F459296

General Info

Members Datasets Scaffolds Average Seq Length
525 290 522 233

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0173230|Ga0373956_0173230_179_988
Length 269
Sequence MRPSGNKSWFGGLAEPGTQNSRCYLRVPSCPLWLNKIMKFGVIVFPGSNCDQDSYNAAIAATGQQATMLWHESHDLENCDAIILPGGFAYGDYLRTGAIAKFAPIMDQVRKFAASGGLVIGICNGFQILCESGLLPGALLRNAGLKYVCKFVDLRVENAETPFTNACKKGEVLRIPIGHMEGNYYCDAQTLETLKRQNRVVFRYSTPEGEITPQANPNGSLDNIAGICNEGSNVLGMMPHPDRCSESLLGSSDGAKIFRSMITAPVSAR

Samples

Sample ID Description Type Environment
1 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
2 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
180 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
181 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
182 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
267 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.38
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 5.52
Rhizosphere 91.05
Stem 0
Stem Tuber 0.19
Unclassified 1.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1008414 3300001976 Bacteria 1344
2 JGI24033J26618_1007566 3300002155 Bacteria 1237
3 JGI24751J29686_10000209 3300002459 Bacteria 25027
4 Ga0065707_10085551 3300005295 Bacteria 6060
5 Ga0070683_100187857 3300005329 Bacteria 1961
6 Ga0070670_100098510 3300005331 Bacteria 2516
7 Ga0068868_100004173 3300005338 Bacteria 10102
8 Ga0068868_100017016 3300005338 Bacteria 5410
9 Ga0070661_100196749 3300005344 Bacteria 1539
10 Ga0070668_100234555 3300005347 Bacteria 1518
11 Ga0070669_100497831 3300005353 Bacteria 1010
12 Ga0070675_100041083 3300005354 Bacteria 3777
13 Ga0070675_100071595 3300005354 Bacteria 2876
14 Ga0070675_100105087 3300005354 Bacteria 2383
15 Ga0070671_100341501 3300005355 Unclassified 1277
16 Ga0070674_100010172 3300005356 Bacteria 5668
17 Ga0070709_10014150 3300005434 Bacteria 4507
18 Ga0070709_10232158 3300005434 Bacteria 1321
19 Ga0070714_100793981 3300005435 Bacteria 916
20 Ga0070713_100000116 3300005436 Bacteria 52486
21 Ga0070713_100053410 3300005436 Bacteria 3348
22 Ga0070713_100055375 3300005436 Bacteria 3295
23 Ga0070713_100137979 3300005436 Bacteria 2157
24 Ga0070710_10174750 3300005437 Bacteria 1341
25 Ga0070710_10217427 3300005437 Unclassified 1214
26 Ga0070711_100046114 3300005439 Bacteria 2968
27 Ga0070711_100100225 3300005439 Bacteria 2106
28 Ga0070711_100260339 3300005439 Bacteria 1364
29 Ga0070694_100083313 3300005444 Bacteria 2228
30 Ga0070694_100291469 3300005444 Bacteria 1248
31 Ga0070678_100557932 3300005456 Bacteria 1017
32 Ga0070681_10000371 3300005458 Bacteria 36201
33 Ga0070707_100392557 3300005468 Bacteria 1348
34 Ga0070707_100764235 3300005468 Bacteria 930
35 Ga0070698_100028555 3300005471 Bacteria 5794
36 Ga0070698_100090376 3300005471 Bacteria 3045
37 Ga0070699_100006304 3300005518 Bacteria 10348
38 Ga0070699_100179272 3300005518 Bacteria 1880
39 Ga0070699_100226722 3300005518 Bacteria 1666
40 Ga0070699_100423537 3300005518 Bacteria 1205
41 Ga0070679_100006254 3300005530 Bacteria 11092
42 Ga0070679_100256813 3300005530 Bacteria 1703
43 Ga0070684_100009949 3300005535 Bacteria 7518
44 Ga0068853_100038001 3300005539 Unclassified 4099
45 Ga0068853_100039687 3300005539 Bacteria 4016
46 Ga0070693_100131765 3300005547 Bacteria 1564
47 Ga0070704_100029806 3300005549 Bacteria 3648
48 Ga0068855_100003285 3300005563 Bacteria 19803
49 Ga0068855_100036457 3300005563 Bacteria 5853
50 Ga0068855_100110370 3300005563 Bacteria 3158
51 Ga0070664_100006163 3300005564 Bacteria 9694
52 Ga0068857_100013481 3300005577 Bacteria 7120
53 Ga0068857_100028649 3300005577 Bacteria 4914
54 Ga0068857_100134413 3300005577 Bacteria 2233
55 Ga0068857_100237851 3300005577 Bacteria 1667
56 Ga0068857_100498834 3300005577 Bacteria 1142
57 Ga0068854_100471568 3300005578 Bacteria 1052
58 Ga0068856_100002080 3300005614 Bacteria 20768
59 Ga0068856_100037096 3300005614 Bacteria 4782
60 Ga0068856_100048047 3300005614 Bacteria 4204
61 Ga0068852_100005551 3300005616 Bacteria 9044
62 Ga0068852_100197331 3300005616 Bacteria 1903
63 Ga0068852_100212606 3300005616 Bacteria 1835
64 Ga0068852_100227765 3300005616 Bacteria 1776
65 Ga0068852_100441956 3300005616 Bacteria 1286
66 Ga0068859_100244865 3300005617 Bacteria 1882
67 Ga0068859_100329999 3300005617 Bacteria 1620
68 Ga0068859_100352799 3300005617 Bacteria 1566
69 Ga0068864_100091495 3300005618 Bacteria 2684
70 Ga0068861_100051372 3300005719 Bacteria 3129
71 Ga0068870_10001383 3300005840 Bacteria 9801
72 Ga0068863_100004403 3300005841 Bacteria 13889
73 Ga0068863_100164256 3300005841 Bacteria 2128
74 Ga0068860_100029437 3300005843 Bacteria 5282
75 Ga0068862_100641026 3300005844 Bacteria 1024
76 Ga0081455_10000290 3300005937 Bacteria 66541
77 Ga0081455_10002415 3300005937 Bacteria 22283
78 Ga0081455_10022753 3300005937 Bacteria 5848
79 Ga0081455_10049242 3300005937 Bacteria 3633
80 Ga0081455_10065648 3300005937 Bacteria 3034
81 Ga0081455_10178370 3300005937 Bacteria 1611
82 Ga0070717_10232941 3300006028 Bacteria 1622
83 Ga0070717_10456805 3300006028 Bacteria 1152
84 Ga0070717_10795045 3300006028 Bacteria 860
85 Ga0075368_10175990 3300006042 Bacteria 900
86 Ga0075432_10006368 3300006058 Bacteria 4015
87 Ga0075432_10033291 3300006058 Bacteria 1787
88 Ga0070715_10092196 3300006163 Bacteria 1397
89 Ga0070716_100070734 3300006173 Bacteria 2049
90 Ga0070712_100000641 3300006175 Bacteria 20568
91 Ga0070712_100007262 3300006175 Bacteria 6914
92 Ga0070712_100009429 3300006175 Bacteria 6152
93 Ga0070712_100076981 3300006175 Bacteria 2403
94 Ga0070712_100254668 3300006175 Bacteria 1404
95 Ga0070712_100658145 3300006175 Bacteria 890
96 Ga0075367_10110685 3300006178 Bacteria 1685
97 Ga0097621_100001528 3300006237 Bacteria 15851
98 Ga0068871_100001464 3300006358 Bacteria 15819
99 Ga0075428_100054943 3300006844 Bacteria 4364
100 Ga0075428_100066151 3300006844 Bacteria 3958
101 Ga0075428_100535247 3300006844 Bacteria 1253
102 Ga0075430_100004467 3300006846 Bacteria 11799
103 Ga0075430_100096449 3300006846 Bacteria 2471
104 Ga0075431_100013322 3300006847 Bacteria 8311
105 Ga0075431_100227536 3300006847 Bacteria 1901
106 Ga0075431_100288359 3300006847 Bacteria 1661
107 Ga0075431_100311631 3300006847 Bacteria 1588
108 Ga0075433_10001584 3300006852 Bacteria 16851
109 Ga0075434_100033684 3300006871 Bacteria 5057
110 Ga0075434_100083656 3300006871 Bacteria 3189
111 Ga0075434_100133358 3300006871 Bacteria 2503
112 Ga0075434_100441257 3300006871 Unclassified 1323
113 Ga0075429_100002362 3300006880 Bacteria 15885
114 Ga0075429_100047545 3300006880 Bacteria 3732
115 Ga0097620_100244866 3300006931 Bacteria 1882
116 Ga0097620_100329990 3300006931 Bacteria 1620
117 Ga0097620_100352777 3300006931 Bacteria 1566
118 Ga0075435_100011513 3300007076 Bacteria 6513
119 Ga0099794_10000003 3300007265 Bacteria 139452
120 Ga0099795_10184154 3300007788 Bacteria 874
121 Ga0105251_10003774 3300009011 Bacteria 10831
122 Ga0105240_10006657 3300009093 Bacteria 16944
123 Ga0105240_10040333 3300009093 Bacteria 5973
124 Ga0111539_10117596 3300009094 Bacteria 3116
125 Ga0111539_10173194 3300009094 Bacteria 2521
126 Ga0111539_10428613 3300009094 Bacteria 1540
127 Ga0105245_10005428 3300009098 Bacteria 11194
128 Ga0105247_10119639 3300009101 Bacteria 1705
129 Ga0114129_10010988 3300009147 Bacteria 12899
130 Ga0114129_10013855 3300009147 Bacteria 11488
