380532 3300006847 Bacteria 1416
102 Ga0075433_10099564 3300006852 Bacteria 2573
103 Ga0075434_100002270 3300006871 Bacteria 16813
104 Ga0075434_100181251 3300006871 Bacteria 2126
105 Ga0075429_100002742 3300006880 Bacteria 14881
106 Ga0075429_100004716 3300006880 Bacteria 11735
107 Ga0075429_100015466 3300006880 Bacteria 6611
108 Ga0075429_100055173 3300006880 Bacteria 3457
109 Ga0075429_100162486 3300006880 Bacteria 1956
110 Ga0075429_100195672 3300006880 Bacteria 1771
111 Ga0075429_100448526 3300006880 Bacteria 1130
112 Ga0097620_100002323 3300006931 Bacteria 19323
113 Ga0097620_100022670 3300006931 Bacteria 6295
114 Ga0097620_100194655 3300006931 Bacteria 2112
115 Ga0075435_100425176 3300007076 Bacteria 1144
116 Ga0111539_10017024 3300009094 Bacteria 8997
117 Ga0111539_10324185 3300009094 Bacteria 1793
118 Ga0111539_10407977 3300009094 Bacteria 1582
119 Ga0111539_10613226 3300009094 Bacteria 1267
120 Ga0111539_11205626 3300009094 Bacteria 879
121 Ga0114129_10000290 3300009147 Bacteria 58049
122 Ga0114129_10001554 3300009147 Bacteria 31146
123 Ga0114129_10002851 3300009147 Bacteria 24173
124 Ga0114129_10085639 3300009147 Bacteria 4372
125 Ga0114129_10091874 3300009147 Bacteria 4204
126 Ga0114129_10125019 3300009147 Bacteria 3537
127 Ga0114129_10144556 3300009147 Bacteria 3258
128 Ga0114129_10369777 3300009147 Bacteria 1895
129 Ga0114129_10611655 3300009147 Bacteria 1411
130 Ga0105243_10219838 3300009148 Bacteria 1678
131 Ga0105248_10583643 3300009177 Bacteria 1261
132 Ga0105249_10258435 3300009553 Bacteria 1729
133 Ga0105239_10205783 3300010375 Bacteria 2205
134 Ga0157370_10160113 3300013104 Bacteria 2095
135 Ga0157369_10012299 3300013105 Bacteria 9721
136 Ga0157375_10625220 3300013308 Bacteria 1235
137 Ga0157375_11110038 3300013308 Bacteria 926
138 Ga0157380_10158626 3300014326 Bacteria 1964
139 Ga0157380_10174465 3300014326 Bacteria 1882
140 Ga0157380_10442232 3300014326 Bacteria 1246
141 Ga0157379_10440873 3300014968 Bacteria 1201
142 Ga0206349_1373949 3300020075 Bacteria 1835
143 Ga0206350_10196893 3300020080 Bacteria 1481
144 Ga0206354_10106349 3300020081 Bacteria 2940
145 Ga0206354_10362210 3300020081 Bacteria 2422
146 Ga0206354_11266847 3300020081 Bacteria 2475
147 Ga0206353_11576664 3300020082 Bacteria 3937
148 Ga0213876_10130735 3300021384 Bacteria 1334
149 Ga0213875_10000725 3300021388 Bacteria 25208
150 Ga0224712_10028186 3300022467 Bacteria 2005
151 Ga0207692_10000572 3300025898 Bacteria 13101
152 Ga0207645_10264237 3300025907 Bacteria 1140
153 Ga0207643_10166317 3300025908 Bacteria 1329
154 Ga0207705_10028751 3300025909 Bacteria 3962
155 Ga0207684_10000007 3300025910 Bacteria 612969
156 Ga0207684_10000015 3300025910 Bacteria 427232
157 Ga0207684_10364091 3300025910 Bacteria 1244
158 Ga0207707_10209735 3300025912 Bacteria 1697
159 Ga0207693_10120189 3300025915 Bacteria 2063
160 Ga0207663_10209065 3300025916 Bacteria 1413
161 Ga0207662_10412960 3300025918 Bacteria 917
162 Ga0207646_10000095 3300025922 Bacteria 117382
163 Ga0207646_10000505 3300025922 Bacteria 52217
164 Ga0207646_10000904 3300025922 Bacteria 38211
165 Ga0207646_10001879 3300025922 Bacteria 25340
166 Ga0207646_10025473 3300025922 Bacteria 5411
167 Ga0207646_10170916 3300025922 Bacteria 1963
168 Ga0207646_10488504 3300025922 Bacteria 1110
169 Ga0207681_10072492 3300025923 Bacteria 2406
170 Ga0207700_10439562 3300025928 Bacteria 1148
171 Ga0207664_10282844 3300025929 Bacteria 1456
172 Ga0207664_10339310 3300025929 Bacteria 1328
173 Ga0207690_10055160 3300025932 Bacteria 2675
174 Ga0207665_10167884 3300025939 Bacteria 1583
175 Ga0207711_10528544 3300025941 Bacteria 1100
176 Ga0207689_10054746 3300025942 Bacteria 3284
177 Ga0207661_10001793 3300025944 Bacteria 14674
178 Ga0207661_10402972 3300025944 Bacteria 1241
179 Ga0207667_10456772 3300025949 Bacteria 1298
180 Ga0207712_10200778 3300025961 Bacteria 1581
181 Ga0207668_10188715 3300025972 Bacteria 1632
182 Ga0207668_10268443 3300025972 Bacteria 1394
183 Ga0207658_10910333 3300025986 Bacteria 801
184 Ga0207677_10082633 3300026023 Bacteria 2309
185 Ga0207703_10046416 3300026035 Bacteria 3498
186 Ga0207676_10194189 3300026095 Bacteria 1789
187 Ga0207674_10118328 3300026116 Bacteria 2619
188 Ga0207675_100042461 3300026118 Bacteria 4246
