F459308

General Info

Members Datasets Scaffolds Average Seq Length
525 346 1050 137

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0012720|Ga0439436_0012720_193_669
Length 158
Sequence MDTNRAHGPDIKLSQCFLAVDDHDKALAFYRDVLGMEVRGDVGFEGMRWVTVGSPLQPDVEIVLEPPGADPDISPADREAIAQLLAKGVLRGVNFTTDDCDALYSRVEASGADVLQEPMDQPYGVRDCAFRDPAGNMLRFMEPRKSGEAGTASKYGAQ

Samples

Sample ID Description Type Environment
1 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
138 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
142 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
143 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
146 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
147 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
148 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
149 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
150 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
151 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
152 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
153 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
154 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
157 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
191 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
260 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
297 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
298 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
299 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
300 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
301 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
302 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
307 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
308 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
309 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
310 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
315 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
316 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
317 2643221553 Microbacterium sp. Root553 Isolate Unclassified
318 2643221647 Streptomyces sp. Root369 Isolate Unclassified
319 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
320 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
321 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
322 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
323 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
324 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
325 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
326 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
327 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
328 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
329 2867428634 Streptomyces sp. RP5T Isolate Unclassified
330 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
331 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
332 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
333 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
334 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
335 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
336 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
337 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
338 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
339 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
340 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
341 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
342 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
343 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
344 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
345 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
346 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 0.38
Isolates 6.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.38
Nodule 0.38
Rhizoplane 1.9
Rhizosphere 83.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439436_0012720 3300041404 Bacteria 2553
2 JGI24740J21852_10069940 3300001979 Bacteria 943
3 JGI24735J21928_10161993 3300002067 Bacteria 646
4 Ga0070676_10255292 3300005328 Bacteria 1172
5 Ga0070683_100029461 3300005329 Bacteria 4970
6 Ga0070680_101737695 3300005336 Bacteria 541
7 Ga0068868_100051495 3300005338 Bacteria 3239
8 Ga0070660_100503138 3300005339 Bacteria 1008
9 Ga0070660_101193599 3300005339 Bacteria 645
10 Ga0070689_100407718 3300005340 Bacteria 1150
11 Ga0070687_100273182 3300005343 Bacteria 1060
12 Ga0070661_100057066 3300005344 Bacteria 2861
13 Ga0070675_100019089 3300005354 Bacteria 5462
14 Ga0070671_101930944 3300005355 Bacteria 525
15 Ga0070673_100367474 3300005364 Bacteria 1280
16 Ga0070659_100174819 3300005366 Bacteria 1761
17 Ga0070700_100042813 3300005441 Bacteria 2783
18 Ga0070663_100034582 3300005455 Bacteria 3501
19 Ga0070663_100589991 3300005455 Bacteria 933
20 Ga0070662_100382144 3300005457 Bacteria 1159
21 Ga0070681_10131024 3300005458 Bacteria 2440
22 Ga0070706_100132127 3300005467 Bacteria 2330
23 Ga0070707_100017988 3300005468 Bacteria 6647
24 Ga0070679_100007161 3300005530 Bacteria 10410
25 Ga0070679_101003961 3300005530 Bacteria 779
26 Ga0070684_100125368 3300005535 Bacteria 2313