131 Ga0114129_10030492 3300009147 Bacteria 7630
132 Ga0114129_10100978 3300009147 Bacteria 3992
133 Ga0114129_11391275 3300009147 Bacteria 866
134 Ga0114129_11641715 3300009147 Bacteria 786
135 Ga0105243_10005454 3300009148 Bacteria 9925
136 Ga0105243_10315383 3300009148 Bacteria 1423
137 Ga0105241_10204249 3300009174 Bacteria 1652
138 Ga0105241_10347251 3300009174 Bacteria 1287
139 Ga0105248_10231623 3300009177 Bacteria 2079
140 Ga0105248_10240080 3300009177 Bacteria 2040
141 Ga0105237_10000452 3300009545 Bacteria 58208
142 Ga0105238_10002146 3300009551 Bacteria 19942
143 Ga0105238_10078974 3300009551 Bacteria 3281
144 Ga0105238_10108121 3300009551 Bacteria 2762
145 Ga0105249_10047910 3300009553 Bacteria 3896
146 Ga0105249_10409136 3300009553 Bacteria 1388
147 Ga0105249_10572912 3300009553 Bacteria 1181
148 Ga0099796_10054383 3300010159 Bacteria 1399
149 Ga0105239_10405995 3300010375 Bacteria 1542
150 Ga0105246_10154917 3300011119 Bacteria 1739
151 Ga0105246_10500505 3300011119 Bacteria 1032
152 Ga0157369_10000263 3300013105 Bacteria 71082
153 Ga0157369_10015605 3300013105 Bacteria 8560
154 Ga0157369_10021497 3300013105 Bacteria 7217
155 Ga0157369_10622596 3300013105 Bacteria 1114
156 Ga0157369_10882295 3300013105 Bacteria 918
157 Ga0157374_10006682 3300013296 Bacteria 9801
158 Ga0157374_10012721 3300013296 Bacteria 7331
159 Ga0157374_10272742 3300013296 Bacteria 1668
160 Ga0157374_10386302 3300013296 Bacteria 1395
161 Ga0157378_10004559 3300013297 Bacteria 12151
162 Ga0163162_10007586 3300013306 Bacteria 10562
163 Ga0163162_10258288 3300013306 Bacteria 1874
164 Ga0157372_10002714 3300013307 Bacteria 19151
165 Ga0157372_10028171 3300013307 Bacteria 6129
166 Ga0157372_10150080 3300013307 Bacteria 2689
167 Ga0157372_10434751 3300013307 Bacteria 1530
168 Ga0157375_10488650 3300013308 Bacteria 1396
169 Ga0157375_11165927 3300013308 Bacteria 903
170 Ga0163163_10032792 3300014325 Bacteria 5019
171 Ga0163163_10034858 3300014325 Bacteria 4878
172 Ga0163163_10094063 3300014325 Bacteria 3014
173 Ga0163163_10209283 3300014325 Bacteria 1999
174 Ga0157379_10067071 3300014968 Bacteria 3208
175 Ga0157379_10382252 3300014968 Bacteria 1292
176 Ga0206350_11475967 3300020080 Bacteria 1787
177 Ga0206354_10238170 3300020081 Bacteria 3386
178 Ga0213876_10007331 3300021384 Bacteria 6001
179 Ga0213876_10110175 3300021384 Bacteria 1461
180 Ga0207697_10002586 3300025315 Bacteria 9316
181 Ga0207653_10009794 3300025885 Bacteria 2989
182 Ga0207682_10034217 3300025893 Bacteria 2048
183 Ga0207647_10073774 3300025904 Bacteria 2056
184 Ga0207685_10087111 3300025905 Unclassified 1306
185 Ga0207685_10088837 3300025905 Bacteria 1296
186 Ga0207643_10000382 3300025908 Bacteria 29759
187 Ga0207684_10017028 3300025910 Bacteria 6243
188 Ga0207654_10168565 3300025911 Bacteria 1420
189 Ga0207707_10017089 3300025912 Bacteria 6321
190 Ga0207707_10156170 3300025912 Bacteria 1995
191 Ga0207707_10377313 3300025912 Bacteria 1219
192 Ga0207707_10513033 3300025912 Bacteria 1021
193 Ga0207695_10006053 3300025913 Bacteria 15789
194 Ga0207695_10156810 3300025913 Bacteria 2211
195 Ga0207671_10000007 3300025914 Bacteria 825758
196 Ga0207671_10222624 3300025914 Bacteria 1478
197 Ga0207693_10000661 3300025915 Bacteria 30947
198 Ga0207693_10010839 3300025915 Bacteria 7397
199 Ga0207693_10209678 3300025915 Bacteria 1531
200 Ga0207663_10001804 3300025916 Bacteria 10114
201 Ga0207663_10007514 3300025916 Bacteria 5655
202 Ga0207649_10134096 3300025920 Bacteria 1686
203 Ga0207652_10008022 3300025921 Bacteria 8475
204 Ga0207652_10009014 3300025921 Bacteria 8041
205 Ga0207652_10163992 3300025921 Unclassified 1992
206 Ga0207646_10440460 3300025922 Bacteria 1176
207 Ga0207681_10373392 3300025923 Bacteria 1146
208 Ga0207694_10002858 3300025924 Bacteria 13924
209 Ga0207650_10005383 3300025925 Bacteria 8728
210 Ga0207650_10621527 3300025925 Bacteria 909
211 Ga0207659_10056869 3300025926 Bacteria 2803
212 Ga0207659_10117922 3300025926 Bacteria 2029
213 Ga0207659_10297285 3300025926 Bacteria 1325
214 Ga0207687_10001888 3300025927 Bacteria 14430
215 Ga0207687_10070467 3300025927 Bacteria 2496
216 Ga0207700_10000612 3300025928 Bacteria 20890
217 Ga0207700_10055646 3300025928 Bacteria 2974
218 Ga0207700_10112433 3300025928 Bacteria 2194
219 Ga0207700_10156573 3300025928 Bacteria 1888
220 Ga0207664_10159862 3300025929 Bacteria 1921
221 Ga0207664_10473199 3300025929 Bacteria 1120
222 Ga0207664_10535523 3300025929 Bacteria 1050
223 Ga0207664_10661363 3300025929 Bacteria 939
224 Ga0207686_10605168 3300025934 Bacteria 863
225 Ga0207709_10050799 3300025935 Bacteria 2538
226 Ga0207665_10356236 3300025939 Unclassified 1105
227 Ga0207661_10214677 3300025944 Bacteria 1697
228 Ga0207679_10038402 3300025945 Bacteria 3411
229 Ga0207679_10054843 3300025945 Bacteria 2936
230 Ga0207667_10000455 3300025949 Bacteria 54886
231 Ga0207667_10221141 3300025949 Bacteria 1940
232 Ga0207651_10636310 3300025960 Unclassified 935
233 Ga0207712_10241268 3300025961 Bacteria 1456
234 Ga0207668_10627677 3300025972 Bacteria 938
235 Ga0207677_10073074 3300026023 Bacteria 2427
236 Ga0207703_10058843 3300026035 Bacteria 3138
237 Ga0207639_10008564 3300026041 Bacteria 7020
238 Ga0207639_10029273 3300026041 Bacteria 4030
239 Ga0207708_10004753 3300026075 Bacteria 9994
240 Ga0207708_10007042 3300026075 Bacteria 8309
241 Ga0207702_10010164 3300026078 Bacteria 7879
242 Ga0207702_10214758 3300026078 Bacteria 1790
243 Ga0207702_10664826 3300026078 Bacteria 1025
244 Ga0207641_10018393 3300026088 Bacteria 5729
245 Ga0207641_10062083 3300026088 Bacteria 3188
246 Ga0207641_10127989 3300026088 Bacteria 2276
247 Ga0207641_10375316 3300026088 Bacteria 1361
248 Ga0207648_10987782 3300026089 Bacteria 788
249 Ga0207676_10004365 3300026095 Bacteria 10004
250 Ga0207676_10471542 3300026095 Bacteria 1187
251 Ga0207674_10001198 3300026116 Bacteria 33773
252 Ga0207674_10004109 3300026116 Bacteria 17630
253 Ga0207674_10050193 3300026116 Bacteria 4263
254 Ga0207674_10280838 3300026116 Bacteria 1613
255 Ga0207674_10393638 3300026116 Bacteria 1339
256 Ga0207674_11022035 3300026116 Bacteria 796
257 Ga0207675_100015055 3300026118 Bacteria 7217
258 Ga0207675_100188297 3300026118 Bacteria 1978
259 Ga0207698_10025223 3300026142 Bacteria 4184
260 Ga0209588_1000001 3300027671 Bacteria 705877
261 Ga0209966_1012403 3300027695 Bacteria 1565
262 Ga0209813_10074542 3300027866 Bacteria 1110
263 Ga0207428_10011116 3300027907 Bacteria 7993
264 Ga0268265_10294734 3300028380 Bacteria 1458
265 Ga0265338_10000071 3300028800 Bacteria 184107
266 Ga0265328_10016542 3300031239 Bacteria 2867
267 Ga0265331_10038729 3300031250 Bacteria 2328
268 Ga0265327_10000134 3300031251 Bacteria 163243
269 Ga0265316_10198062 3300031344 Bacteria 1490
270 Ga0265342_10181801 3300031712 Bacteria 1151
271 Ga0316576_10028201 3300031727 Bacteria 3955
272 Ga0316577_10255295 3300031733 Bacteria 992
273 Ga0307412_10525921 3300031911 Bacteria 989
274 Ga0307409_101103972 3300031995 Bacteria 814
275 Ga0307416_100025449 3300032002 Bacteria 4338
276 Ga0307416_100406551 3300032002 Bacteria 1401
277 Ga0316580_10027225 3300032139 Bacteria 1768
278 Ga0373926_0009828 3300035083 Bacteria 3199
279 Ga0373929_0015307 3300035085 Bacteria 1490
280 Ga0373934_0227614 3300035086 Bacteria 770
281 Ga0373923_0014313 3300035111 Bacteria 2978