189 Ga0207683_10289725 3300026121 Bacteria 1497
190 Ga0207428_10005397 3300027907 Bacteria 11923
191 Ga0207428_10030757 3300027907 Bacteria 4436
192 Ga0207428_10045419 3300027907 Bacteria 3538
193 Ga0207428_10075441 3300027907 Bacteria 2642
194 Ga0268264_10367479 3300028381 Bacteria 1374
195 Ga0316177_1025831 3300030731 Bacteria 1330
196 Ga0316176_1002521 3300030732 Bacteria 3357
197 Ga0314311_1064677 3300030733 Bacteria 4322
198 Ga0316180_1079902 3300030736 Bacteria 1568
199 Ga0316183_1067173 3300030742 Bacteria 2522
200 Ga0316182_1432565 3300030745 Bacteria 5042
201 Ga0307513_10011334 3300031456 Bacteria 11084
202 Ga0307513_10293276 3300031456 Bacteria 1397
203 Ga0307405_10001248 3300031731 Bacteria 10595
204 Ga0307405_10062569 3300031731 Bacteria 2358
205 Ga0307413_10006443 3300031824 Bacteria 5362
206 Ga0307410_10018553 3300031852 Bacteria 4207
207 Ga0307406_10157561 3300031901 Bacteria 1628
208 Ga0307407_10049944 3300031903 Bacteria 2390
209 Ga0307412_10544464 3300031911 Bacteria 974
210 Ga0307409_100029810 3300031995 Bacteria 3911
211 Ga0307409_100210190 3300031995 Bacteria 1748
212 Ga0307409_100454329 3300031995 Bacteria 1237
213 Ga0307416_100001217 3300032002 Bacteria 13879
214 Ga0307416_100172168 3300032002 Bacteria 2017
215 Ga0307416_100238847 3300032002 Bacteria 1759
216 Ga0307416_100475921 3300032002 Bacteria 1308
217 Ga0307411_10020006 3300032005 Bacteria 3882
218 Ga0307411_10378269 3300032005 Bacteria 1164
219 Ga0307411_10438221 3300032005 Bacteria 1090
220 Ga0307415_100000006 3300032126 Bacteria 107919
221 Ga0307415_100046041 3300032126 Bacteria 2929
222 Ga0307415_100166978 3300032126 Bacteria 1712
223 Ga0373926_0044676 3300035083 Bacteria 1587
224 Ga0373934_0104938 3300035086 Bacteria 1144
225 Ga0373947_0022978 3300035725 Bacteria 3623
226 Ga0373937_0444773 3300036401 Bacteria 1231
227 Ga0373937_0458684 3300036401 Bacteria 1210
228 Ga0395899_0003841 3300037312 Bacteria 11844
229 Ga0395899_0046998 3300037312 Bacteria 3214
230 Ga0395899_0147125 3300037312 Bacteria 1672
231 Ga0395900_0009542 3300037418 Bacteria 9949
232 Ga0395900_0053184 3300037418 Bacteria 4168
233 Ga0395900_0076716 3300037418 Bacteria 3434
234 Ga0395900_0079345 3300037418 Bacteria 3373
235 Ga0395900_0080992 3300037418 Bacteria 3336
236 Ga0395900_0243473 3300037418 Bacteria 1803
237 Ga0395900_0485608 3300037418 Bacteria 1187
238 Ga0395898_0001963 3300037466 Bacteria 25901
239 Ga0395898_0004551 3300037466 Bacteria 15135
240 Ga0395898_0118418 3300037466 Bacteria 2537
241 Ga0395898_0165602 3300037466 Bacteria 2114
242 Ga0395898_0302528 3300037466 Bacteria 1525
243 Ga0395905_0000164 3300037471 Bacteria 110591
244 Ga0395905_0000596 3300037471 Bacteria 48287
245 Ga0395905_0003330 3300037471 Bacteria 17245
246 Ga0395905_0012975 3300037471 Bacteria 8007
247 Ga0395905_0036752 3300037471 Bacteria 4600
248 Ga0395905_0119682 3300037471 Bacteria 2475
249 Ga0395905_0224390 3300037471 Bacteria 1758
250 Ga0436364_0849153 3300037853 Bacteria 48156
251 Ga0395901_0008308 3300038443 Bacteria 10492
252 Ga0395901_0017095 3300038443 Bacteria 7395
253 Ga0395901_0037866 3300038443 Bacteria 4987
254 Ga0395901_0109585 3300038443 Bacteria 2899
255 Ga0395901_0315855 3300038443 Bacteria 1617
256 Ga0436365_0412500 3300039437 Bacteria 4424
257 Ga0439436_0000462 3300041404 Bacteria 10429
258 Ga0439439_0079414 3300041406 Bacteria 886
259 Ga0439465_0032186 3300041413 Unclassified 1673
260 Ga0451795_0301688 3300041456 Bacteria 814
261 Ga0451849_1059109 3300041505 Bacteria 981
262 Ga0439433_0009589 3300041999 Bacteria 2112
263 Ga0439445_0012572 3300042004 Unclassified 2037
264 Ga0439448_0001838 3300042005 Bacteria 5619
265 Ga0439449_0007995 3300042007 Bacteria 4018
266 Ga0439449_0011769 3300042007 Bacteria 3289
267 Ga0439450_045148 3300042008 Bacteria 1034
268 Ga0439457_003324 3300042014 Bacteria 4392
269 Ga0439463_003870 3300042016 Bacteria 3773
270 Ga0450903_000052 3300042138 Bacteria 23517
271 Ga0439460_0007350 3300042461 Bacteria 2751
272 Ga0451577_0006491 3300042876 Bacteria 11647
273 Ga0451577_0195527 3300042876 Bacteria 1825
274 Ga0439440_0006705 3300042993 Bacteria 2325
275 Ga0466969_0008187 3300044656 Bacteria 5547
276 Ga0466969_0010036 3300044656 Bacteria 5022
277 Ga0466969_0104460 3300044656 Bacteria 1331