27 Ga0070684_100209502 3300005535 Bacteria 1776
28 Ga0070693_100504494 3300005547 Bacteria 859
29 Ga0070664_100044791 3300005564 Bacteria 3736
30 Ga0068857_100287889 3300005577 Bacteria 1512
31 Ga0068857_100789991 3300005577 Bacteria 906
32 Ga0068856_101227866 3300005614 Bacteria 766
33 Ga0070702_100261333 3300005615 Bacteria 1179
34 Ga0068852_100927933 3300005616 Bacteria 888
35 Ga0068859_100533995 3300005617 Bacteria 1268
36 Ga0068859_102060442 3300005617 Bacteria 630
37 Ga0068864_100201807 3300005618 Bacteria 1827
38 Ga0068861_100021568 3300005719 Bacteria 4631
39 Ga0068851_10623330 3300005834 Bacteria 658
40 Ga0068863_100230543 3300005841 Bacteria 1786
41 Ga0068858_100747674 3300005842 Bacteria 953
42 Ga0068860_101546445 3300005843 Bacteria 685
43 Ga0068862_100371228 3300005844 Bacteria 1332
44 Ga0068862_101284389 3300005844 Bacteria 733
45 Ga0081540_1130808 3300005983 Bacteria 1025
46 Ga0081539_10006015 3300005985 Bacteria 11916
47 Ga0081539_10074396 3300005985 Bacteria 1809
48 Ga0081539_10157470 3300005985 Bacteria 1086
49 Ga0075364_10014656 3300006051 Bacteria 4848
50 Ga0075370_10037119 3300006353 Bacteria 2739
51 Ga0068871_100363780 3300006358 Bacteria 1282
52 Ga0075428_100423225 3300006844 Bacteria 1427
53 Ga0075428_100466052 3300006844 Bacteria 1353
54 Ga0075430_100873367 3300006846 Bacteria 741
55 Ga0075431_100019413 3300006847 Bacteria 6929
56 Ga0075431_101730200 3300006847 Bacteria 582
57 Ga0075433_10669072 3300006852 Bacteria 910
58 Ga0075429_100074426 3300006880 Bacteria 2958
59 Ga0068865_101349593 3300006881 Bacteria 635
60 Ga0097620_100533971 3300006931 Bacteria 1268
61 Ga0097620_102061035 3300006931 Bacteria 630
62 Ga0097620_103053150 3300006931 Bacteria 511
63 Ga0111539_10002270 3300009094 Bacteria 25583
64 Ga0111539_10514385 3300009094 Bacteria 1394
65 Ga0105245_10053874 3300009098 Bacteria 3612
66 Ga0114129_10093588 3300009147 Bacteria 4163
67 Ga0114129_11942308 3300009147 Bacteria 713
68 Ga0105243_10196728 3300009148 Bacteria 1765
69 Ga0105243_10321098 3300009148 Bacteria 1411
70 Ga0105241_10205492 3300009174 Bacteria 1647
71 Ga0105238_10237870 3300009551 Bacteria 1798
72 Ga0105238_10365827 3300009551 Bacteria 1432
73 Ga0105249_10106010 3300009553 Bacteria 2651
74 Ga0105249_10866656 3300009553 Bacteria 969
75 Ga0105239_10415457 3300010375 Bacteria 1523
76 Ga0105246_10415650 3300011119 Bacteria 1121
77 Ga0157370_10365650 3300013104 Bacteria 1329
78 Ga0157372_11493159 3300013307 Bacteria 779
79 Ga0157375_10418783 3300013308 Bacteria 1505
80 Ga0163163_10653107 3300014325 Bacteria 1115
81 Ga0163163_10664145 3300014325 Bacteria 1106
82 Ga0182008_10414212 3300014497 Bacteria 726
83 Ga0157377_10117824 3300014745 Bacteria 1605
84 Ga0157377_10296565 3300014745 Bacteria 1065
85 Ga0157379_10321360 3300014968 Bacteria 1413
86 Ga0157376_10300628 3300014969 Bacteria 1519
87 Ga0206352_11080364 3300020078 Bacteria 508
88 Ga0206353_11805816 3300020082 Bacteria 1657
89 Ga0213876_10378163 3300021384 Bacteria 753
90 Ga0209646_1000099 3300025246 Bacteria 180436
91 Ga0207688_10023927 3300025901 Bacteria 3348
92 Ga0207680_10181052 3300025903 Bacteria 1425
93 Ga0207647_10007073 3300025904 Bacteria 8138
94 Ga0207647_10261572 3300025904 Bacteria 991
95 Ga0207645_10101986 3300025907 Bacteria 1852
96 Ga0207643_10515831 3300025908 Bacteria 765
97 Ga0207684_10043755 3300025910 Bacteria 3797
98 Ga0207707_10100555 3300025912 Bacteria 2527
99 Ga0207660_10094229 3300025917 Bacteria 2225
100 Ga0207662_10219964 3300025918 Bacteria 1236
101 Ga0207657_10324035 3300025919 Bacteria 1218
102 Ga0207657_10351627 3300025919 Bacteria 1162
103 Ga0207649_10038330 3300025920 Bacteria 2901
104 Ga0207652_10087911 3300025921 Bacteria 2725
105 Ga0207646_10246544 3300025922 Bacteria 1613
106 Ga0207694_10545534 3300025924 Bacteria 973
107 Ga0207659_10040662 3300025926 Bacteria 3252
108 Ga0207687_10016773 3300025927 Bacteria 4813
109 Ga0207690_10098822 3300025932 Bacteria 2080
110 Ga0207706_10073857 3300025933 Bacteria 2999
111 Ga0207709_10798270 3300025935 Bacteria 762
112 Ga0207670_10321266 3300025936 Bacteria 1218
113 Ga0207670_10892752 3300025936 Bacteria 744
114 Ga0207704_10434713 3300025938 Bacteria 1044
115 Ga0207691_10163635 3300025940 Bacteria 1950
116 Ga0207661_10036564 3300025944 Bacteria 3834
117 Ga0207661_10038375 3300025944 Bacteria 3754
118 Ga0207661_11088523 3300025944 Bacteria 736
119 Ga0207679_10103463 3300025945 Bacteria 2231
120 Ga0207679_11238270 3300025945 Bacteria 685
121 Ga0207651_10370355 3300025960 Bacteria 1212
122 Ga0207712_10096131 3300025961 Bacteria 2192
123 Ga0207712_10489427 3300025961 Bacteria 1050
124 Ga0207640_11415866 3300025981 Bacteria 623
125 Ga0207677_10029450 3300026023 Bacteria 3489
126 Ga0207639_10198955 3300026041 Bacteria 1717
127 Ga0207639_10674299 3300026041 Bacteria 958
128 Ga0207678_10018587 3300026067 Bacteria 6102
129 Ga0207708_10036012 3300026075 Bacteria 3766
130 Ga0207708_10130014 3300026075 Bacteria 1969
131 Ga0207702_11277577 3300026078 Bacteria 728
132 Ga0207641_11061619 3300026088 Bacteria 808
133 Ga0207676_10498720 3300026095 Bacteria 1156
134 Ga0207676_10933438 3300026095 Bacteria 853
135 Ga0207674_10095713 3300026116 Bacteria 2955
136 Ga0207674_10200086 3300026116 Bacteria 1947