282 Ga0373936_0016739 3300035113 Bacteria 2822
283 Ga0373941_0150624 3300035115 Bacteria 853
284 Ga0373945_0000919 3300035116 Bacteria 8741
285 Ga0373945_0058430 3300035116 Bacteria 1434
286 Ga0373956_0016562 3300035119 Bacteria 3097
287 Ga0373956_0032133 3300035119 Bacteria 2302
288 Ga0373956_0133333 3300035119 Bacteria 1164
289 Ga0373956_0173230 3300035119 Bacteria 1019
290 Ga0373943_0020403 3300035170 Bacteria 3054
291 Ga0373943_0071146 3300035170 Unclassified 1762
292 Ga0373943_0288663 3300035170 Bacteria 929
293 Ga0373946_0015075 3300035171 Bacteria 2924
294 Ga0373946_0056982 3300035171 Bacteria 1652
295 Ga0373942_0148592 3300035207 Bacteria 751
296 Ga0316574_0013156 3300035398 Bacteria 4752
297 Ga0373924_0001292 3300035410 Bacteria 8037
298 Ga0373924_0022855 3300035410 Bacteria 2447
299 Ga0373924_0110452 3300035410 Bacteria 1188
300 Ga0373931_0022022 3300035691 Bacteria 3203
301 Ga0373931_0125223 3300035691 Unclassified 1473
302 Ga0373935_0001019 3300035692 Bacteria 15239
303 Ga0373935_0051288 3300035692 Bacteria 2620
304 Ga0373927_0004708 3300035695 Bacteria 9511
305 Ga0373927_0187319 3300035695 Unclassified 1357
306 Ga0373933_0135218 3300035724 Bacteria 1553
307 Ga0373947_0003790 3300035725 Bacteria 8911
308 Ga0373947_0072667 3300035725 Bacteria 2112
309 Ga0373947_0078422 3300035725 Bacteria 2039
310 Ga0373937_0000199 3300036401 Bacteria 58972
311 Ga0373937_0005842 3300036401 Bacteria 10580
312 Ga0373937_0016183 3300036401 Bacteria 6617
313 Ga0373937_0027663 3300036401 Bacteria 5130
314 Ga0373937_0835702 3300036401 Bacteria 869
315 Ga0316584_0105973 3300036712 Bacteria 2104
316 Ga0373925_0072211 3300037068 Bacteria 2611
317 Ga0373925_0091562 3300037068 Bacteria 2325
318 Ga0373925_0093445 3300037068 Bacteria 2302
319 Ga0373925_0114214 3300037068 Bacteria 2089
320 Ga0395899_0020930 3300037312 Bacteria 4961
321 Ga0395899_0027008 3300037312 Bacteria 4330
322 Ga0395900_0006405 3300037418 Bacteria 12270
323 Ga0395900_0011978 3300037418 Bacteria 8868
324 Ga0395900_0014516 3300037418 Bacteria 8038
325 Ga0395900_0200320 3300037418 Bacteria 2020
326 Ga0395900_0594611 3300037418 Bacteria 1047
327 Ga0395900_0637686 3300037418 Bacteria 1003
328 Ga0395898_0022636 3300037466 Bacteria 6363
329 Ga0395898_0077536 3300037466 Bacteria 3208
330 Ga0395898_0084172 3300037466 Bacteria 3066
331 Ga0395898_0155515 3300037466 Bacteria 2187
332 Ga0395898_0309020 3300037466 Bacteria 1508
333 Ga0395905_0008024 3300037471 Bacteria 10431
334 Ga0395905_0056367 3300037471 Bacteria 3677
335 Ga0395905_0120115 3300037471 Bacteria 2470
336 Ga0395901_0014492 3300038443 Bacteria 8019
337 Ga0395901_0033717 3300038443 Bacteria 5286
338 Ga0395901_0043278 3300038443 Bacteria 4671
339 Ga0395901_0050469 3300038443 Bacteria 4322
340 Ga0395901_0077401 3300038443 Bacteria 3471
341 Ga0395901_0079640 3300038443 Unclassified 3421
342 Ga0395901_0314704 3300038443 Bacteria 1621
343 Ga0395901_0785110 3300038443 Bacteria 943
344 Ga0436365_0078006 3300039437 Bacteria 6382
345 Ga0436365_0181285 3300039437 Bacteria 1444
346 Ga0436365_0224050 3300039437 Bacteria 932
347 Ga0436365_0868921 3300039437 Bacteria 1429
348 Ga0436361_0503757 3300039447 Bacteria 781
349 Ga0451795_0082870 3300041456 Bacteria 1377
350 Ga0451851_1347250 3300041507 Bacteria 1121
351 Ga0439452_031941 3300042010 Bacteria 1289
352 Ga0439454_000318 3300042011 Bacteria 3616
353 Ga0439455_0069589 3300042012 Bacteria 944
354 Ga0439463_034467 3300042016 Bacteria 1281
355 Ga0439434_0067352 3300042435 Bacteria 1124
356 Ga0439435_0011838 3300042436 Bacteria 2100
357 Ga0439464_0047303 3300042439 Bacteria 1238
358 Ga0451577_0059370 3300042876 Bacteria 3410
359 Ga0451577_0273866 3300042876 Bacteria 1529
360 Ga0453684_0000004 3300044712 Bacteria 1469893
361 Ga0466957_0002521 3300044842 Bacteria 9850
362 Ga0466960_0232624 3300044901 Bacteria 1018
363 Ga0466959_0019510 3300045049 Bacteria 4986
364 Ga0451576_0881984 3300045051 Bacteria 939
365 Ga0466967_0049923 3300045976 Bacteria 3662
366 Ga0495617_017146 3300046452 Bacteria 2445
367 Ga0495591_032485 3300046458 Bacteria 1553
368 Ga0495629_0440411 3300046459 Bacteria 883
369 Ga0495629_0475865 3300046459 Bacteria 844
370 Ga0495651_0028096 3300046462 Bacteria 4384
371 Ga0495651_0046066 3300046462 Bacteria 3376
372 Ga0495651_0121246 3300046462 Bacteria 1921
373 Ga0495653_0082652 3300046463 Bacteria 2370
374 Ga0495653_0220556 3300046463 Bacteria 1275
375 Ga0495605_0078196 3300046474 Bacteria 1551
376 Ga0495639_0194307 3300046475 Bacteria 991
377 Ga0495639_0200600 3300046475 Bacteria 976
378 Ga0495584_0164695 3300046491 Bacteria 1127
379 Ga0495584_0177606 3300046491 Unclassified 1082
380 Ga0495585_0018466 3300046492 Bacteria 4021
381 Ga0495594_0143808 3300046499 Bacteria 1353
382 Ga0495594_0174257 3300046499 Bacteria 1224
383 Ga0495607_0038636 3300046501 Bacteria 2858
384 Ga0495607_0119841 3300046501 Bacteria 1383
385 Ga0495583_0143995 3300046506 Bacteria 991
386 Ga0495608_0031745 3300046511 Bacteria 3570
387 Ga0495608_0058395 3300046511 Bacteria 2543
388 Ga0495608_0131137 3300046511 Bacteria 1604
389 Ga0495628_0377393 3300046516 Bacteria 1039
390 Ga0495630_0107656 3300046517 Bacteria 2111
391 Ga0495637_0063722 3300046520 Bacteria 1506
392 Ga0495637_0117803 3300046520 Bacteria 1024
393 Ga0495644_0072105 3300046523 Bacteria 1298
394 Ga0495652_0404450 3300046529 Bacteria 966
395 Ga0495665_0071902 3300046531 Bacteria 1821
396 Ga0495640_0039447 3300046533 Bacteria 3313
397 Ga0495586_0001711 3300046535 Bacteria 11997
398 Ga0495598_0001223 3300046537 Bacteria 4979
399 Ga0495645_0041227 3300046543 Bacteria 3367
400 Ga0495645_0177963 3300046543 Bacteria 1459
401 Ga0495667_0034329 3300046559 Bacteria 3392
402 Ga0495667_0192427 3300046559 Bacteria 1307
403 Ga0495656_0027867 3300046615 Bacteria 2260
404 Ga0495634_0195306 3300046642 Bacteria 1260
405 Ga0495635_0055052 3300046663 Bacteria 2740
406 Ga0495635_0107116 3300046663 Bacteria 1909
407 Ga0495635_0222888 3300046663 Bacteria 1275
408 Ga0495659_0044934 3300046664 Unclassified 1590
409 Ga0495657_0007756 3300046675 Bacteria 8249
410 Ga0495657_0226594 3300046675 Bacteria 1132
411 Ga0495599_0221609 3300046678 Bacteria 1157
412 Ga0495599_0293388 3300046678 Bacteria 983
413 Ga0495623_0028713 3300046679 Bacteria 3579
414 Ga0495623_0045952 3300046679 Bacteria 2772
415 Ga0495623_0080716 3300046679 Bacteria 2013
416 Ga0495647_0091172 3300046681 Bacteria 1250
417 Ga0495647_0244452 3300046681 Bacteria 797
418 Ga0495658_0048767 3300046683 Bacteria 2390
419 Ga0495669_0045362 3300046684 Unclassified 1959
420 Ga0495669_0197574 3300046684 Bacteria 961
421 Ga0495669_0241094 3300046684 Bacteria 868
422 Ga0495613_0019058 3300046689 Bacteria 5114
423 Ga0495670_0134860 3300046691 Bacteria 1288
424 Ga0495670_0237372 3300046691 Bacteria 970
425 Ga0495600_0007112 3300046809 Bacteria 6839
426 Ga0495600_0025623 3300046809 Bacteria 3801
427 Ga0495600_0379494 3300046809 Bacteria 882
428 Ga0495581_0081840 3300047315 Bacteria 1870
429 Ga0495604_0076453 3300047317 Bacteria 2518
430 Ga0495636_0081820 3300047318 Bacteria 1391
431 Ga0495636_0094702 3300047318 Bacteria 1300
432 Ga0495674_0270502 3300047319 Bacteria 1394
433 Ga0495672_0004490 3300047320 Bacteria 11417
434 Ga0495680_0004578 3300047322 Bacteria 13190
435 Ga0495680_0008265 3300047322 Bacteria 9479