278 Ga0466969_0149690 3300044656 Bacteria 1076
279 Ga0466972_0009126 3300044658 Bacteria 4980
280 Ga0466972_0034700 3300044658 Bacteria 2470
281 Ga0453683_0007368 3300044673 Bacteria 7472
282 Ga0466965_0000590 3300044683 Bacteria 13211
283 Ga0466965_0030186 3300044683 Bacteria 2640
284 Ga0466965_0044321 3300044683 Bacteria 2198
285 Ga0466966_0000905 3300044684 Bacteria 18847
286 Ga0466966_0001938 3300044684 Bacteria 13407
287 Ga0466966_0010686 3300044684 Bacteria 6103
288 Ga0466966_0045688 3300044684 Bacteria 2799
289 Ga0466966_0054627 3300044684 Bacteria 2530
290 Ga0466961_0000981 3300044693 Bacteria 17707
291 Ga0466961_0007754 3300044693 Bacteria 6833
292 Ga0466961_0011624 3300044693 Bacteria 5626
293 Ga0466961_0102029 3300044693 Bacteria 1807
294 Ga0466961_0126416 3300044693 Bacteria 1604
295 Ga0466961_0253297 3300044693 Bacteria 1081
296 Ga0466963_0000549 3300044694 Bacteria 17618
297 Ga0466963_0002234 3300044694 Bacteria 10735
298 Ga0466963_0057905 3300044694 Bacteria 2582
299 Ga0466964_0008208 3300044706 Bacteria 3917
300 Ga0453684_0000049 3300044712 Bacteria 559289
301 Ga0453684_0030454 3300044712 Bacteria 7624
302 Ga0466971_0131826 3300044719 Bacteria 1160
303 Ga0466968_0022328 3300044735 Bacteria 2572
304 Ga0466970_0000618 3300044765 Bacteria 17422
305 Ga0466970_0022216 3300044765 Bacteria 3311
306 Ga0466970_0202848 3300044765 Bacteria 1104
307 Ga0466957_0000492 3300044842 Bacteria 19698
308 Ga0466957_0350963 3300044842 Bacteria 1001
309 Ga0466960_0006350 3300044901 Bacteria 4739
310 Ga0466959_0001513 3300045049 Bacteria 14270
311 Ga0466959_0005137 3300045049 Bacteria 8915
312 Ga0466959_0017220 3300045049 Bacteria 5293
313 Ga0466959_0168509 3300045049 Bacteria 1537
314 Ga0466958_0003296 3300045836 Bacteria 8359
315 Ga0466958_0017944 3300045836 Bacteria 4100
316 Ga0466958_0031851 3300045836 Bacteria 3134
317 Ga0466958_0233887 3300045836 Bacteria 1174
318 Ga0466967_0011408 3300045976 Bacteria 6728
319 Ga0466967_0093256 3300045976 Bacteria 2739
320 Ga0466967_0614196 3300045976 Bacteria 1074
321 Ga0495629_0000032 3300046459 Bacteria 123692
322 Ga0495641_0026271 3300046461 Bacteria 2843
323 Ga0495580_0064984 3300046472 Bacteria 2556
324 Ga0495580_0228497 3300046472 Bacteria 1278
325 Ga0495582_0009354 3300046473 Bacteria 5399
326 Ga0495594_0005258 3300046499 Bacteria 6655
327 Ga0495634_0044068 3300046642 Bacteria 3021
328 Ga0495635_0000134 3300046663 Bacteria 44533
329 Ga0495658_0000240 3300046683 Bacteria 31379
330 Ga0495613_0000641 3300046689 Bacteria 27753
331 Ga0495624_0133122 3300046690 Bacteria 1524
332 Ga0495581_0003232 3300047315 Bacteria 9341
333 Ga0495676_0141956 3300047321 Bacteria 1720
334 Ga0495680_0000523 3300047322 Bacteria 43357
335 Ga0495593_0100847 3300047673 Bacteria 1480
336 Ga0495614_0016589 3300048089 Bacteria 3204
337 Ga0496100_0007108 3300048903 Bacteria 6147
338 Ga0496102_0021060 3300048905 Bacteria 5766
339 Ga0496104_0351849 3300048907 Bacteria 1386
340 Ga0496105_0034794 3300048908 Bacteria 4145
341 Ga0496105_0346868 3300048908 Bacteria 1186
342 Ga0496106_0051994 3300048909 Bacteria 3090
343 Ga0496112_0145762 3300048915 Bacteria 2336
344 Ga0496113_0142640 3300048916 Bacteria 1886
345 Ga0496115_0119231 3300048918 Bacteria 2170
346 Ga0501031_0003849 3300049568 Bacteria 9655
347 Ga0501031_0019020 3300049568 Bacteria 4472
348 Ga0501031_0022768 3300049568 Bacteria 4084
349 Ga0501031_0378506 3300049568 Bacteria 916
350 Ga0501032_0000142 3300049569 Bacteria 58661
351 Ga0501032_0092756 3300049569 Bacteria 2003
352 Ga0501033_0005672 3300049570 Bacteria 9853
353 Ga0501033_0212951 3300049570 Bacteria 1377
354 Ga0501033_0261809 3300049570 Bacteria 1224
355 Ga0501034_0001328 3300049571 Bacteria 33406
356 Ga0501034_0011207 3300049571 Bacteria 9309
357 Ga0501034_0162950 3300049571 Bacteria 2200
358 Ga0501034_0427061 3300049571 Bacteria 1245
359 Ga0501036_0001103 3300049572 Bacteria 20516
360 Ga0501036_0004728 3300049572 Bacteria 10987
361 Ga0501036_0020358 3300049572 Bacteria 5573
362 Ga0501036_0100897 3300049572 Bacteria 2441
363 Ga0501036_0121468 3300049572 Bacteria 2206
364 Ga0501037_0007520 3300049573 Bacteria 7977
365 Ga0501037_0104441 3300049573 Bacteria 2043
366 Ga0501037_0105560 3300049573 Bacteria 2030