137 Ga0207674_10321368 3300026116 Bacteria 1497
138 Ga0207675_100033298 3300026118 Bacteria 4802
139 Ga0207698_10976938 3300026142 Bacteria 857
140 Ga0268266_10718155 3300028379 Bacteria 964
141 Ga0268266_11395690 3300028379 Bacteria 676
142 Ga0268264_10270352 3300028381 Bacteria 1588
143 Ga0307515_10000699 3300028794 Bacteria 77489
144 Ga0307515_10156887 3300028794 Bacteria 2343
145 Ga0307515_10311793 3300028794 Bacteria 1248
146 Ga0307511_10008891 3300030521 Bacteria 10021
147 Ga0307511_10046630 3300030521 Bacteria 3560
148 Ga0307512_10015780 3300030522 Bacteria 6991
149 Ga0307513_10122970 3300031456 Bacteria 2558
150 Ga0307513_10159127 3300031456 Bacteria 2153
151 Ga0307509_10003540 3300031507 Bacteria 23507
152 Ga0307509_10010674 3300031507 Bacteria 11206
153 Ga0307509_10030385 3300031507 Bacteria 5978
154 Ga0307408_100383955 3300031548 Bacteria 1201
155 Ga0307514_10067732 3300031649 Bacteria 2693
156 Ga0307516_10188947 3300031730 Bacteria 1787
157 Ga0307516_10295268 3300031730 Bacteria 1298
158 Ga0307405_10011044 3300031731 Bacteria 4713
159 Ga0307518_10095365 3300031838 Bacteria 2136
160 Ga0307410_10011418 3300031852 Bacteria 5079
161 Ga0307406_10005802 3300031901 Bacteria 6764
162 Ga0307406_10032792 3300031901 Bacteria 3173
163 Ga0307406_10302696 3300031901 Bacteria 1229
164 Ga0307407_10017856 3300031903 Bacteria 3572
165 Ga0307412_10295400 3300031911 Bacteria 1278
166 Ga0307409_100000245 3300031995 Bacteria 21848
167 Ga0307409_100305295 3300031995 Bacteria 1483
168 Ga0307416_100001142 3300032002 Bacteria 14249
169 Ga0307416_100168611 3300032002 Bacteria 2035
170 Ga0307416_100241479 3300032002 Bacteria 1751
171 Ga0307416_100291105 3300032002 Bacteria 1617
172 Ga0307414_10067906 3300032004 Bacteria 2556
173 Ga0307411_10011024 3300032005 Bacteria 4854
174 Ga0307415_100000249 3300032126 Bacteria 23267
175 Ga0307415_100032103 3300032126 Bacteria 3392
176 Ga0307507_10000158 3300033179 Bacteria 120194
177 Ga0307507_10018115 3300033179 Bacteria 8033
178 Ga0307507_10084844 3300033179 Bacteria 2758
179 Ga0307510_10006521 3300033180 Bacteria 13915
180 Ga0395898_0008287 3300037466 Bacteria 10990
181 Ga0395898_0023073 3300037466 Bacteria 6292
182 Ga0395905_0392141 3300037471 Bacteria 1283
183 Ga0395901_0048379 3300038443 Bacteria 4416
184 Ga0395901_1442093 3300038443 Bacteria 646
185 Ga0436365_0910771 3300039437 Bacteria 737
186 Ga0451791_0070963 3300041451 Bacteria 732
187 Ga0451802_0418231 3300041460 Bacteria 880
188 Ga0451833_0250567 3300041491 Bacteria 856
189 Ga0451833_1482948 3300041491 Bacteria 579
190 Ga0451845_0101425 3300041501 Bacteria 1520
191 Ga0451853_0186987 3300041512 Bacteria 1392
192 Ga0451853_0512021 3300041512 Bacteria 8812
193 Ga0451853_1415845 3300041512 Bacteria 1172
194 Ga0439448_0005562 3300042005 Bacteria 3596
195 Ga0439449_0010050 3300042007 Bacteria 3580
196 Ga0439449_0089808 3300042007 Bacteria 1134
197 Ga0439450_125550 3300042008 Bacteria 663
198 Ga0439455_0000964 3300042012 Bacteria 4496
199 Ga0439457_000032 3300042014 Bacteria 28723
200 Ga0439457_026832 3300042014 Bacteria 1275
201 Ga0450920_022721 3300042122 Bacteria 1215
202 Ga0450897_000298 3300042128 Bacteria 2611
203 Ga0450894_000627 3300042131 Bacteria 5934
204 Ga0450895_007404 3300042132 Bacteria 908
205 Ga0450896_001635 3300042133 Bacteria 2797
206 Ga0450898_005635 3300042134 Bacteria 1899
207 Ga0450899_000887 3300042135 Bacteria 3413
208 Ga0450903_000297 3300042138 Bacteria 10927
209 Ga0450905_048676 3300042142 Bacteria 687
210 Ga0450906_000533 3300042145 Bacteria 7984
211 Ga0439458_0007098 3300042157 Bacteria 2494
212 Ga0450908_005153 3300042184 Bacteria 2507
213 Ga0439459_0006038 3300042438 Bacteria 2008
214 Ga0439460_0107592 3300042461 Bacteria 902
215 Ga0439440_0005862 3300042993 Bacteria 2451
216 Ga0466969_0011022 3300044656 Bacteria 4787
217 Ga0466969_0034989 3300044656 Bacteria 2543
218 Ga0466969_0044782 3300044656 Bacteria 2199
219 Ga0466972_0010894 3300044658 Bacteria 4562
220 Ga0466972_0040706 3300044658 Bacteria 2263
221 Ga0466972_0068246 3300044658 Bacteria 1698
222 Ga0466972_0122597 3300044658 Bacteria 1225
223 Ga0466966_0028271 3300044684 Bacteria 3653
224 Ga0466966_0051198 3300044684 Bacteria 2625
225 Ga0466966_0177090 3300044684 Bacteria 1295
226 Ga0466966_0663306 3300044684 Bacteria 628
227 Ga0466961_0038149 3300044693 Bacteria 3082
228 Ga0466961_0143432 3300044693 Bacteria 1494
229 Ga0466961_0161074 3300044693 Bacteria 1398
230 Ga0466963_0000748 3300044694 Bacteria 16035
231 Ga0466963_0016667 3300044694 Bacteria 4571
232 Ga0466963_0236845 3300044694 Bacteria 1280
233 Ga0466963_0810910 3300044694 Bacteria 660
234 Ga0466963_1339027 3300044694 Bacteria 502
235 Ga0466964_0009725 3300044706 Bacteria 3623
236 Ga0466971_0034711 3300044719 Bacteria 2260
237 Ga0466971_0127168 3300044719 Bacteria 1181
238 Ga0466971_0325318 3300044719 Bacteria 741
239 Ga0466968_0058288 3300044735 Bacteria 1661
240 Ga0466968_0114620 3300044735 Bacteria 1215
241 Ga0466970_0103200 3300044765 Bacteria 1554
242 Ga0466970_0216123 3300044765 Bacteria 1069
243 Ga0466970_0313802 3300044765 Bacteria 886
244 Ga0466960_0002701 3300044901 Bacteria 6704
245 Ga0466960_0006600 3300044901 Bacteria 4662