436 Ga0495680_0204887 3300047322 Bacteria 1414
437 Ga0495680_0278542 3300047322 Bacteria 1179
438 Ga0495675_0194531 3300047444 Bacteria 1237
439 Ga0495675_0252013 3300047444 Bacteria 1060
440 Ga0495679_058358 3300047446 Bacteria 1139
441 Ga0495684_0043625 3300047471 Bacteria 3434
442 Ga0495684_0083058 3300047471 Bacteria 2430
443 Ga0495602_0039005 3300048088 Bacteria 4381
444 Ga0495614_0082845 3300048089 Bacteria 1391
445 Ga0495614_0181318 3300048089 Bacteria 947
446 Ga0496101_0187678 3300048904 Unclassified 1594
447 Ga0496102_0000813 3300048905 Bacteria 30380
448 Ga0496102_0071795 3300048905 Bacteria 3179
449 Ga0496102_0168354 3300048905 Bacteria 2062
450 Ga0496103_0013082 3300048906 Bacteria 4920
451 Ga0496104_0013919 3300048907 Bacteria 7259
452 Ga0496104_0059539 3300048907 Bacteria 3616
453 Ga0496104_0086206 3300048907 Bacteria 2998
454 Ga0496104_0297262 3300048907 Bacteria 1527
455 Ga0496105_0080340 3300048908 Bacteria 2693
456 Ga0496105_0226578 3300048908 Bacteria 1520
457 Ga0496105_0257510 3300048908 Bacteria 1412
458 Ga0496106_0457575 3300048909 Bacteria 1025
459 Ga0496108_0042797 3300048911 Bacteria 3782
460 Ga0496109_0093182 3300048912 Bacteria 2787
461 Ga0496109_0134323 3300048912 Bacteria 2311
462 Ga0496110_0076288 3300048913 Bacteria 2980
463 Ga0496110_0096635 3300048913 Bacteria 2647
464 Ga0496110_0222307 3300048913 Bacteria 1717
465 Ga0496110_0428585 3300048913 Bacteria 1206
466 Ga0496111_0158747 3300048914 Bacteria 1678
467 Ga0496112_0003286 3300048915 Bacteria 13354
468 Ga0496112_0003994 3300048915 Bacteria 12364
469 Ga0496112_0015370 3300048915 Bacteria 7140
470 Ga0496112_0038195 3300048915 Bacteria 4689
471 Ga0496113_0004383 3300048916 Bacteria 8659
472 Ga0496113_0010830 3300048916 Bacteria 6051
473 Ga0496115_0357288 3300048918 Bacteria 1191
474 Ga0501034_0012747 3300049571 Bacteria 8670
475 Ga0501036_0719118 3300049572 Bacteria 825
476 Ga0501039_0598583 3300049575 Bacteria 864
477 Ga0501047_0000105 3300049581 Bacteria 102765
478 Ga0501047_0450791 3300049581 Bacteria 1116
479 Ga0501068_0002814 3300049584 Bacteria 9250
480 Ga0501068_0105580 3300049584 Bacteria 1748
481 Ga0501069_0148526 3300049585 Bacteria 1346
482 Ga0501070_0159265 3300049586 Bacteria 1861
483 Ga0501071_0212824 3300049587 Bacteria 1454
484 Ga0501073_0326484 3300049589 Bacteria 1059
485 Ga0501074_0002707 3300049590 Bacteria 12404
486 Ga0501233_046716 3300049668 Bacteria 1036
487 Ga0501235_024120 3300049669 Bacteria 1358
488 Ga0501080_0051537 3300049742 Bacteria 3829
489 Ga0501080_0217566 3300049742 Bacteria 1749
490 Ga0501083_0011214 3300049744 Bacteria 6289
491 Ga0501083_0069069 3300049744 Bacteria 2351
492 Ga0501035_0258187 3300049822 Bacteria 1478
493 nmdc:mga03n38_117188_c1 3300050490 Bacteria 1304
494 nmdc:mga00v17_112533_c1 3300050491 Bacteria 1727
495 nmdc:mga0yw44_224253_c1 3300050492 Bacteria 1246
496 nmdc:mga06z11_106692_c1 3300050494 Bacteria 1545
497 nmdc:mga04h51_88616_c1 3300050495 Bacteria 1110
498 nmdc:mga05p37_17911_c1 3300050507 Bacteria 8550
499 nmdc:mga05p37_76876_c1 3300050507 Bacteria 4110
500 nmdc:mga05p37_8000_c1 3300050507 Bacteria 12480
501 nmdc:mga09592_1946_c1 3300050508 Bacteria 16640
502 nmdc:mga09592_21385_c1 3300050508 Bacteria 5332
503 nmdc:mga0qj67_10469_c1 3300050509 Bacteria 6928
504 nmdc:mga0qj67_12587_c1 3300050509 Bacteria 6377
505 nmdc:mga06r32_148779_c1 3300050510 Bacteria 2320
506 nmdc:mga06r32_306986_c1 3300050510 Bacteria 1572
507 nmdc:mga08y16_114578_c1 3300050511 Bacteria 2807
508 nmdc:mga08y16_174119_c1 3300050511 Bacteria 2235
509 nmdc:mga08y16_371892_c1 3300050511 Bacteria 1466
510 nmdc:mga0n895_151323_c1 3300050512 Bacteria 2351
511 nmdc:mga0n895_18283_c1 3300050512 Bacteria 6482
512 nmdc:mga0rr50_199381_c1 3300050513 Bacteria 1644
513 nmdc:mga08x19_369476_c1 3300050514 Bacteria 1003
514 nmdc:mga0a205_438501_c1 3300050515 Bacteria 1167
515 nmdc:mga0a205_6663_c1 3300050515 Bacteria 10451
516 Ga0495601_0104819 3300053077 Bacteria 1828
517 Ga0495601_0147123 3300053077 Bacteria 1538
518 Ga0495612_0106501 3300053078 Bacteria 1197
519 Ga0495612_0181062 3300053078 Bacteria 925
520 Ga0495595_0006427 3300053084 Bacteria 4793
521 Ga0495619_0040035 3300053085 Bacteria 3062
522 Ga0530510_0029100 3300061734 Bacteria 3964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0594611 Ga0395900_0594611_396_1022 208
2 3300048907 Ga0496104_0086206 Ga0496104_0086206_1571_2209 209
3 3300035207 Ga0373942_0148592 Ga0373942_0148592_92_724 210
4 3300046684 Ga0495669_0241094 Ga0495669_0241094_29_661 210
5 3300025893 Ga0207682_10034217 Ga0207682_100342173 216
6 3300007265 Ga0099794_10000003 Ga0099794_1000000364 218
7 3300027671 Ga0209588_1000001 Ga0209588_100000166 218
8 3300013105 Ga0157369_10622596 Ga0157369_106225962 219
9 3300048905 Ga0496102_0000813 Ga0496102_0000813_13683_14405 219
10 3300048906 Ga0496103_0013082 Ga0496103_0013082_3475_4197 219
11 iso_pu_bacteria 2881633906 2881634433 219
12 iso_pu_bacteria 2899370129 2899376944 219
13 3300028800 Ga0265338_10000071 Ga0265338_10000071148 220
14 3300044901 Ga0466960_0232624 Ga0466960_0232624_297_962 220
15 3300005937 Ga0081455_10049242 Ga0081455_100492422 221
16 3300005435 Ga0070714_100793981 Ga0070714_1007939812 222
17 3300005436 Ga0070713_100055375 Ga0070713_1000553752 222
18 3300005614 Ga0068856_100037096 Ga0068856_1000370962 222
19 3300005616 Ga0068852_100441956 Ga0068852_1004419562 222
20 3300005937 Ga0081455_10000290 Ga0081455_1000029039 222
21 3300006175 Ga0070712_100009429 Ga0070712_1000094295 222
22 3300010159 Ga0099796_10054383 Ga0099796_100543832 222
23 3300025928 Ga0207700_10156573 Ga0207700_101565733 222
24 3300025929 Ga0207664_10159862 Ga0207664_101598622 222
25 3300026078 Ga0207702_10664826 Ga0207702_106648262 222
26 3300031727 Ga0316576_10028201 Ga0316576_100282012 222
27 3300032139 Ga0316580_10027225 Ga0316580_100272252 222
28 3300035086 Ga0373934_0227614 Ga0373934_0227614_61_747 222
29 3300035119 Ga0373956_0016562 Ga0373956_0016562_1856_2533 222
30 3300035398 Ga0316574_0013156 Ga0316574_0013156_1983_2654 222
31 3300036401 Ga0373937_0005842 Ga0373937_0005842_1886_2563 222
32 3300039437 Ga0436365_0224050 Ga0436365_0224050_111_800 222
33 3300041456 Ga0451795_0082870 Ga0451795_0082870_267_956 222
34 3300041507 Ga0451851_1347250 Ga0451851_1347250_207_896 222
35 3300046462 Ga0495651_0046066 Ga0495651_0046066_622_1299 222
36 3300046511 Ga0495608_0058395 Ga0495608_0058395_1392_2069 222
37 3300046663 Ga0495635_0055052 Ga0495635_0055052_489_1166 222
38 3300046678 Ga0495599_0221609 Ga0495599_0221609_259_936 222
39 3300046679 Ga0495623_0080716 Ga0495623_0080716_1320_1997 222
40 3300046809 Ga0495600_0007112 Ga0495600_0007112_4299_4976 222
41 3300047317 Ga0495604_0076453 Ga0495604_0076453_509_1186 222
42 3300047319 Ga0495674_0270502 Ga0495674_0270502_541_1218 222
43 3300047322 Ga0495680_0004578 Ga0495680_0004578_8962_9639 222
44 3300047471 Ga0495684_0043625 Ga0495684_0043625_715_1392 222
45 3300048088 Ga0495602_0039005 Ga0495602_0039005_135_812 222
46 3300048907 Ga0496104_0059539 Ga0496104_0059539_693_1370 222
47 3300048908 Ga0496105_0226578 Ga0496105_0226578_316_993 222
48 3300048912 Ga0496109_0134323 Ga0496109_0134323_929_1606 222
49 3300048915 Ga0496112_0003994 Ga0496112_0003994_3384_4061 222
50 3300048916 Ga0496113_0010830 Ga0496113_0010830_5335_6012 222