367 Ga0501037_0168287 3300049573 Bacteria 1559
368 Ga0501038_0012601 3300049574 Bacteria 7728
369 Ga0501038_0126125 3300049574 Bacteria 2106
370 Ga0501038_0160019 3300049574 Bacteria 1830
371 Ga0501038_0308240 3300049574 Bacteria 1241
372 Ga0501039_0014880 3300049575 Bacteria 5949
373 Ga0501039_0105089 3300049575 Bacteria 2205
374 Ga0501039_0292563 3300049575 Bacteria 1280
375 Ga0501039_0335918 3300049575 Bacteria 1187
376 Ga0501039_0410762 3300049575 Unclassified 1063
377 Ga0501040_0001579 3300049576 Bacteria 14509
378 Ga0501040_0015231 3300049576 Bacteria 5080
379 Ga0501040_0059524 3300049576 Bacteria 2624
380 Ga0501040_0083046 3300049576 Bacteria 2222
381 Ga0501040_0368497 3300049576 Bacteria 1030
382 Ga0501041_0010450 3300049577 Bacteria 5469
383 Ga0501042_0012932 3300049578 Bacteria 5669
384 Ga0501042_0027656 3300049578 Bacteria 3988
385 Ga0501042_0032835 3300049578 Bacteria 3677
386 Ga0501043_0004878 3300049579 Bacteria 10836
387 Ga0501043_0052247 3300049579 Bacteria 3210
388 Ga0501046_0007647 3300049580 Bacteria 9480
389 Ga0501046_0023973 3300049580 Bacteria 5010
390 Ga0501046_0042256 3300049580 Bacteria 3635
391 Ga0501046_0364043 3300049580 Bacteria 1048
392 Ga0501046_0514227 3300049580 Bacteria 856
393 Ga0501047_0003449 3300049581 Bacteria 14951
394 Ga0501047_0039466 3300049581 Bacteria 4566
395 Ga0501047_0125785 3300049581 Bacteria 2444
396 Ga0501048_0005383 3300049582 Bacteria 9733
397 Ga0501048_0029146 3300049582 Bacteria 4004
398 Ga0501048_0174775 3300049582 Bacteria 1522
399 Ga0501048_0184825 3300049582 Bacteria 1477
400 Ga0501048_0235083 3300049582 Bacteria 1300
401 Ga0501068_0064066 3300049584 Bacteria 2237
402 Ga0501070_0161842 3300049586 Bacteria 1845
403 Ga0501070_0376749 3300049586 Bacteria 1150
404 Ga0501071_0013631 3300049587 Bacteria 5542
405 Ga0501071_0086715 3300049587 Bacteria 2297
406 Ga0501071_0133728 3300049587 Bacteria 1844
407 Ga0501072_0002193 3300049588 Bacteria 14592
408 Ga0501072_0010953 3300049588 Bacteria 6914
409 Ga0501072_0086860 3300049588 Bacteria 2482
410 Ga0501072_0415442 3300049588 Bacteria 1067
411 Ga0501074_0011342 3300049590 Bacteria 6476
412 Ga0501075_0013711 3300049591 Bacteria 5792
413 Ga0501075_0023188 3300049591 Bacteria 4541
414 Ga0501075_0187202 3300049591 Bacteria 1579
415 Ga0501076_0004486 3300049592 Bacteria 9942
416 Ga0501076_0021611 3300049592 Bacteria 4938
417 Ga0501076_0055631 3300049592 Unclassified 3138
418 Ga0501076_0209919 3300049592 Bacteria 1591
419 Ga0501077_0039678 3300049593 Bacteria 2999
420 Ga0501077_0141786 3300049593 Bacteria 1524
421 Ga0501079_0006725 3300049741 Bacteria 8652
422 Ga0501079_0087550 3300049741 Bacteria 2411
423 Ga0501079_0134839 3300049741 Bacteria 1922
424 Ga0501079_0141148 3300049741 Bacteria 1877
425 Ga0501079_0271852 3300049741 Bacteria 1325
426 Ga0501080_0092001 3300049742 Bacteria 2817
427 Ga0501081_0021160 3300049743 Bacteria 4341
428 Ga0501081_0221513 3300049743 Bacteria 1376
429 Ga0501083_0086802 3300049744 Bacteria 2069
430 Ga0501035_0053133 3300049822 Bacteria 3624
431 Ga0501035_0101106 3300049822 Bacteria 2530
432 Ga0501035_0116267 3300049822 Bacteria 2340
433 Ga0501035_0174167 3300049822 Bacteria 1857
434 Ga0501035_0210204 3300049822 Bacteria 1665
435 Ga0501035_0350057 3300049822 Bacteria 1236
436 Ga0501044_0035163 3300049823 Bacteria 5248
437 Ga0501044_0147397 3300049823 Bacteria 2338
438 Ga0501044_0358467 3300049823 Bacteria 1376
439 Ga0501044_0474873 3300049823 Bacteria 1154
440 Ga0501044_0920834 3300049823 Bacteria 748
441 Ga0501045_0007058 3300049824 Bacteria 7784
442 Ga0501045_0013559 3300049824 Bacteria 5758
443 Ga0501045_0019343 3300049824 Bacteria 4854
444 Ga0501045_0063908 3300049824 Bacteria 2701
445 Ga0501045_0164463 3300049824 Bacteria 1652
446 Ga0501045_0393850 3300049824 Bacteria 1031
447 nmdc:mga03n38_112437_c1 3300050490 Bacteria 1328
448 nmdc:mga03n38_7879_c1 3300050490 Bacteria 3790
449 nmdc:mga06z11_33289_c1 3300050494 Bacteria 2520
450 nmdc:mga07m45_330316_c1 3300050496 Bacteria 886
451 nmdc:mga05p37_1044780_c1 3300050507 Bacteria 862
452 nmdc:mga05p37_2644_c1 3300050507 Bacteria 20857
453 nmdc:mga05p37_284_c1 3300050507 Bacteria 52993
454 nmdc:mga05p37_61677_c1 3300050507 Bacteria 4616
455 nmdc:mga05p37_6627_c1 3300050507 Bacteria 13654