246 Ga0466959_0147242 3300045049 Bacteria 1661
247 Ga0466959_0332999 3300045049 Bacteria 1036
248 Ga0466959_0333349 3300045049 Bacteria 1036
249 Ga0466958_0182421 3300045836 Bacteria 1332
250 Ga0466967_0008283 3300045976 Bacteria 7598
251 Ga0466967_0093925 3300045976 Bacteria 2730
252 Ga0466967_0213738 3300045976 Bacteria 1830
253 Ga0466967_0270433 3300045976 Bacteria 1628
254 Ga0495617_002783 3300046452 Bacteria 6749
255 Ga0495627_000357 3300046453 Bacteria 42749
256 Ga0495627_007980 3300046453 Bacteria 4003
257 Ga0495592_0006761 3300046454 Bacteria 8551
258 Ga0495592_0278564 3300046454 Bacteria 1094
259 Ga0495603_0006752 3300046455 Bacteria 6885
260 Ga0495603_0018930 3300046455 Bacteria 4167
261 Ga0495603_0032858 3300046455 Bacteria 3122
262 Ga0495603_0736471 3300046455 Bacteria 563
263 Ga0495590_0014638 3300046457 Bacteria 2861
264 Ga0495629_0004249 3300046459 Bacteria 10739
265 Ga0495629_0033796 3300046459 Bacteria 3616
266 Ga0495629_0054919 3300046459 Bacteria 2785
267 Ga0495629_0078336 3300046459 Bacteria 2307
268 Ga0495629_0107463 3300046459 Bacteria 1946
269 Ga0495629_0806199 3300046459 Bacteria 619
270 Ga0495638_0093298 3300046460 Bacteria 1810
271 Ga0495638_0315379 3300046460 Bacteria 837
272 Ga0495641_0074098 3300046461 Bacteria 1527
273 Ga0495641_0322868 3300046461 Bacteria 697
274 Ga0495651_0080101 3300046462 Bacteria 2467
275 Ga0495651_0135365 3300046462 Bacteria 1793
276 Ga0495582_0030113 3300046473 Bacteria 2978
277 Ga0495582_0139933 3300046473 Bacteria 1371
278 Ga0495605_0002404 3300046474 Bacteria 11580
279 Ga0495605_0165873 3300046474 Bacteria 978
280 Ga0495639_0082833 3300046475 Bacteria 1496
281 Ga0495662_0008557 3300046476 Bacteria 5026
282 Ga0495662_0012154 3300046476 Bacteria 4205
283 Ga0495662_0014290 3300046476 Bacteria 3862
284 Ga0495662_0076250 3300046476 Bacteria 1627
285 Ga0495662_0158612 3300046476 Bacteria 1114
286 Ga0495664_0000253 3300046477 Bacteria 25829
287 Ga0495664_0067711 3300046477 Bacteria 2130
288 Ga0495584_0091370 3300046491 Bacteria 1535
289 Ga0495584_0712070 3300046491 Bacteria 512
290 Ga0495585_0014133 3300046492 Bacteria 4659
291 Ga0495585_0157030 3300046492 Bacteria 1182
292 Ga0495594_0027382 3300046499 Bacteria 3071
293 Ga0495594_0052117 3300046499 Bacteria 2253
294 Ga0495594_0077447 3300046499 Bacteria 1855
295 Ga0495594_0111114 3300046499 Bacteria 1545
296 Ga0495594_0169239 3300046499 Bacteria 1243
297 Ga0495596_0109389 3300046500 Bacteria 1073
298 Ga0495607_0068257 3300046501 Bacteria 1994
299 Ga0495606_0016761 3300046507 Bacteria 5570
300 Ga0495608_0032219 3300046511 Bacteria 3543
301 Ga0495616_0050844 3300046513 Bacteria 2070
302 Ga0495618_0018393 3300046514 Bacteria 4290
303 Ga0495618_0150150 3300046514 Bacteria 1488
304 Ga0495620_0013025 3300046515 Bacteria 4269
305 Ga0495620_0056446 3300046515 Bacteria 1651
306 Ga0495628_0033429 3300046516 Bacteria 4146
307 Ga0495628_0061453 3300046516 Bacteria 2946
308 Ga0495630_0108128 3300046517 Bacteria 2107
309 Ga0495630_0176120 3300046517 Bacteria 1630
310 Ga0495631_0006400 3300046518 Bacteria 6076
311 Ga0495632_0444599 3300046519 Bacteria 563
312 Ga0495643_0006859 3300046522 Bacteria 7421
313 Ga0495643_0163466 3300046522 Bacteria 1094
314 Ga0495648_0065806 3300046524 Bacteria 2128
315 Ga0495666_0030365 3300046526 Bacteria 2652
316 Ga0495666_0192828 3300046526 Bacteria 938
317 Ga0495642_0156041 3300046528 Bacteria 988
318 Ga0495652_0106074 3300046529 Bacteria 2269
319 Ga0495652_0321144 3300046529 Bacteria 1118
320 Ga0495654_0031215 3300046530 Bacteria 2705
321 Ga0495640_0017254 3300046533 Bacteria 5383
322 Ga0495587_0003015 3300046536 Bacteria 11258
323 Ga0495587_0330606 3300046536 Bacteria 851
324 Ga0495597_0041813 3300046542 Bacteria 2046
325 Ga0495597_0106186 3300046542 Bacteria 1180
326 Ga0495622_0013626 3300046557 Bacteria 3769
327 Ga0495622_0051435 3300046557 Bacteria 1911
328 Ga0495667_0040552 3300046559 Bacteria 3091
329 Ga0495668_0043262 3300046616 Bacteria 2505
330 Ga0495634_0004868 3300046642 Bacteria 10402
331 Ga0495611_0021261 3300046648 Bacteria 2801
332 Ga0495625_0018312 3300046660 Bacteria 5470
333 Ga0495625_0374971 3300046660 Bacteria 894
334 Ga0495635_0065584 3300046663 Bacteria 2491
335 Ga0495661_0020531 3300046665 Bacteria 4311
336 Ga0495588_0055234 3300046674 Bacteria 2049
337 Ga0495657_0008642 3300046675 Bacteria 7771
338 Ga0495657_0012807 3300046675 Bacteria 6217
339 Ga0495657_0073405 3300046675 Bacteria 2228
340 Ga0495657_0159645 3300046675 Bacteria 1395
341 Ga0495646_0007018 3300046680 Bacteria 7151
342 Ga0495646_0055259 3300046680 Bacteria 2385
343 Ga0495647_0442153 3300046681 Bacteria 601
344 Ga0495658_0122011 3300046683 Bacteria 1577
345 Ga0495613_0005389 3300046689 Bacteria 9611
346 Ga0495613_0031880 3300046689 Bacteria 3914
347 Ga0495613_0083971 3300046689 Bacteria 2312
348 Ga0495613_0143608 3300046689 Bacteria 1704
349 Ga0495613_0664808 3300046689 Bacteria 688
350 Ga0495624_0075987 3300046690 Bacteria 2085
351 Ga0495624_0465123 3300046690 Bacteria 757
352 Ga0495670_0043029 3300046691 Bacteria 2254
353 Ga0495671_0214635 3300046692 Bacteria 932
354 Ga0495649_0005350 3300046694 Bacteria 8188
355 Ga0495649_0063767 3300046694 Bacteria 1979
356 Ga0495589_0051764 3300046794 Bacteria 2029