51 3300053085 Ga0495619_0040035 Ga0495619_0040035_113_790 222
52 3300005616 Ga0068852_100197331 Ga0068852_1001973312 223
53 3300006042 Ga0075368_10175990 Ga0075368_101759902 223
54 3300006178 Ga0075367_10110685 Ga0075367_101106853 223
55 3300031911 Ga0307412_10525921 Ga0307412_105259211 223
56 3300032002 Ga0307416_100406551 Ga0307416_1004065513 223
57 3300042010 Ga0439452_031941 Ga0439452_031941_92_766 223
58 3300042435 Ga0439434_0067352 Ga0439434_0067352_415_1089 223
59 3300047320 Ga0495672_0004490 Ga0495672_0004490_5782_6456 223
60 3300049571 Ga0501034_0012747 Ga0501034_0012747_7655_8329 223
61 3300049584 Ga0501068_0002814 Ga0501068_0002814_6842_7516 223
62 3300049585 Ga0501069_0148526 Ga0501069_0148526_499_1173 223
63 3300049586 Ga0501070_0159265 Ga0501070_0159265_833_1507 223
64 3300049587 Ga0501071_0212824 Ga0501071_0212824_702_1376 223
65 3300049590 Ga0501074_0002707 Ga0501074_0002707_2371_3045 223
66 3300049742 Ga0501080_0051537 Ga0501080_0051537_2771_3445 223
67 3300049742 Ga0501080_0217566 Ga0501080_0217566_612_1286 223
68 3300049744 Ga0501083_0011214 Ga0501083_0011214_5479_6153 223
69 3300049744 Ga0501083_0069069 Ga0501083_0069069_1594_2268 223
70 3300050490 nmdc:mga03n38_117188_c1 nmdc:mga03n38_117188_c1_352_1026 223
71 3300005456 Ga0070678_100557932 Ga0070678_1005579322 224
72 3300009098 Ga0105245_10005428 Ga0105245_100054282 224
73 3300025927 Ga0207687_10001888 Ga0207687_100018882 224
74 3300046459 Ga0495629_0475865 Ga0495629_0475865_98_793 224
75 3300046463 Ga0495653_0220556 Ga0495653_0220556_319_1026 224
76 3300046517 Ga0495630_0107656 Ga0495630_0107656_398_1108 224
77 3300046535 Ga0495586_0001711 Ga0495586_0001711_7366_8076 224
78 3300046681 Ga0495647_0244452 Ga0495647_0244452_29_739 224
79 3300046683 Ga0495658_0048767 Ga0495658_0048767_459_1154 224
80 3300046689 Ga0495613_0019058 Ga0495613_0019058_1257_1967 224
81 3300047322 Ga0495680_0204887 Ga0495680_0204887_513_1223 224
82 3300048089 Ga0495614_0181318 Ga0495614_0181318_66_761 224
83 3300025922 Ga0207646_10440460 Ga0207646_104404602 225
84 3300031251 Ga0265327_10000134 Ga0265327_10000134123 225
85 3300036401 Ga0373937_0016183 Ga0373937_0016183_3847_4527 225
86 3300039447 Ga0436361_0503757 Ga0436361_0503757_42_734 225
87 3300046462 Ga0495651_0028096 Ga0495651_0028096_2948_3628 225
88 3300046463 Ga0495653_0082652 Ga0495653_0082652_803_1483 225
89 3300046511 Ga0495608_0031745 Ga0495608_0031745_977_1657 225
90 3300046516 Ga0495628_0377393 Ga0495628_0377393_10_690 225
91 3300046543 Ga0495645_0041227 Ga0495645_0041227_297_977 225
92 3300046559 Ga0495667_0034329 Ga0495667_0034329_902_1582 225
93 3300046642 Ga0495634_0195306 Ga0495634_0195306_96_776 225
94 3300046663 Ga0495635_0222888 Ga0495635_0222888_286_966 225
95 3300046675 Ga0495657_0007756 Ga0495657_0007756_6347_7027 225
96 3300046679 Ga0495623_0045952 Ga0495623_0045952_677_1357 225
97 3300046809 Ga0495600_0025623 Ga0495600_0025623_2447_3127 225
98 3300047322 Ga0495680_0008265 Ga0495680_0008265_6033_6713 225
99 3300049589 Ga0501073_0326484 Ga0501073_0326484_314_994 225
100 3300050492 nmdc:mga0yw44_224253_c1 nmdc:mga0yw44_224253_c1_60_758 225
101 3300009148 Ga0105243_10315383 Ga0105243_103153832 226
102 3300050514 nmdc:mga08x19_369476_c1 nmdc:mga08x19_369476_c1_19_708 226
103 3300009545 Ga0105237_10000452 Ga0105237_100004529 227
104 3300021384 Ga0213876_10007331 Ga0213876_100073315 227
105 3300021384 Ga0213876_10110175 Ga0213876_101101752 227
106 3300025914 Ga0207671_10000007 Ga0207671_1000000711 227
107 3300039437 Ga0436365_0078006 Ga0436365_0078006_3000_3725 227
108 3300039437 Ga0436365_0868921 Ga0436365_0868921_389_1114 227
109 3300005563 Ga0068855_100110370 Ga0068855_1001103704 228
110 3300005578 Ga0068854_100471568 Ga0068854_1004715682 228
111 3300013105 Ga0157369_10015605 Ga0157369_100156053 228
112 3300020081 Ga0206354_10238170 Ga0206354_102381703 228
113 3300038443 Ga0395901_0079640 Ga0395901_0079640_553_1245 228
114 3300046459 Ga0495629_0440411 Ga0495629_0440411_75_761 228
115 3300049822 Ga0501035_0258187 Ga0501035_0258187_686_1378 228
116 3300050508 nmdc:mga09592_21385_c1 nmdc:mga09592_21385_c1_1264_1950 228
117 3300050509 nmdc:mga0qj67_10469_c1 nmdc:mga0qj67_10469_c1_4525_5211 228
118 iso_pu_bacteria 8055066027 8055073855 228
119 3300005329 Ga0070683_100187857 Ga0070683_1001878572 229
120 3300013308 Ga0157375_11165927 Ga0157375_111659272 229
121 3300020080 Ga0206350_11475967 Ga0206350_114759672 229
122 3300049575 Ga0501039_0598583 Ga0501039_0598583_135_830 229
123 3300005338 Ga0068868_100004173 Ga0068868_10000417311 230
124 3300005338 Ga0068868_100017016 Ga0068868_1000170167 230
125 3300005353 Ga0070669_100497831 Ga0070669_1004978312 230
126 3300005436 Ga0070713_100000116 Ga0070713_10000011614 230
127 3300005436 Ga0070713_100137979 Ga0070713_1001379791 230
128 3300005439 Ga0070711_100100225 Ga0070711_1001002252 230
129 3300005458 Ga0070681_10000371 Ga0070681_100003718 230
130 3300005468 Ga0070707_100764235 Ga0070707_1007642351 230
131 3300005530 Ga0070679_100006254 Ga0070679_1000062546 230
132 3300005539 Ga0068853_100039687 Ga0068853_1000396875 230
133 3300005563 Ga0068855_100003285 Ga0068855_1000032856 230
134 3300005577 Ga0068857_100013481 Ga0068857_1000134814 230
135 3300005577 Ga0068857_100498834 Ga0068857_1004988341 230
136 3300005614 Ga0068856_100002080 Ga0068856_10000208020 230
137 3300005616 Ga0068852_100005551 Ga0068852_1000055514 230
138 3300005617 Ga0068859_100329999 Ga0068859_1003299993 230
139 3300005618 Ga0068864_100091495 Ga0068864_1000914953 230
140 3300005843 Ga0068860_100029437 Ga0068860_1000294377 230
141 3300006028 Ga0070717_10232941 Ga0070717_102329412 230
142 3300006175 Ga0070712_100000641 Ga0070712_1000006414 230
143 3300006237 Ga0097621_100001528 Ga0097621_10000152821 230
144 3300006358 Ga0068871_100001464 Ga0068871_10000146420 230
145 3300006931 Ga0097620_100329990 Ga0097620_1003299903 230
146 3300009093 Ga0105240_10006657 Ga0105240_1000665719 230
147 3300009174 Ga0105241_10204249 Ga0105241_102042493 230
148 3300009174 Ga0105241_10347251 Ga0105241_103472512 230
149 3300009177 Ga0105248_10240080 Ga0105248_102400803 230
150 3300009551 Ga0105238_10002146 Ga0105238_1000214620 230
151 3300013105 Ga0157369_10000263 Ga0157369_1000026366 230
152 3300013105 Ga0157369_10882295 Ga0157369_108822952 230
153 3300013296 Ga0157374_10006682 Ga0157374_100066824 230
154 3300013296 Ga0157374_10012721 Ga0157374_100127212 230
155 3300013296 Ga0157374_10386302 Ga0157374_103863022 230
156 3300013297 Ga0157378_10004559 Ga0157378_100045598 230
157 3300013306 Ga0163162_10258288 Ga0163162_102582882 230
158 3300013307 Ga0157372_10002714 Ga0157372_1000271419 230
159 3300014325 Ga0163163_10209283 Ga0163163_102092832 230
160 3300025910 Ga0207684_10017028 Ga0207684_100170285 230
161 3300025911 Ga0207654_10168565 Ga0207654_101685651 230
162 3300025912 Ga0207707_10017089 Ga0207707_100170893 230
163 3300025912 Ga0207707_10513033 Ga0207707_105130331 230
164 3300025913 Ga0207695_10006053 Ga0207695_100060535 230
165 3300025914 Ga0207671_10222624 Ga0207671_102226242 230
166 3300025915 Ga0207693_10000661 Ga0207693_1000066123 230
167 3300025921 Ga0207652_10008022 Ga0207652_100080226 230
168 3300025921 Ga0207652_10009014 Ga0207652_100090148 230
169 3300025923 Ga0207681_10373392 Ga0207681_103733922 230
170 3300025924 Ga0207694_10002858 Ga0207694_100028588 230