456 nmdc:mga05p37_95990_c1 3300050507 Bacteria 3652
457 nmdc:mga05p37_96969_c1 3300050507 Bacteria 3633
458 nmdc:mga09592_1083_c1 3300050508 Bacteria 21638
459 nmdc:mga09592_152622_c1 3300050508 Bacteria 1993
460 nmdc:mga09592_25937_c1 3300050508 Bacteria 4854
461 nmdc:mga09592_29226_c1 3300050508 Bacteria 4584
462 nmdc:mga09592_29560_c1 3300050508 Bacteria 4557
463 nmdc:mga09592_398255_c1 3300050508 Bacteria 1190
464 nmdc:mga0qj67_14265_c1 3300050509 Bacteria 6005
465 nmdc:mga0qj67_1474_c1 3300050509 Bacteria 16512
466 nmdc:mga0qj67_189818_c1 3300050509 Bacteria 1670
467 nmdc:mga0qj67_212361_c1 3300050509 Bacteria 1572
468 nmdc:mga0qj67_21594_c1 3300050509 Bacteria 4939
469 nmdc:mga0qj67_62441_c1 3300050509 Bacteria 2960
470 nmdc:mga0qj67_65434_c1 3300050509 Bacteria 2894
471 nmdc:mga0qj67_74_c2 3300050509 Bacteria 31414
472 nmdc:mga06r32_375592_c1 3300050510 Bacteria 1404
473 nmdc:mga06r32_377_c1 3300050510 Bacteria 37475
474 nmdc:mga06r32_4767_c1 3300050510 Bacteria 12196
475 nmdc:mga06r32_5263_c1 3300050510 Bacteria 11635
476 nmdc:mga08y16_139172_c1 3300050511 Bacteria 2524
477 nmdc:mga08y16_14567_c1 3300050511 Bacteria 8269
478 nmdc:mga08y16_32336_c1 3300050511 Bacteria 5501
479 nmdc:mga08y16_80767_c1 3300050511 Bacteria 3390
480 nmdc:mga0n895_169413_c1 3300050512 Bacteria 2216
481 nmdc:mga0a205_63497_c1 3300050515 Bacteria 3568
482 Ga0495619_0004385 3300053085 Bacteria 8998
483 Ga0501084_0003879 3300054114 Bacteria 12172
484 Ga0501084_0158067 3300054114 Bacteria 1912
485 Ga0501082_0016338 3300060353 Bacteria 6389
486 Ga0501082_0029208 3300060353 Bacteria 4749
487 Ga0501082_0063496 3300060353 Bacteria 3180
488 Ga0501082_0163576 3300060353 Bacteria 1934
489 Ga0466962_0002331 3300061719 Bacteria 9000
490 Ga0466962_0009178 3300061719 Bacteria 4737
491 Ga0466962_0101955 3300061719 Bacteria 1378
492 Ga0530510_0013061 3300061734 Bacteria 5841
493 Ga0530510_0345269 3300061734 Bacteria 1118
494 Ga0530510_0458761 3300061734 Bacteria 964
495 2547405495 2547132111 Bacteria 8013147
496 2548697168 2547132424 Bacteria 8348532
497 2554260092 2554235005 Bacteria 6457341
498 2738888976 2738541308 Bacteria 7020677
499 2744954729 2744054611 Bacteria 5611514
500 2753071221 2751185734 Bacteria 8863695
501 2812361704 2811994879 Bacteria 9313447
502 2812477092 2811994917 Bacteria 7761064
503 2856742640 2856741275 Bacteria 8096094
504 2862512610 2862507626 Bacteria 9425308
505 2866617701 2866612099 Bacteria 7543886
506 2870721975 2870721527 Bacteria 9689237
507 2873317449 2873314349 Bacteria 8512634
508 2891396897 2891395885 Bacteria 9251614
509 2891559499 2891554331 Bacteria 8812224
510 2891563231 2891562705 Bacteria 8039471
511 2895436561 2895427314 Bacteria 13147766
512 2912723808 2912715099 Bacteria 9460473
513 2912728273 2912723979 Bacteria 8557534
514 2922556412 2922554459 Bacteria 6683962
515 2946064460 2946064051 Bacteria 8957905
516 2947224399 2947224130 Bacteria 9938529
517 2954692650 2954691527 Bacteria 10720516
518 2954707723 2954701450 Bacteria 10834262
519 3006494035 3006493962 Bacteria 8825450
520 8001785921 8001781756 Bacteria 9586736
521 8008575419 8008574985 Bacteria 7815457
522 8023627821 8023623736 Bacteria 8593882
523 8055069121 8055066027 Bacteria 9479577
524 8055173220 8055172936 Bacteria 9305943
525 8055415144 8055412473 Bacteria 6257500
526 8056834742 8056829672 Bacteria 9045328
527 Ga0111539_10001879
528 JGI24737J22298_10015755
529 JGI24751J29686_10003199
530 Ga0006777J48905_1093077
531 JGI25407J50210_10000005
532 Ga0070658_10065034
533 Ga0070683_100000938
534 Ga0070683_100521687
535 Ga0070690_100106121
536 Ga0070670_100031532
537 Ga0068869_100054594
538 Ga0070687_100261975
539 Ga0070668_100465202
540 Ga0070669_100178685
541 Ga0070659_100046289
542 Ga0070659_100151358
543 Ga0070667_100459481
544 Ga0070667_100793682
545 Ga0070709_10037723
546 Ga0070714_100015702
547 Ga0070714_100433724
548 Ga0070714_100847028
549 Ga0070713_100391741
550 Ga0070713_100593013
551 Ga0070710_10039460
552 Ga0070711_100179013
553 Ga0070694_100076460
554 Ga0070694_100628358
555 Ga0070708_100002695
556 Ga0070708_100005308
557 Ga0070678_100548681
558 Ga0070662_100456875
559 Ga0068867_100307383
560 Ga0070706_100000226
561 Ga0070706_100202642
562 Ga0070706_100781089