357 Ga0495589_0152628 3300046794 Bacteria 1102
358 Ga0495600_0088016 3300046809 Bacteria 2026
359 Ga0495600_0264405 3300046809 Bacteria 1092
360 Ga0495660_0082256 3300046810 Bacteria 1686
361 Ga0495660_0138296 3300046810 Bacteria 1214
362 Ga0495581_0000976 3300047315 Bacteria 15368
363 Ga0495604_0001024 3300047317 Bacteria 23293
364 Ga0495604_0135586 3300047317 Bacteria 1764
365 Ga0495636_0003680 3300047318 Bacteria 5960
366 Ga0495636_0008880 3300047318 Bacteria 3958
367 Ga0495636_0211939 3300047318 Bacteria 887
368 Ga0495674_0582026 3300047319 Bacteria 888
369 Ga0495676_0008946 3300047321 Bacteria 9145
370 Ga0495676_0090397 3300047321 Bacteria 2291
371 Ga0495676_0126487 3300047321 Bacteria 1851
372 Ga0495680_0018130 3300047322 Bacteria 5986
373 Ga0495683_0007305 3300047323 Bacteria 5985
374 Ga0495687_005717 3300047443 Bacteria 7835
375 Ga0495687_028811 3300047443 Bacteria 2577
376 Ga0495687_067298 3300047443 Bacteria 1450
377 Ga0495687_101215 3300047443 Bacteria 1080
378 Ga0495687_128027 3300047443 Bacteria 904
379 Ga0495687_133767 3300047443 Bacteria 873
380 Ga0495675_0006435 3300047444 Bacteria 7191
381 Ga0495675_0049657 3300047444 Bacteria 2666
382 Ga0495675_0065594 3300047444 Bacteria 2296
383 Ga0495685_007513 3300047447 Bacteria 3601
384 Ga0495685_029520 3300047447 Bacteria 1885
385 Ga0495685_037857 3300047447 Bacteria 1653
386 Ga0495681_0006829 3300047470 Bacteria 7417
387 Ga0495681_0330350 3300047470 Bacteria 584
388 Ga0495684_0186819 3300047471 Bacteria 1534
389 Ga0495684_0393378 3300047471 Bacteria 975
390 Ga0495593_0016328 3300047673 Bacteria 4189
391 Ga0495593_0265077 3300047673 Bacteria 860
392 Ga0495602_0236162 3300048088 Bacteria 1370
393 Ga0495614_0019517 3300048089 Bacteria 2933
394 Ga0495614_0035699 3300048089 Bacteria 2135
395 Ga0495614_0045581 3300048089 Bacteria 1880
396 Ga0495614_0471346 3300048089 Bacteria 595
397 Ga0495614_0521800 3300048089 Bacteria 566
398 Ga0496100_1235153 3300048903 Bacteria 590
399 Ga0496101_1514769 3300048904 Bacteria 522
400 Ga0496104_0604090 3300048907 Bacteria 1007
401 Ga0496105_1332887 3300048908 Bacteria 523
402 Ga0496109_0112376 3300048912 Bacteria 2533
403 Ga0496112_0681739 3300048915 Bacteria 956
404 Ga0496114_0556447 3300048917 Bacteria 1013
405 Ga0496118_0047290 3300048921 Bacteria 3336
406 Ga0496119_0116185 3300048922 Bacteria 1477
407 Ga0496122_0020778 3300048925 Bacteria 5910
408 Ga0496122_0127534 3300048925 Bacteria 1625
409 Ga0496124_0149561 3300048927 Bacteria 1834
410 Ga0496125_0025021 3300048928 Bacteria 5477
411 Ga0496125_0031052 3300048928 Bacteria 4768
412 Ga0496125_0157210 3300048928 Bacteria 1551
413 Ga0496126_0362045 3300048929 Bacteria 1184
414 Ga0496126_0396674 3300048929 Bacteria 1120
415 Ga0495678_028122 3300049459 Bacteria 2377
416 Ga0495682_0131267 3300049460 Bacteria 896
417 Ga0501031_0009379 3300049568 Bacteria 6361
418 Ga0501032_0029431 3300049569 Bacteria 3768
419 Ga0501033_0048695 3300049570 Bacteria 3147
420 Ga0501033_0122435 3300049570 Bacteria 1887
421 Ga0501033_0129794 3300049570 Bacteria 1826
422 Ga0501034_0007129 3300049571 Bacteria 11925
423 Ga0501034_0014805 3300049571 Bacteria 8023
424 Ga0501034_0493744 3300049571 Bacteria 1138
425 Ga0501036_0016039 3300049572 Bacteria 6260
426 Ga0501037_0008113 3300049573 Bacteria 7696
427 Ga0501037_0213625 3300049573 Bacteria 1359
428 Ga0501038_0063692 3300049574 Bacteria 3146
429 Ga0501038_0100877 3300049574 Bacteria 2404
430 Ga0501039_0409941 3300049575 Bacteria 1064
431 Ga0501040_1294856 3300049576 Bacteria 529
432 Ga0501042_0009330 3300049578 Bacteria 6535
433 Ga0501043_0010560 3300049579 Bacteria 7229
434 Ga0501043_0467593 3300049579 Bacteria 945
435 Ga0501046_0025615 3300049580 Bacteria 4826
436 Ga0501047_0031184 3300049581 Bacteria 5141
437 Ga0501047_0033750 3300049581 Bacteria 4939
438 Ga0501047_0041310 3300049581 Bacteria 4456
439 Ga0501048_0007120 3300049582 Bacteria 8499
440 Ga0501067_0003764 3300049583 Bacteria 8361
441 Ga0501067_0003814 3300049583 Bacteria 8315
442 Ga0501068_0015755 3300049584 Bacteria 4348
443 Ga0501069_0130921 3300049585 Bacteria 1436
444 Ga0501070_0004381 3300049586 Bacteria 12130
445 Ga0501071_0003892 3300049587 Bacteria 9409
446 Ga0501072_0006329 3300049588 Bacteria 9016
447 Ga0501072_1122888 3300049588 Bacteria 611
448 Ga0501073_0022783 3300049589 Bacteria 4505
449 Ga0501074_0006620 3300049590 Bacteria 8377
450 Ga0501077_0005823 3300049593 Bacteria 7511
451 Ga0501080_0002728 3300049742 Bacteria 15489
452 Ga0501080_0015390 3300049742 Bacteria 7051
453 Ga0501083_0491233 3300049744 Bacteria 799
454 Ga0501035_0015499 3300049822 Bacteria 7031
455 Ga0501035_0204711 3300049822 Bacteria 1691
456 Ga0501035_0408122 3300049822 Bacteria 1129
457 Ga0501044_0001986 3300049823 Bacteria 23638
458 Ga0501044_0166072 3300049823 Bacteria 2181
459 Ga0501044_0457034 3300049823 Bacteria 1183
460 Ga0501045_0113435 3300049824 Bacteria 2010
461 nmdc:mga03n38_153182_c1 3300050490 Bacteria 1161
462 nmdc:mga03n38_275020_c1 3300050490 Bacteria 897
463 nmdc:mga00v17_125839_c1 3300050491 Bacteria 1635
464 nmdc:mga00v17_12672_c1 3300050491 Bacteria 4657
465 nmdc:mga00v17_265220_c1 3300050491 Bacteria 1114
466 nmdc:mga05p37_286456_c1 3300050507 Bacteria 1962