171 3300025928 Ga0207700_10000612 Ga0207700_1000061220 230
172 3300025928 Ga0207700_10112433 Ga0207700_101124332 230
173 3300025929 Ga0207664_10473199 Ga0207664_104731991 230
174 3300025944 Ga0207661_10214677 Ga0207661_102146772 230
175 3300025945 Ga0207679_10038402 Ga0207679_100384023 230
176 3300025949 Ga0207667_10000455 Ga0207667_1000045535 230
177 3300026023 Ga0207677_10073074 Ga0207677_100730743 230
178 3300026035 Ga0207703_10058843 Ga0207703_100588431 230
179 3300026041 Ga0207639_10029273 Ga0207639_100292731 230
180 3300026078 Ga0207702_10010164 Ga0207702_100101645 230
181 3300026095 Ga0207676_10471542 Ga0207676_104715422 230
182 3300026116 Ga0207674_10004109 Ga0207674_100041093 230
183 3300026116 Ga0207674_11022035 Ga0207674_110220351 230
184 3300026142 Ga0207698_10025223 Ga0207698_100252233 230
185 3300031995 Ga0307409_101103972 Ga0307409_1011039721 230
186 3300032002 Ga0307416_100025449 Ga0307416_1000254492 230
187 3300035170 Ga0373943_0288663 Ga0373943_0288663_91_786 230
188 3300035724 Ga0373933_0135218 Ga0373933_0135218_430_1125 230
189 3300036401 Ga0373937_0027663 Ga0373937_0027663_2502_3197 230
190 3300037418 Ga0395900_0014516 Ga0395900_0014516_6185_6919 230
191 3300037471 Ga0395905_0120115 Ga0395905_0120115_14_709 230
192 3300038443 Ga0395901_0050469 Ga0395901_0050469_345_1079 230
193 3300042876 Ga0451577_0273866 Ga0451577_0273866_281_976 230
194 3300045976 Ga0466967_0049923 Ga0466967_0049923_920_1618 230
195 3300046511 Ga0495608_0131137 Ga0495608_0131137_728_1423 230
196 3300046533 Ga0495640_0039447 Ga0495640_0039447_1070_1765 230
197 3300046809 Ga0495600_0379494 Ga0495600_0379494_154_849 230
198 3300048905 Ga0496102_0168354 Ga0496102_0168354_489_1184 230
199 3300048907 Ga0496104_0297262 Ga0496104_0297262_539_1234 230
200 3300048908 Ga0496105_0257510 Ga0496105_0257510_267_962 230
201 3300048915 Ga0496112_0003286 Ga0496112_0003286_4482_5177 230
202 3300049668 Ga0501233_046716 Ga0501233_046716_158_853 230
203 3300049669 Ga0501235_024120 Ga0501235_024120_284_979 230
204 3300053077 Ga0495601_0104819 Ga0495601_0104819_683_1378 230
205 3300053078 Ga0495612_0106501 Ga0495612_0106501_303_998 230
206 3300053084 Ga0495595_0006427 Ga0495595_0006427_2432_3127 230
207 3300005354 Ga0070675_100105087 Ga0070675_1001050873 231
208 3300005434 Ga0070709_10232158 Ga0070709_102321583 231
209 3300005436 Ga0070713_100053410 Ga0070713_1000534103 231
210 3300005437 Ga0070710_10174750 Ga0070710_101747502 231
211 3300005439 Ga0070711_100260339 Ga0070711_1002603391 231
212 3300005518 Ga0070699_100423537 Ga0070699_1004235371 231
213 3300005530 Ga0070679_100256813 Ga0070679_1002568131 231
214 3300005539 Ga0068853_100038001 Ga0068853_1000380013 231
215 3300005547 Ga0070693_100131765 Ga0070693_1001317651 231
216 3300005563 Ga0068855_100036457 Ga0068855_1000364575 231
217 3300005614 Ga0068856_100048047 Ga0068856_1000480472 231
218 3300005616 Ga0068852_100212606 Ga0068852_1002126061 231
219 3300005616 Ga0068852_100227765 Ga0068852_1002277652 231
220 3300005617 Ga0068859_100244865 Ga0068859_1002448653 231
221 3300006028 Ga0070717_10456805 Ga0070717_104568052 231
222 3300006028 Ga0070717_10795045 Ga0070717_107950451 231
223 3300006163 Ga0070715_10092196 Ga0070715_100921962 231
224 3300006175 Ga0070712_100076981 Ga0070712_1000769812 231
225 3300006175 Ga0070712_100254668 Ga0070712_1002546682 231
226 3300006847 Ga0075431_100288359 Ga0075431_1002883593 231
227 3300006871 Ga0075434_100133358 Ga0075434_1001333582 231
228 3300006880 Ga0075429_100002362 Ga0075429_10000236216 231
229 3300006931 Ga0097620_100244866 Ga0097620_1002448663 231
230 3300007076 Ga0075435_100011513 Ga0075435_1000115136 231
231 3300007788 Ga0099795_10184154 Ga0099795_101841541 231
232 3300009093 Ga0105240_10040333 Ga0105240_100403333 231
233 3300009094 Ga0111539_10173194 Ga0111539_101731944 231
234 3300009551 Ga0105238_10078974 Ga0105238_100789744 231
235 3300009551 Ga0105238_10108121 Ga0105238_101081212 231
236 3300010375 Ga0105239_10405995 Ga0105239_104059952 231
237 3300013105 Ga0157369_10021497 Ga0157369_100214978 231
238 3300013296 Ga0157374_10272742 Ga0157374_102727422 231
239 3300013307 Ga0157372_10434751 Ga0157372_104347511 231
240 3300014968 Ga0157379_10067071 Ga0157379_100670711 231
241 3300025905 Ga0207685_10088837 Ga0207685_100888371 231
242 3300025912 Ga0207707_10156170 Ga0207707_101561702 231
243 3300025912 Ga0207707_10377313 Ga0207707_103773132 231
244 3300025913 Ga0207695_10156810 Ga0207695_101568103 231
245 3300025915 Ga0207693_10209678 Ga0207693_102096782 231
246 3300025916 Ga0207663_10007514 Ga0207663_100075142 231
247 3300025921 Ga0207652_10163992 Ga0207652_101639921 231
248 3300025927 Ga0207687_10070467 Ga0207687_100704672 231
249 3300025928 Ga0207700_10055646 Ga0207700_100556462 231
250 3300025929 Ga0207664_10535523 Ga0207664_105355231 231
251 3300025929 Ga0207664_10661363 Ga0207664_106613632 231
252 3300025934 Ga0207686_10605168 Ga0207686_106051681 231
253 3300025939 Ga0207665_10356236 Ga0207665_103562361 231
254 3300025949 Ga0207667_10221141 Ga0207667_102211413 231
255 3300026041 Ga0207639_10008564 Ga0207639_100085648 231
256 3300026078 Ga0207702_10214758 Ga0207702_102147581 231
257 3300026088 Ga0207641_10375316 Ga0207641_103753163 231
258 3300027866 Ga0209813_10074542 Ga0209813_100745422 231
259 3300031239 Ga0265328_10016542 Ga0265328_100165422 231
260 3300031250 Ga0265331_10038729 Ga0265331_100387291 231
261 3300031344 Ga0265316_10198062 Ga0265316_101980621 231
262 3300031712 Ga0265342_10181801 Ga0265342_101818013 231
263 3300035111 Ga0373923_0014313 Ga0373923_0014313_1035_1733 231
264 3300035116 Ga0373945_0000919 Ga0373945_0000919_7843_8541 231
265 3300035119 Ga0373956_0032133 Ga0373956_0032133_925_1623 231
266 3300035119 Ga0373956_0133333 Ga0373956_0133333_48_746 231
267 3300035170 Ga0373943_0020403 Ga0373943_0020403_920_1618 231
268 3300035171 Ga0373946_0015075 Ga0373946_0015075_1437_2135 231
269 3300035410 Ga0373924_0001292 Ga0373924_0001292_7004_7702 231
270 3300035410 Ga0373924_0022855 Ga0373924_0022855_50_748 231
271 3300035410 Ga0373924_0110452 Ga0373924_0110452_368_1066 231
272 3300035692 Ga0373935_0001019 Ga0373935_0001019_1202_1900 231
273 3300035695 Ga0373927_0004708 Ga0373927_0004708_3539_4237 231
274 3300035725 Ga0373947_0003790 Ga0373947_0003790_6873_7571 231
275 3300035725 Ga0373947_0072667 Ga0373947_0072667_194_892 231
276 3300036401 Ga0373937_0000199 Ga0373937_0000199_40408_41106 231
277 3300036401 Ga0373937_0835702 Ga0373937_0835702_54_752 231
278 3300037068 Ga0373925_0093445 Ga0373925_0093445_919_1620 231
279 3300037068 Ga0373925_0114214 Ga0373925_0114214_284_982 231
280 3300037471 Ga0395905_0056367 Ga0395905_0056367_2822_3523 231
281 3300038443 Ga0395901_0785110 Ga0395901_0785110_192_890 231
282 3300039437 Ga0436365_0181285 Ga0436365_0181285_716_1414 231
283 3300044842 Ga0466957_0002521 Ga0466957_0002521_780_1478 231
284 3300046462 Ga0495651_0121246 Ga0495651_0121246_36_734 231
285 3300046475 Ga0495639_0194307 Ga0495639_0194307_165_863 231
286 3300046499 Ga0495594_0174257 Ga0495594_0174257_355_1050 231
287 3300046529 Ga0495652_0404450 Ga0495652_0404450_160_858 231
288 3300046531 Ga0495665_0071902 Ga0495665_0071902_359_1057 231
289 3300046559 Ga0495667_0192427 Ga0495667_0192427_349_1047 231