563 Ga0070707_100000276
564 Ga0070707_100000917
565 Ga0070707_100003424
566 Ga0070707_100011586
567 Ga0070707_100126148
568 Ga0070698_100001078
569 Ga0070698_100005402
570 Ga0070698_100029377
571 Ga0070698_100090235
572 Ga0070698_100147697
573 Ga0070698_100272568
574 Ga0070698_100299914
575 Ga0070699_100007362
576 Ga0070699_100134562
577 Ga0070699_100193450
578 Ga0070679_100120605
579 Ga0070684_100022978
580 Ga0070684_100387764
581 Ga0070697_100000060
582 Ga0070697_100003590
583 Ga0070697_100138117
584 Ga0070672_100043995
585 Ga0070704_100923298
586 Ga0068855_100385930
587 Ga0068857_100091593
588 Ga0068857_100133289
589 Ga0068857_100281895
590 Ga0068857_100404573
591 Ga0068859_100002323
592 Ga0068859_100022669
593 Ga0068859_100194641
594 Ga0068866_10442590
595 Ga0068870_10192955
596 Ga0068860_100101243
597 Ga0081455_10012848
598 Ga0081455_10044587
599 Ga0081455_10115339
600 Ga0081455_10158143
601 Ga0081538_10000251
602 Ga0081538_10005996
603 Ga0081538_10016255
604 Ga0081538_10022308
605 Ga0081539_10085191
606 Ga0070717_10015467
607 Ga0070717_10418742
608 Ga0070717_10544445
609 Ga0075363_100004963
610 Ga0075367_10054749
611 Ga0075428_100000315
612 Ga0075428_100010182
613 Ga0075428_100012201
614 Ga0075428_100286936
615 Ga0075428_100491125
616 Ga0075428_100580326
617 Ga0075430_100005211
618 Ga0075430_100008022
619 Ga0075430_100008872
620 Ga0075430_100051864
621 Ga0075430_100161868
622 Ga0075430_100206517
623 Ga0075431_100000967
624 Ga0075431_100001049
625 Ga0075431_100005261
626 Ga0075431_100075298
627 Ga0075431_100380532
628 Ga0075433_10099564
629 Ga0075434_100002270
630 Ga0075434_100181251
631 Ga0075429_100002742
632 Ga0075429_100004716
633 Ga0075429_100015466
634 Ga0075429_100055173
635 Ga0075429_100162486
636 Ga0075429_100195672
637 Ga0075429_100448526
638 Ga0097620_100002323
639 Ga0097620_100022670
640 Ga0097620_100194655
641 Ga0075435_100425176
642 Ga0111539_10017024
643 Ga0111539_10324185
644 Ga0111539_10407977
645 Ga0111539_10613226
646 Ga0111539_11205626
647 Ga0114129_10000290
648 Ga0114129_10001554
649 Ga0114129_10002851
650 Ga0114129_10085639
651 Ga0114129_10091874
652 Ga0114129_10125019
653 Ga0114129_10144556
654 Ga0114129_10369777
655 Ga0114129_10611655
656 Ga0105243_10219838
657 Ga0105248_10583643
658 Ga0105249_10258435
659 Ga0105239_10205783
660 Ga0157370_10160113
661 Ga0157369_10012299
662 Ga0157375_10625220
663 Ga0157375_11110038
664 Ga0157380_10158626
665 Ga0157380_10174465
666 Ga0157380_10442232
667 Ga0157379_10440873
668 Ga0206349_1373949
669 Ga0206350_10196893
670 Ga0206354_10106349
671 Ga0206354_10362210
672 Ga0206354_11266847
673 Ga0206353_11576664
674 Ga0213876_10130735
675 Ga0213875_10000725
676 Ga0224712_10028186
677 Ga0207692_10000572
678 Ga0207645_10264237
679 Ga0207643_10166317
680 Ga0207705_10028751
681 Ga0207684_10000007
682 Ga0207684_10000015
683 Ga0207684_10364091
684 Ga0207707_10209735
685 Ga0207693_10120189
686 Ga0207663_10209065
687 Ga0207662_10412960
688 Ga0207646_10000095
689 Ga0207646_10000505
690 Ga0207646_10000904
691 Ga0207646_10001879
692 Ga0207646_10025473
693 Ga0207646_10170916
694 Ga0207646_10488504
695 Ga0207681_10072492
696 Ga0207700_10439562
697 Ga0207664_10282844
698 Ga0207664_10339310
699 Ga0207690_10055160
700 Ga0207665_10167884
701 Ga0207711_10528544
702 Ga0207689_10054746
703 Ga0207661_10001793
704 Ga0207661_10402972
705 Ga0207667_10456772
706 Ga0207712_10200778
707 Ga0207668_10188715
708 Ga0207668_10268443
709 Ga0207658_10910333
710 Ga0207677_10082633
711 Ga0207703_10046416
712 Ga0207676_10194189
713 Ga0207674_10118328
714 Ga0207675_100042461
715 Ga0207683_10289725
716 Ga0207428_10005397
717 Ga0207428_10030757
718 Ga0207428_10045419
719 Ga0207428_10075441
720 Ga0268264_10367479
721 Ga0316177_1025831
722 Ga0316176_1002521
723 Ga0314311_1064677
724 Ga0316180_1079902
725 Ga0316183_1067173
726 Ga0316182_1432565
727 Ga0307513_10011334
728 Ga0307513_10293276
729 Ga0307405_10001248
730 Ga0307405_10062569
731 Ga0307413_10006443
732 Ga0307410_10018553
733 Ga0307406_10157561
734 Ga0307407_10049944
735 Ga0307412_10544464
736 Ga0307409_100029810
737 Ga0307409_100210190
738 Ga0307409_100454329
739 Ga0307416_100001217
740 Ga0307416_100172168
741 Ga0307416_100238847
742 Ga0307416_100475921
743 Ga0307411_10020006
744 Ga0307411_10378269