467 nmdc:mga09592_379367_c1 3300050508 Bacteria 1222
468 nmdc:mga0qj67_1117742_c1 3300050509 Bacteria 615
469 nmdc:mga06r32_15284_c1 3300050510 Bacteria 6973
470 nmdc:mga06r32_686295_c1 3300050510 Bacteria 990
471 nmdc:mga08y16_144036_c1 3300050511 Bacteria 2477
472 Ga0495655_0239722 3300053083 Bacteria 606
473 Ga0500646_0001054 3300053090 Bacteria 7529
474 Ga0500583_0015322 3300053092 Bacteria 3029
475 Ga0500640_013687 3300053095 Bacteria 3362
476 Ga0500650_0197897 3300053098 Bacteria 916
477 Ga0500572_005281 3300053111 Bacteria 2924
478 Ga0500582_209130 3300053114 Bacteria 651
479 Ga0500608_259497 3300053122 Bacteria 672
480 Ga0500617_135047 3300053124 Bacteria 998
481 Ga0500642_0252924 3300053130 Bacteria 809
482 Ga0500573_0181729 3300053140 Bacteria 1130
483 Ga0500573_0381406 3300053140 Bacteria 674
484 Ga0500588_0000466 3300053146 Bacteria 6407
485 Ga0500600_0196792 3300053149 Bacteria 953
486 Ga0500624_064354 3300053157 Bacteria 707
487 Ga0500634_0232742 3300053161 Bacteria 780
488 Ga0500637_0215841 3300053178 Bacteria 1087
489 Ga0501082_0018399 3300060353 Bacteria 6017
490 Ga0466962_0012627 3300061719 Bacteria 4064
491 Ga0466962_0093149 3300061719 Bacteria 1444
492 Ga0466962_0518614 3300061719 Bacteria 604
493 2585311168 2582581313 Bacteria 10042643
494 2585318584 2582581314 Bacteria 11452267
495 2616697191 2616644814 Bacteria 11555299
496 2643785673 2643221553 Bacteria 3544260
497 2644265915 2643221647 Bacteria 10741251
498 2644680074 2643221724 Bacteria 3593515
499 2730229572 2728369380 Bacteria 3620317
500 2747953607 2747842429 Bacteria 3914386
501 2785341313 2784746763 Bacteria 9783172
502 2786672564 2786546132 Bacteria 10419719
503 2793979796 2791355406 Bacteria 11364898
504 2852665192 2852663356 Bacteria 4090475
505 2857723720 2857723135 Bacteria 4217853
506 2862392431 2862382967 Bacteria 10317375
507 2863408498 2863404153 Bacteria 9672205
508 2867431457 2867428634 Bacteria 9590268
509 2946077632 2946072368 Bacteria 8999607
510 2946081025 2946080515 Bacteria 4310960
511 2954384112 2954380949 Bacteria 10050426
512 2954678839 2954673503 Bacteria 9685905
513 2954685313 2954682443 Bacteria 9862841
514 2954694932 2954691527 Bacteria 10720516
515 2954710109 2954701450 Bacteria 10834262
516 2990064030 2990059506 Bacteria 9321252
517 8001783165 8001781756 Bacteria 9586736
518 8008562669 8008558824 Bacteria 10610750
519 8008577275 8008574985 Bacteria 7815457
520 8047901130 8047893842 Bacteria 11723082
521 8048357771 8048356638 Bacteria 11044339
522 8048378069 8048369669 Bacteria 11666822
523 8048387167 8048379754 Bacteria 11877923
524 8048406573 8048406513 Bacteria 8936924
525 8056832036 8056829672 Bacteria 9045328
526 Ga0439436_0012720
527 JGI24740J21852_10069940
528 JGI24735J21928_10161993
529 Ga0070676_10255292
530 Ga0070683_100029461
531 Ga0070680_101737695
532 Ga0068868_100051495
533 Ga0070660_100503138
534 Ga0070660_101193599
535 Ga0070689_100407718
536 Ga0070687_100273182
537 Ga0070661_100057066
538 Ga0070675_100019089
539 Ga0070671_101930944
540 Ga0070673_100367474
541 Ga0070659_100174819
542 Ga0070700_100042813
543 Ga0070663_100034582
544 Ga0070663_100589991
545 Ga0070662_100382144
546 Ga0070681_10131024
547 Ga0070706_100132127
548 Ga0070707_100017988
549 Ga0070679_100007161
550 Ga0070679_101003961
551 Ga0070684_100125368
552 Ga0070684_100209502
553 Ga0070693_100504494
554 Ga0070664_100044791
555 Ga0068857_100287889
556 Ga0068857_100789991
557 Ga0068856_101227866
558 Ga0070702_100261333
559 Ga0068852_100927933
560 Ga0068859_100533995
561 Ga0068859_102060442
562 Ga0068864_100201807
563 Ga0068861_100021568
564 Ga0068851_10623330
565 Ga0068863_100230543
566 Ga0068858_100747674
567 Ga0068860_101546445
568 Ga0068862_100371228
569 Ga0068862_101284389
570 Ga0081540_1130808
571 Ga0081539_10006015
572 Ga0081539_10074396
573 Ga0081539_10157470
574 Ga0075364_10014656
575 Ga0075370_10037119
576 Ga0068871_100363780
577 Ga0075428_100423225
578 Ga0075428_100466052
579 Ga0075430_100873367
580 Ga0075431_100019413
581 Ga0075431_101730200
582 Ga0075433_10669072
583 Ga0075429_100074426
584 Ga0068865_101349593
585 Ga0097620_100533971
586 Ga0097620_102061035
587 Ga0097620_103053150
588 Ga0111539_10002270
589 Ga0111539_10514385
590 Ga0105245_10053874
591 Ga0114129_10093588
592 Ga0114129_11942308
593 Ga0105243_10196728
594 Ga0105243_10321098
595 Ga0105241_10205492
596 Ga0105238_10237870
597 Ga0105238_10365827
598 Ga0105249_10106010
599 Ga0105249_10866656
600 Ga0105239_10415457
601 Ga0105246_10415650
602 Ga0157370_10365650
603 Ga0157372_11493159
604 Ga0157375_10418783
605 Ga0163163_10653107
606 Ga0163163_10664145
607 Ga0182008_10414212
608 Ga0157377_10117824
609 Ga0157377_10296565
610 Ga0157379_10321360
611 Ga0157376_10300628
612 Ga0206352_11080364
613 Ga0206353_11805816
614 Ga0213876_10378163
615 Ga0209646_1000099
616 Ga0207688_10023927
617 Ga0207680_10181052
618 Ga0207647_10007073
619 Ga0207647_10261572
620 Ga0207645_10101986
621 Ga0207643_10515831
622 Ga0207684_10043755
623 Ga0207707_10100555
624 Ga0207660_10094229
625 Ga0207662_10219964
626 Ga0207657_10324035
627 Ga0207657_10351627
628 Ga0207649_10038330
629 Ga0207652_10087911
630 Ga0207646_10246544
631 Ga0207694_10545534
632 Ga0207659_10040662