290 3300046678 Ga0495599_0293388 Ga0495599_0293388_21_719 231
291 3300046679 Ga0495623_0028713 Ga0495623_0028713_484_1182 231
292 3300046681 Ga0495647_0091172 Ga0495647_0091172_210_908 231
293 3300046684 Ga0495669_0197574 Ga0495669_0197574_15_713 231
294 3300047322 Ga0495680_0278542 Ga0495680_0278542_267_965 231
295 3300047444 Ga0495675_0194531 Ga0495675_0194531_267_965 231
296 3300047444 Ga0495675_0252013 Ga0495675_0252013_342_1040 231
297 3300047471 Ga0495684_0083058 Ga0495684_0083058_1523_2221 231
298 3300048089 Ga0495614_0082845 Ga0495614_0082845_22_720 231
299 3300048905 Ga0496102_0071795 Ga0496102_0071795_1543_2241 231
300 3300048908 Ga0496105_0080340 Ga0496105_0080340_25_723 231
301 3300048913 Ga0496110_0222307 Ga0496110_0222307_240_938 231
302 3300048914 Ga0496111_0158747 Ga0496111_0158747_193_891 231
303 3300048915 Ga0496112_0015370 Ga0496112_0015370_1737_2435 231
304 3300048915 Ga0496112_0038195 Ga0496112_0038195_3980_4678 231
305 3300048916 Ga0496113_0004383 Ga0496113_0004383_1044_1742 231
306 3300048918 Ga0496115_0357288 Ga0496115_0357288_469_1167 231
307 3300050494 nmdc:mga06z11_106692_c1 nmdc:mga06z11_106692_c1_291_1028 231
308 3300050495 nmdc:mga04h51_88616_c1 nmdc:mga04h51_88616_c1_228_965 231
309 3300050508 nmdc:mga09592_1946_c1 nmdc:mga09592_1946_c1_12505_13203 231
310 3300050510 nmdc:mga06r32_306986_c1 nmdc:mga06r32_306986_c1_294_992 231
311 3300050512 nmdc:mga0n895_151323_c1 nmdc:mga0n895_151323_c1_1156_1857 231
312 3300050513 nmdc:mga0rr50_199381_c1 nmdc:mga0rr50_199381_c1_690_1391 231
313 3300053077 Ga0495601_0147123 Ga0495601_0147123_299_997 231
314 3300053078 Ga0495612_0181062 Ga0495612_0181062_75_773 231
315 3300005295 Ga0065707_10085551 Ga0065707_100855511 232
316 3300005355 Ga0070671_100341501 Ga0070671_1003415012 232
317 3300005356 Ga0070674_100010172 Ga0070674_1000101721 232
318 3300005434 Ga0070709_10014150 Ga0070709_100141505 232
319 3300005437 Ga0070710_10217427 Ga0070710_102174272 232
320 3300005439 Ga0070711_100046114 Ga0070711_1000461144 232
321 3300005471 Ga0070698_100028555 Ga0070698_1000285553 232
322 3300005617 Ga0068859_100352799 Ga0068859_1003527993 232
323 3300005841 Ga0068863_100164256 Ga0068863_1001642563 232
324 3300006173 Ga0070716_100070734 Ga0070716_1000707343 232
325 3300006175 Ga0070712_100007262 Ga0070712_1000072628 232
326 3300006175 Ga0070712_100658145 Ga0070712_1006581452 232
327 3300006844 Ga0075428_100066151 Ga0075428_1000661515 232
328 3300006871 Ga0075434_100441257 Ga0075434_1004412571 232
329 3300006931 Ga0097620_100352777 Ga0097620_1003527773 232
330 3300009101 Ga0105247_10119639 Ga0105247_101196393 232
331 3300009147 Ga0114129_10010988 Ga0114129_100109885 232
332 3300009147 Ga0114129_11641715 Ga0114129_116417151 232
333 3300009177 Ga0105248_10231623 Ga0105248_102316232 232
334 3300013306 Ga0163162_10007586 Ga0163162_100075864 232
335 3300014325 Ga0163163_10034858 Ga0163163_100348583 232
336 3300014325 Ga0163163_10094063 Ga0163163_100940631 232
337 3300025315 Ga0207697_10002586 Ga0207697_100025865 232
338 3300025905 Ga0207685_10087111 Ga0207685_100871111 232
339 3300025915 Ga0207693_10010839 Ga0207693_100108398 232
340 3300025916 Ga0207663_10001804 Ga0207663_100018044 232
341 3300025960 Ga0207651_10636310 Ga0207651_106363102 232
342 3300025972 Ga0207668_10627677 Ga0207668_106276772 232
343 3300026088 Ga0207641_10127989 Ga0207641_101279893 232
344 3300031733 Ga0316577_10255295 Ga0316577_102552952 232
345 3300035083 Ga0373926_0009828 Ga0373926_0009828_2275_2988 232
346 3300035113 Ga0373936_0016739 Ga0373936_0016739_2007_2720 232
347 3300035116 Ga0373945_0058430 Ga0373945_0058430_61_774 232
348 3300035170 Ga0373943_0071146 Ga0373943_0071146_850_1563 232
349 3300035171 Ga0373946_0056982 Ga0373946_0056982_397_1110 232
350 3300035691 Ga0373931_0125223 Ga0373931_0125223_176_889 232
351 3300035692 Ga0373935_0051288 Ga0373935_0051288_461_1174 232
352 3300035695 Ga0373927_0187319 Ga0373927_0187319_581_1294 232
353 3300035725 Ga0373947_0078422 Ga0373947_0078422_957_1670 232
354 3300036712 Ga0316584_0105973 Ga0316584_0105973_962_1663 232
355 3300037068 Ga0373925_0072211 Ga0373925_0072211_903_1616 232
356 3300037068 Ga0373925_0091562 Ga0373925_0091562_60_773 232
357 3300037466 Ga0395898_0155515 Ga0395898_0155515_825_1526 232
358 3300038443 Ga0395901_0314704 Ga0395901_0314704_228_929 232
359 3300042876 Ga0451577_0059370 Ga0451577_0059370_1949_2653 232
360 3300045049 Ga0466959_0019510 Ga0466959_0019510_3992_4693 232
361 3300046475 Ga0495639_0200600 Ga0495639_0200600_160_873 232
362 3300046491 Ga0495584_0164695 Ga0495584_0164695_394_1107 232
363 3300046491 Ga0495584_0177606 Ga0495584_0177606_188_901 232
364 3300046499 Ga0495594_0143808 Ga0495594_0143808_253_966 232
365 3300046537 Ga0495598_0001223 Ga0495598_0001223_745_1458 232
366 3300046543 Ga0495645_0177963 Ga0495645_0177963_197_898 232
367 3300046664 Ga0495659_0044934 Ga0495659_0044934_744_1457 232
368 3300046684 Ga0495669_0045362 Ga0495669_0045362_1220_1933 232
369 3300047315 Ga0495581_0081840 Ga0495581_0081840_1127_1828 232
370 3300048904 Ga0496101_0187678 Ga0496101_0187678_10_723 232
371 3300049581 Ga0501047_0000105 Ga0501047_0000105_100130_100831 232
372 3300050491 nmdc:mga00v17_112533_c1 nmdc:mga00v17_112533_c1_745_1455 232
373 3300061734 Ga0530510_0029100 Ga0530510_0029100_2484_3197 232
374 3300005577 Ga0068857_100134413 Ga0068857_1001344132 233
375 3300013307 Ga0157372_10150080 Ga0157372_101500802 233
376 3300026088 Ga0207641_10062083 Ga0207641_100620832 233
377 3300026089 Ga0207648_10987782 Ga0207648_109877821 233
378 3300026116 Ga0207674_10393638 Ga0207674_103936382 233
379 3300035119 Ga0373956_0173230 Ga0373956_0173230_179_988 233
380 3300046663 Ga0495635_0107116 Ga0495635_0107116_1104_1895 233
381 3300049572 Ga0501036_0719118 Ga0501036_0719118_101_805 233
382 3300049581 Ga0501047_0450791 Ga0501047_0450791_309_1040 233
383 3300027695 Ga0209966_1012403 Ga0209966_10124032 234
384 3300045051 Ga0451576_0881984 Ga0451576_0881984_46_750 234
385 3300048907 Ga0496104_0013919 Ga0496104_0013919_3227_3931 234
386 3300048911 Ga0496108_0042797 Ga0496108_0042797_2133_2837 234
387 3300048913 Ga0496110_0076288 Ga0496110_0076288_215_919 234
388 3300011119 Ga0105246_10500505 Ga0105246_105005052 235
389 3300046675 Ga0495657_0226594 Ga0495657_0226594_309_1019 235
390 3300005518 Ga0070699_100006304 Ga0070699_1000063044 236
391 3300005937 Ga0081455_10178370 Ga0081455_101783702 236
392 3300013307 Ga0157372_10028171 Ga0157372_100281712 236
393 3300037312 Ga0395899_0027008 Ga0395899_0027008_1451_2161 236
394 3300037418 Ga0395900_0006405 Ga0395900_0006405_2277_2987 236
395 3300037418 Ga0395900_0200320 Ga0395900_0200320_489_1199 236
396 3300037466 Ga0395898_0084172 Ga0395898_0084172_406_1116 236
397 3300037466 Ga0395898_0309020 Ga0395898_0309020_356_1066 236
398 3300037471 Ga0395905_0008024 Ga0395905_0008024_4603_5313 236
399 3300038443 Ga0395901_0014492 Ga0395901_0014492_3716_4426 236
400 3300038443 Ga0395901_0033717 Ga0395901_0033717_3516_4226 236
401 3300038443 Ga0395901_0077401 Ga0395901_0077401_2011_2721 236
402 3300044712 Ga0453684_0000004 Ga0453684_0000004_867736_868452 236
403 3300005937 Ga0081455_10002415 Ga0081455_1000241519 237
404 3300005937 Ga0081455_10022753 Ga0081455_100227536 237
405 3300006058 Ga0075432_10033291 Ga0075432_100332913 237