745 Ga0307411_10438221
746 Ga0307415_100000006
747 Ga0307415_100046041
748 Ga0307415_100166978
749 Ga0373926_0044676
750 Ga0373934_0104938
751 Ga0373947_0022978
752 Ga0373937_0444773
753 Ga0373937_0458684
754 Ga0395899_0003841
755 Ga0395899_0046998
756 Ga0395899_0147125
757 Ga0395900_0009542
758 Ga0395900_0053184
759 Ga0395900_0076716
760 Ga0395900_0079345
761 Ga0395900_0080992
762 Ga0395900_0243473
763 Ga0395900_0485608
764 Ga0395898_0001963
765 Ga0395898_0004551
766 Ga0395898_0118418
767 Ga0395898_0165602
768 Ga0395898_0302528
769 Ga0395905_0000164
770 Ga0395905_0000596
771 Ga0395905_0003330
772 Ga0395905_0012975
773 Ga0395905_0036752
774 Ga0395905_0119682
775 Ga0395905_0224390
776 Ga0436364_0849153
777 Ga0395901_0008308
778 Ga0395901_0017095
779 Ga0395901_0037866
780 Ga0395901_0109585
781 Ga0395901_0315855
782 Ga0436365_0412500
783 Ga0439436_0000462
784 Ga0439439_0079414
785 Ga0439465_0032186
786 Ga0451795_0301688
787 Ga0451849_1059109
788 Ga0439433_0009589
789 Ga0439445_0012572
790 Ga0439448_0001838
791 Ga0439449_0007995
792 Ga0439449_0011769
793 Ga0439450_045148
794 Ga0439457_003324
795 Ga0439463_003870
796 Ga0450903_000052
797 Ga0439460_0007350
798 Ga0451577_0006491
799 Ga0451577_0195527
800 Ga0439440_0006705
801 Ga0466969_0008187
802 Ga0466969_0010036
803 Ga0466969_0104460
804 Ga0466969_0149690
805 Ga0466972_0009126
806 Ga0466972_0034700
807 Ga0453683_0007368
808 Ga0466965_0000590
809 Ga0466965_0030186
810 Ga0466965_0044321
811 Ga0466966_0000905
812 Ga0466966_0001938
813 Ga0466966_0010686
814 Ga0466966_0045688
815 Ga0466966_0054627
816 Ga0466961_0000981
817 Ga0466961_0007754
818 Ga0466961_0011624
819 Ga0466961_0102029
820 Ga0466961_0126416
821 Ga0466961_0253297
822 Ga0466963_0000549
823 Ga0466963_0002234
824 Ga0466963_0057905
825 Ga0466964_0008208
826 Ga0453684_0000049
827 Ga0453684_0030454
828 Ga0466971_0131826
829 Ga0466968_0022328
830 Ga0466970_0000618
831 Ga0466970_0022216
832 Ga0466970_0202848
833 Ga0466957_0000492
834 Ga0466957_0350963
835 Ga0466960_0006350
836 Ga0466959_0001513
837 Ga0466959_0005137
838 Ga0466959_0017220
839 Ga0466959_0168509
840 Ga0466958_0003296
841 Ga0466958_0017944
842 Ga0466958_0031851
843 Ga0466958_0233887
844 Ga0466967_0011408
845 Ga0466967_0093256
846 Ga0466967_0614196
847 Ga0495629_0000032
848 Ga0495641_0026271
849 Ga0495580_0064984
850 Ga0495580_0228497
851 Ga0495582_0009354
852 Ga0495594_0005258
853 Ga0495634_0044068
854 Ga0495635_0000134
855 Ga0495658_0000240
856 Ga0495613_0000641
857 Ga0495624_0133122
858 Ga0495581_0003232
859 Ga0495676_0141956
860 Ga0495680_0000523
861 Ga0495593_0100847
862 Ga0495614_0016589
863 Ga0496100_0007108
864 Ga0496102_0021060
865 Ga0496104_0351849
866 Ga0496105_0034794
867 Ga0496105_0346868
868 Ga0496106_0051994
869 Ga0496112_0145762
870 Ga0496113_0142640
871 Ga0496115_0119231
872 Ga0501031_0003849
873 Ga0501031_0019020
874 Ga0501031_0022768
875 Ga0501031_0378506
876 Ga0501032_0000142
877 Ga0501032_0092756
878 Ga0501033_0005672
879 Ga0501033_0212951
880 Ga0501033_0261809
881 Ga0501034_0001328
882 Ga0501034_0011207
883 Ga0501034_0162950
884 Ga0501034_0427061
885 Ga0501036_0001103
886 Ga0501036_0004728
887 Ga0501036_0020358
888 Ga0501036_0100897
889 Ga0501036_0121468
890 Ga0501037_0007520
891 Ga0501037_0104441
892 Ga0501037_0105560
893 Ga0501037_0168287
894 Ga0501038_0012601
895 Ga0501038_0126125
896 Ga0501038_0160019
897 Ga0501038_0308240
898 Ga0501039_0014880
899 Ga0501039_0105089
900 Ga0501039_0292563
901 Ga0501039_0335918
902 Ga0501039_0410762
903 Ga0501040_0001579
904 Ga0501040_0015231
905 Ga0501040_0059524
906 Ga0501040_0083046
907 Ga0501040_0368497
908 Ga0501041_0010450
909 Ga0501042_0012932
910 Ga0501042_0027656
911 Ga0501042_0032835
912 Ga0501043_0004878
913 Ga0501043_0052247
914 Ga0501046_0007647
915 Ga0501046_0023973
916 Ga0501046_0042256
917 Ga0501046_0364043
918 Ga0501046_0514227
919 Ga0501047_0003449
920 Ga0501047_0039466
921 Ga0501047_0125785
922 Ga0501048_0005383
923 Ga0501048_0029146
924 Ga0501048_0174775
925 Ga0501048_0184825
926 Ga0501048_0235083
927 Ga0501068_0064066
928 Ga0501070_0161842
929 Ga0501070_0376749
930 Ga0501071_0013631
931 Ga0501071_0086715
932 Ga0501071_0133728
933 Ga0501072_0002193
934 Ga0501072_0010953
935 Ga0501072_0086860
936 Ga0501072_0415442