633 Ga0207687_10016773
634 Ga0207690_10098822
635 Ga0207706_10073857
636 Ga0207709_10798270
637 Ga0207670_10321266
638 Ga0207670_10892752
639 Ga0207704_10434713
640 Ga0207691_10163635
641 Ga0207661_10036564
642 Ga0207661_10038375
643 Ga0207661_11088523
644 Ga0207679_10103463
645 Ga0207679_11238270
646 Ga0207651_10370355
647 Ga0207712_10096131
648 Ga0207712_10489427
649 Ga0207640_11415866
650 Ga0207677_10029450
651 Ga0207639_10198955
652 Ga0207639_10674299
653 Ga0207678_10018587
654 Ga0207708_10036012
655 Ga0207708_10130014
656 Ga0207702_11277577
657 Ga0207641_11061619
658 Ga0207676_10498720
659 Ga0207676_10933438
660 Ga0207674_10095713
661 Ga0207674_10200086
662 Ga0207674_10321368
663 Ga0207675_100033298
664 Ga0207698_10976938
665 Ga0268266_10718155
666 Ga0268266_11395690
667 Ga0268264_10270352
668 Ga0307515_10000699
669 Ga0307515_10156887
670 Ga0307515_10311793
671 Ga0307511_10008891
672 Ga0307511_10046630
673 Ga0307512_10015780
674 Ga0307513_10122970
675 Ga0307513_10159127
676 Ga0307509_10003540
677 Ga0307509_10010674
678 Ga0307509_10030385
679 Ga0307408_100383955
680 Ga0307514_10067732
681 Ga0307516_10188947
682 Ga0307516_10295268
683 Ga0307405_10011044
684 Ga0307518_10095365
685 Ga0307410_10011418
686 Ga0307406_10005802
687 Ga0307406_10032792
688 Ga0307406_10302696
689 Ga0307407_10017856
690 Ga0307412_10295400
691 Ga0307409_100000245
692 Ga0307409_100305295
693 Ga0307416_100001142
694 Ga0307416_100168611
695 Ga0307416_100241479
696 Ga0307416_100291105
697 Ga0307414_10067906
698 Ga0307411_10011024
699 Ga0307415_100000249
700 Ga0307415_100032103
701 Ga0307507_10000158
702 Ga0307507_10018115
703 Ga0307507_10084844
704 Ga0307510_10006521
705 Ga0395898_0008287
706 Ga0395898_0023073
707 Ga0395905_0392141
708 Ga0395901_0048379
709 Ga0395901_1442093
710 Ga0436365_0910771
711 Ga0451791_0070963
712 Ga0451802_0418231
713 Ga0451833_0250567
714 Ga0451833_1482948
715 Ga0451845_0101425
716 Ga0451853_0186987
717 Ga0451853_0512021
718 Ga0451853_1415845
719 Ga0439448_0005562
720 Ga0439449_0010050
721 Ga0439449_0089808
722 Ga0439450_125550
723 Ga0439455_0000964
724 Ga0439457_000032
725 Ga0439457_026832
726 Ga0450920_022721
727 Ga0450897_000298
728 Ga0450894_000627
729 Ga0450895_007404
730 Ga0450896_001635
731 Ga0450898_005635
732 Ga0450899_000887
733 Ga0450903_000297
734 Ga0450905_048676
735 Ga0450906_000533
736 Ga0439458_0007098
737 Ga0450908_005153
738 Ga0439459_0006038
739 Ga0439460_0107592
740 Ga0439440_0005862
741 Ga0466969_0011022
742 Ga0466969_0034989
743 Ga0466969_0044782
744 Ga0466972_0010894
745 Ga0466972_0040706
746 Ga0466972_0068246
747 Ga0466972_0122597
748 Ga0466966_0028271
749 Ga0466966_0051198
750 Ga0466966_0177090
751 Ga0466966_0663306
752 Ga0466961_0038149
753 Ga0466961_0143432
754 Ga0466961_0161074
755 Ga0466963_0000748
756 Ga0466963_0016667
757 Ga0466963_0236845
758 Ga0466963_0810910
759 Ga0466963_1339027
760 Ga0466964_0009725
761 Ga0466971_0034711
762 Ga0466971_0127168
763 Ga0466971_0325318
764 Ga0466968_0058288
765 Ga0466968_0114620
766 Ga0466970_0103200
767 Ga0466970_0216123
768 Ga0466970_0313802
769 Ga0466960_0002701
770 Ga0466960_0006600
771 Ga0466959_0147242
772 Ga0466959_0332999
773 Ga0466959_0333349
774 Ga0466958_0182421
775 Ga0466967_0008283
776 Ga0466967_0093925
777 Ga0466967_0213738
778 Ga0466967_0270433
779 Ga0495617_002783
780 Ga0495627_000357
781 Ga0495627_007980
782 Ga0495592_0006761
783 Ga0495592_0278564
784 Ga0495603_0006752
785 Ga0495603_0018930
786 Ga0495603_0032858
787 Ga0495603_0736471
788 Ga0495590_0014638
789 Ga0495629_0004249
790 Ga0495629_0033796
791 Ga0495629_0054919
792 Ga0495629_0078336
793 Ga0495629_0107463
794 Ga0495629_0806199
795 Ga0495638_0093298
796 Ga0495638_0315379
797 Ga0495641_0074098
798 Ga0495641_0322868
799 Ga0495651_0080101
800 Ga0495651_0135365
801 Ga0495582_0030113
802 Ga0495582_0139933
803 Ga0495605_0002404
804 Ga0495605_0165873
805 Ga0495639_0082833
806 Ga0495662_0008557
807 Ga0495662_0012154
808 Ga0495662_0014290
809 Ga0495662_0076250
810 Ga0495662_0158612
811 Ga0495664_0000253
812 Ga0495664_0067711
813 Ga0495584_0091370
814 Ga0495584_0712070
815 Ga0495585_0014133
816 Ga0495585_0157030
817 Ga0495594_0027382
818 Ga0495594_0052117
819 Ga0495594_0077447
820 Ga0495594_0111114
821 Ga0495594_0169239
822 Ga0495596_0109389
823 Ga0495607_0068257
824 Ga0495606_0016761
825 Ga0495608_0032219
826 Ga0495616_0050844
827 Ga0495618_0018393
828 Ga0495618_0150150
829 Ga0495620_0013025
830 Ga0495620_0056446
831 Ga0495628_0033429
832 Ga0495628_0061453
833 Ga0495630_0108128
834 Ga0495630_0176120
835 Ga0495631_0006400
836 Ga0495632_0444599
837 Ga0495643_0006859
838 Ga0495643_0163466
839 Ga0495648_0065806
840 Ga0495666_0030365
841 Ga0495666_0192828
842 Ga0495642_0156041
843 Ga0495652_0106074
844 Ga0495652_0321144
845 Ga0495654_0031215
846 Ga0495640_0017254
847 Ga0495587_0003015
848 Ga0495587_0330606
849 Ga0495597_0041813
850 Ga0495597_0106186
851 Ga0495622_0013626
852 Ga0495622_0051435
853 Ga0495667_0040552
854 Ga0495668_0043262
855 Ga0495634_0004868
856 Ga0495611_0021261
857 Ga0495625_0018312
858 Ga0495625_0374971
859 Ga0495635_0065584
860 Ga0495661_0020531
861 Ga0495588_0055234
862 Ga0495657_0008642
863 Ga0495657_0012807
864 Ga0495657_0073405