937 Ga0501074_0011342
938 Ga0501075_0013711
939 Ga0501075_0023188
940 Ga0501075_0187202
941 Ga0501076_0004486
942 Ga0501076_0021611
943 Ga0501076_0055631
944 Ga0501076_0209919
945 Ga0501077_0039678
946 Ga0501077_0141786
947 Ga0501079_0006725
948 Ga0501079_0087550
949 Ga0501079_0134839
950 Ga0501079_0141148
951 Ga0501079_0271852
952 Ga0501080_0092001
953 Ga0501081_0021160
954 Ga0501081_0221513
955 Ga0501083_0086802
956 Ga0501035_0053133
957 Ga0501035_0101106
958 Ga0501035_0116267
959 Ga0501035_0174167
960 Ga0501035_0210204
961 Ga0501035_0350057
962 Ga0501044_0035163
963 Ga0501044_0147397
964 Ga0501044_0358467
965 Ga0501044_0474873
966 Ga0501044_0920834
967 Ga0501045_0007058
968 Ga0501045_0013559
969 Ga0501045_0019343
970 Ga0501045_0063908
971 Ga0501045_0164463
972 Ga0501045_0393850
973 nmdc:mga03n38_112437_c1
974 nmdc:mga03n38_7879_c1
975 nmdc:mga06z11_33289_c1
976 nmdc:mga07m45_330316_c1
977 nmdc:mga05p37_1044780_c1
978 nmdc:mga05p37_2644_c1
979 nmdc:mga05p37_284_c1
980 nmdc:mga05p37_61677_c1
981 nmdc:mga05p37_6627_c1
982 nmdc:mga05p37_95990_c1
983 nmdc:mga05p37_96969_c1
984 nmdc:mga09592_1083_c1
985 nmdc:mga09592_152622_c1
986 nmdc:mga09592_25937_c1
987 nmdc:mga09592_29226_c1
988 nmdc:mga09592_29560_c1
989 nmdc:mga09592_398255_c1
990 nmdc:mga0qj67_14265_c1
991 nmdc:mga0qj67_1474_c1
992 nmdc:mga0qj67_189818_c1
993 nmdc:mga0qj67_212361_c1
994 nmdc:mga0qj67_21594_c1
995 nmdc:mga0qj67_62441_c1
996 nmdc:mga0qj67_65434_c1
997 nmdc:mga0qj67_74_c2
998 nmdc:mga06r32_375592_c1
999 nmdc:mga06r32_377_c1
1000 nmdc:mga06r32_4767_c1
1001 nmdc:mga06r32_5263_c1
1002 nmdc:mga08y16_139172_c1
1003 nmdc:mga08y16_14567_c1
1004 nmdc:mga08y16_32336_c1
1005 nmdc:mga08y16_80767_c1
1006 nmdc:mga0n895_169413_c1
1007 nmdc:mga0a205_63497_c1
1008 Ga0495619_0004385
1009 Ga0501084_0003879
1010 Ga0501084_0158067
1011 Ga0501082_0016338
1012 Ga0501082_0029208
1013 Ga0501082_0063496
1014 Ga0501082_0163576
1015 Ga0466962_0002331
1016 Ga0466962_0009178
1017 Ga0466962_0101955
1018 Ga0530510_0013061
1019 Ga0530510_0345269
1020 Ga0530510_0458761
1021 2547405495
1022 2548697168
1023 2554260092
1024 2738888976
1025 2744954729
1026 2753071221
1027 2812361704
1028 2812477092
1029 2856742640
1030 2862512610
1031 2866617701
1032 2870721975
1033 2873317449
1034 2891396897
1035 2891559499
1036 2891563231
1037 2895436561
1038 2912723808
1039 2912728273
1040 2922556412
1041 2946064460
1042 2947224399
1043 2954692650
1044 2954707723
1045 3006494035
1046 8001785921
1047 8008575419
1048 8023627821
1049 8055069121
1050 8055173220
1051 8055415144
1052 8056834742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

9

216

0.51

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yv1-assembly1.cif.gz_A crystal structure of succinyl-coa synthetase alpha chain from methanocaldococcus jannaschii dsm 2661 0.7361 31 93
4row-assembly1.cif.gz_A the crystal structure of novel apobec3g cd2 head-to-tail dimer suggests the binding mode of full-length apobec3g to hiv-1 ssdna 0.7041 49 92
4hnv-assembly1.cif.gz_A crystal structure of r54e mutant of s. aureus pyruvate carboxylase 0.6658 19 91
3rl5-assembly1.cif.gz_A rat metallophosphodiesterase mpped2 h67r mutant 0.6656 2 240
4mfd-assembly1.cif.gz_C structure of the carboxyl transferase domain from rhizobium etli pyruvate carboxylase with oxalate 0.6619 6 92
ID Description Score Start End Superfamily
af_Q4DY11_62_216_3.60.21.40 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain 0.7686 4 85 3.60.21.40
2yv1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.7361 31 93 3.40.50.261
af_Q08BG1_205_402_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7158 4 207 3.60.21.10
af_Q2FVI2_1_263_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7115 1 227 3.60.21.10
af_P0AEW4_8_273_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6998 2 227 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A5N8WAI4-F1-model_v4 Metallophosphoesterase 0.9943 1 113 GO:0008758
GO:0009245
GO:0016020
AF-A0A7K2KY92-F1-model_v4 Metallophosphoesterase 0.9931 1 71 GO:0016787
AF-A0A076MP28-F1-model_v4 Metallophosphoesterase 0.9926 159 239
AF-A0A1U1NET1-F1-model_v4 deleted 0.9858 142 241
AF-A0A5N8WAI4-F1-model_v4 Metallophosphoesterase 0.9857 1 113 GO:0008758
GO:0009245
GO:0016020

Map