865 Ga0495657_0159645
866 Ga0495646_0007018
867 Ga0495646_0055259
868 Ga0495647_0442153
869 Ga0495658_0122011
870 Ga0495613_0005389
871 Ga0495613_0031880
872 Ga0495613_0083971
873 Ga0495613_0143608
874 Ga0495613_0664808
875 Ga0495624_0075987
876 Ga0495624_0465123
877 Ga0495670_0043029
878 Ga0495671_0214635
879 Ga0495649_0005350
880 Ga0495649_0063767
881 Ga0495589_0051764
882 Ga0495589_0152628
883 Ga0495600_0088016
884 Ga0495600_0264405
885 Ga0495660_0082256
886 Ga0495660_0138296
887 Ga0495581_0000976
888 Ga0495604_0001024
889 Ga0495604_0135586
890 Ga0495636_0003680
891 Ga0495636_0008880
892 Ga0495636_0211939
893 Ga0495674_0582026
894 Ga0495676_0008946
895 Ga0495676_0090397
896 Ga0495676_0126487
897 Ga0495680_0018130
898 Ga0495683_0007305
899 Ga0495687_005717
900 Ga0495687_028811
901 Ga0495687_067298
902 Ga0495687_101215
903 Ga0495687_128027
904 Ga0495687_133767
905 Ga0495675_0006435
906 Ga0495675_0049657
907 Ga0495675_0065594
908 Ga0495685_007513
909 Ga0495685_029520
910 Ga0495685_037857
911 Ga0495681_0006829
912 Ga0495681_0330350
913 Ga0495684_0186819
914 Ga0495684_0393378
915 Ga0495593_0016328
916 Ga0495593_0265077
917 Ga0495602_0236162
918 Ga0495614_0019517
919 Ga0495614_0035699
920 Ga0495614_0045581
921 Ga0495614_0471346
922 Ga0495614_0521800
923 Ga0496100_1235153
924 Ga0496101_1514769
925 Ga0496104_0604090
926 Ga0496105_1332887
927 Ga0496109_0112376
928 Ga0496112_0681739
929 Ga0496114_0556447
930 Ga0496118_0047290
931 Ga0496119_0116185
932 Ga0496122_0020778
933 Ga0496122_0127534
934 Ga0496124_0149561
935 Ga0496125_0025021
936 Ga0496125_0031052
937 Ga0496125_0157210
938 Ga0496126_0362045
939 Ga0496126_0396674
940 Ga0495678_028122
941 Ga0495682_0131267
942 Ga0501031_0009379
943 Ga0501032_0029431
944 Ga0501033_0048695
945 Ga0501033_0122435
946 Ga0501033_0129794
947 Ga0501034_0007129
948 Ga0501034_0014805
949 Ga0501034_0493744
950 Ga0501036_0016039
951 Ga0501037_0008113
952 Ga0501037_0213625
953 Ga0501038_0063692
954 Ga0501038_0100877
955 Ga0501039_0409941
956 Ga0501040_1294856
957 Ga0501042_0009330
958 Ga0501043_0010560
959 Ga0501043_0467593
960 Ga0501046_0025615
961 Ga0501047_0031184
962 Ga0501047_0033750
963 Ga0501047_0041310
964 Ga0501048_0007120
965 Ga0501067_0003764
966 Ga0501067_0003814
967 Ga0501068_0015755
968 Ga0501069_0130921
969 Ga0501070_0004381
970 Ga0501071_0003892
971 Ga0501072_0006329
972 Ga0501072_1122888
973 Ga0501073_0022783
974 Ga0501074_0006620
975 Ga0501077_0005823
976 Ga0501080_0002728
977 Ga0501080_0015390
978 Ga0501083_0491233
979 Ga0501035_0015499
980 Ga0501035_0204711
981 Ga0501035_0408122
982 Ga0501044_0001986
983 Ga0501044_0166072
984 Ga0501044_0457034
985 Ga0501045_0113435
986 nmdc:mga03n38_153182_c1
987 nmdc:mga03n38_275020_c1
988 nmdc:mga00v17_125839_c1
989 nmdc:mga00v17_12672_c1
990 nmdc:mga00v17_265220_c1
991 nmdc:mga05p37_286456_c1
992 nmdc:mga09592_379367_c1
993 nmdc:mga0qj67_1117742_c1
994 nmdc:mga06r32_15284_c1
995 nmdc:mga06r32_686295_c1
996 nmdc:mga08y16_144036_c1
997 Ga0495655_0239722
998 Ga0500646_0001054
999 Ga0500583_0015322
1000 Ga0500640_013687
1001 Ga0500650_0197897
1002 Ga0500572_005281
1003 Ga0500582_209130
1004 Ga0500608_259497
1005 Ga0500617_135047
1006 Ga0500642_0252924
1007 Ga0500573_0181729
1008 Ga0500573_0381406
1009 Ga0500588_0000466
1010 Ga0500600_0196792
1011 Ga0500624_064354
1012 Ga0500634_0232742
1013 Ga0500637_0215841
1014 Ga0501082_0018399
1015 Ga0466962_0012627
1016 Ga0466962_0093149
1017 Ga0466962_0518614
1018 2585311168
1019 2585318584
1020 2616697191
1021 2643785673
1022 2644265915
1023 2644680074
1024 2730229572
1025 2747953607
1026 2785341313
1027 2786672564
1028 2793979796
1029 2852665192
1030 2857723720
1031 2862392431
1032 2863408498
1033 2867431457
1034 2946077632
1035 2946081025
1036 2954384112
1037 2954678839
1038 2954685313
1039 2954694932
1040 2954710109
1041 2990064030
1042 8001783165
1043 8008562669
1044 8008577275
1045 8047901130
1046 8048357771
1047 8048378069
1048 8048387167
1049 8048406573
1050 8056832036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

140

0.82

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

130

0.82

PF18029

Glyoxalase_6

Glyoxalase-like domain

15

141

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8784 4 138
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8753 5 137
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8722 4 138
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8702 4 136
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8522 4 136
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9304 86 135 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8983 86 139 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8623 86 135 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8577 86 137 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8553 86 139 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A317LTC7-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9878 4 139
AF-A0A7K1VBZ2-F1-model_v4 VOC family protein 0.9874 4 139
AF-A0A7W8K1Q2-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9853 4 139
AF-A0A6N7CPF6-F1-model_v4 VOC domain-containing protein 0.9851 2 139
AF-A0A6I5X500-F1-model_v4 VOC family protein 0.9836 4 138

Map