406 3300006844 Ga0075428_100054943 Ga0075428_1000549434 237
407 3300006846 Ga0075430_100004467 Ga0075430_1000044672 237
408 3300006847 Ga0075431_100013322 Ga0075431_1000133226 237
409 3300006847 Ga0075431_100227536 Ga0075431_1002275363 237
410 3300006852 Ga0075433_10001584 Ga0075433_1000158410 237
411 3300006871 Ga0075434_100083656 Ga0075434_1000836564 237
412 3300006880 Ga0075429_100047545 Ga0075429_1000475454 237
413 3300009094 Ga0111539_10428613 Ga0111539_104286133 237
414 3300009147 Ga0114129_10013855 Ga0114129_1001385513 237
415 3300009147 Ga0114129_10030492 Ga0114129_100304923 237
416 3300027907 Ga0207428_10011116 Ga0207428_100111164 237
417 3300037312 Ga0395899_0020930 Ga0395899_0020930_2611_3324 237
418 3300037418 Ga0395900_0011978 Ga0395900_0011978_6735_7448 237
419 3300037466 Ga0395898_0022636 Ga0395898_0022636_4065_4778 237
420 3300038443 Ga0395901_0043278 Ga0395901_0043278_1669_2382 237
421 3300046520 Ga0495637_0117803 Ga0495637_0117803_56_769 237
422 3300049584 Ga0501068_0105580 Ga0501068_0105580_430_1143 237
423 3300050507 nmdc:mga05p37_17911_c1 nmdc:mga05p37_17911_c1_3749_4462 237
424 3300050507 nmdc:mga05p37_8000_c1 nmdc:mga05p37_8000_c1_11298_12011 237
425 3300050511 nmdc:mga08y16_114578_c1 nmdc:mga08y16_114578_c1_310_1023 237
426 3300050511 nmdc:mga08y16_371892_c1 nmdc:mga08y16_371892_c1_350_1063 237
427 3300050515 nmdc:mga0a205_438501_c1 nmdc:mga0a205_438501_c1_255_968 237
428 3300050515 nmdc:mga0a205_6663_c1 nmdc:mga0a205_6663_c1_9473_10186 237
429 3300006844 Ga0075428_100535247 Ga0075428_1005352472 238
430 3300009147 Ga0114129_10100978 Ga0114129_101009785 238
431 3300046501 Ga0495607_0119841 Ga0495607_0119841_493_1209 238
432 3300001976 JGI24752J21851_1008414 JGI24752J21851_10084142 239
433 3300002155 JGI24033J26618_1007566 JGI24033J26618_10075662 239
434 3300002459 JGI24751J29686_10000209 JGI24751J29686_1000020917 239
435 3300005331 Ga0070670_100098510 Ga0070670_1000985103 239
436 3300005344 Ga0070661_100196749 Ga0070661_1001967492 239
437 3300005347 Ga0070668_100234555 Ga0070668_1002345552 239
438 3300005354 Ga0070675_100041083 Ga0070675_1000410833 239
439 3300005354 Ga0070675_100071595 Ga0070675_1000715951 239
440 3300005444 Ga0070694_100083313 Ga0070694_1000833134 239
441 3300005444 Ga0070694_100291469 Ga0070694_1002914692 239
442 3300005468 Ga0070707_100392557 Ga0070707_1003925571 239
443 3300005471 Ga0070698_100090376 Ga0070698_1000903762 239
444 3300005518 Ga0070699_100179272 Ga0070699_1001792723 239
445 3300005518 Ga0070699_100226722 Ga0070699_1002267222 239
446 3300005535 Ga0070684_100009949 Ga0070684_1000099493 239
447 3300005549 Ga0070704_100029806 Ga0070704_1000298063 239
448 3300005564 Ga0070664_100006163 Ga0070664_1000061634 239
449 3300005577 Ga0068857_100028649 Ga0068857_1000286493 239
450 3300005577 Ga0068857_100237851 Ga0068857_1002378512 239
451 3300005719 Ga0068861_100051372 Ga0068861_1000513722 239
452 3300005840 Ga0068870_10001383 Ga0068870_100013832 239
453 3300005841 Ga0068863_100004403 Ga0068863_1000044036 239
454 3300005844 Ga0068862_100641026 Ga0068862_1006410262 239
455 3300005937 Ga0081455_10065648 Ga0081455_100656482 239
456 3300006058 Ga0075432_10006368 Ga0075432_100063682 239
457 3300006846 Ga0075430_100096449 Ga0075430_1000964491 239
458 3300006847 Ga0075431_100311631 Ga0075431_1003116312 239
459 3300006871 Ga0075434_100033684 Ga0075434_1000336842 239
460 3300009011 Ga0105251_10003774 Ga0105251_100037742 239
461 3300009094 Ga0111539_10117596 Ga0111539_101175962 239
462 3300009147 Ga0114129_11391275 Ga0114129_113912751 239
463 3300009148 Ga0105243_10005454 Ga0105243_100054546 239
464 3300009553 Ga0105249_10047910 Ga0105249_100479102 239
465 3300009553 Ga0105249_10409136 Ga0105249_104091362 239
466 3300009553 Ga0105249_10572912 Ga0105249_105729123 239
467 3300011119 Ga0105246_10154917 Ga0105246_101549173 239
468 3300013308 Ga0157375_10488650 Ga0157375_104886503 239
469 3300014325 Ga0163163_10032792 Ga0163163_100327922 239
470 3300014968 Ga0157379_10382252 Ga0157379_103822523 239
471 3300025885 Ga0207653_10009794 Ga0207653_100097944 239
472 3300025904 Ga0207647_10073774 Ga0207647_100737742 239
473 3300025908 Ga0207643_10000382 Ga0207643_100003822 239
474 3300025920 Ga0207649_10134096 Ga0207649_101340963 239
475 3300025925 Ga0207650_10005383 Ga0207650_100053838 239
476 3300025925 Ga0207650_10621527 Ga0207650_106215271 239
477 3300025926 Ga0207659_10056869 Ga0207659_100568692 239
478 3300025926 Ga0207659_10117922 Ga0207659_101179223 239
479 3300025926 Ga0207659_10297285 Ga0207659_102972851 239
480 3300025935 Ga0207709_10050799 Ga0207709_100507992 239
481 3300025945 Ga0207679_10054843 Ga0207679_100548433 239
482 3300025961 Ga0207712_10241268 Ga0207712_102412682 239
483 3300026075 Ga0207708_10004753 Ga0207708_100047532 239
484 3300026075 Ga0207708_10007042 Ga0207708_1000704210 239
485 3300026088 Ga0207641_10018393 Ga0207641_100183937 239
486 3300026095 Ga0207676_10004365 Ga0207676_100043652 239
487 3300026116 Ga0207674_10001198 Ga0207674_1000119813 239
488 3300026116 Ga0207674_10050193 Ga0207674_100501936 239
489 3300026116 Ga0207674_10280838 Ga0207674_102808383 239
490 3300026118 Ga0207675_100015055 Ga0207675_1000150556 239
491 3300026118 Ga0207675_100188297 Ga0207675_1001882972 239
492 3300028380 Ga0268265_10294734 Ga0268265_102947343 239
493 3300035085 Ga0373929_0015307 Ga0373929_0015307_523_1242 239
494 3300035115 Ga0373941_0150624 Ga0373941_0150624_62_781 239
495 3300035691 Ga0373931_0022022 Ga0373931_0022022_319_1038 239
496 3300037418 Ga0395900_0637686 Ga0395900_0637686_41_763 239
497 3300037466 Ga0395898_0077536 Ga0395898_0077536_75_797 239
498 3300042011 Ga0439454_000318 Ga0439454_000318_2728_3450 239
499 3300042012 Ga0439455_0069589 Ga0439455_0069589_153_875 239
500 3300042016 Ga0439463_034467 Ga0439463_034467_227_949 239
501 3300042436 Ga0439435_0011838 Ga0439435_0011838_132_854 239
502 3300042439 Ga0439464_0047303 Ga0439464_0047303_58_780 239
503 3300046452 Ga0495617_017146 Ga0495617_017146_1173_1892 239
504 3300046458 Ga0495591_032485 Ga0495591_032485_757_1476 239
505 3300046474 Ga0495605_0078196 Ga0495605_0078196_98_817 239
506 3300046492 Ga0495585_0018466 Ga0495585_0018466_2189_2908 239
507 3300046501 Ga0495607_0038636 Ga0495607_0038636_900_1619 239
508 3300046506 Ga0495583_0143995 Ga0495583_0143995_217_936 239
509 3300046520 Ga0495637_0063722 Ga0495637_0063722_261_980 239
510 3300046523 Ga0495644_0072105 Ga0495644_0072105_433_1152 239
511 3300046615 Ga0495656_0027867 Ga0495656_0027867_1175_1894 239
512 3300046691 Ga0495670_0134860 Ga0495670_0134860_40_759 239
513 3300046691 Ga0495670_0237372 Ga0495670_0237372_50_769 239
514 3300047318 Ga0495636_0081820 Ga0495636_0081820_204_923 239
515 3300047318 Ga0495636_0094702 Ga0495636_0094702_567_1289 239
516 3300047446 Ga0495679_058358 Ga0495679_058358_16_735 239
517 3300048909 Ga0496106_0457575 Ga0496106_0457575_104_826 239
518 3300048912 Ga0496109_0093182 Ga0496109_0093182_306_1025 239
519 3300048913 Ga0496110_0096635 Ga0496110_0096635_524_1243 239
520 3300048913 Ga0496110_0428585 Ga0496110_0428585_135_857 239
521 3300050507 nmdc:mga05p37_76876_c1 nmdc:mga05p37_76876_c1_742_1464 239
522 3300050509 nmdc:mga0qj67_12587_c1 nmdc:mga0qj67_12587_c1_4640_5362 239
523 3300050510 nmdc:mga06r32_148779_c1 nmdc:mga06r32_148779_c1_1042_1764 239
524 3300050511 nmdc:mga08y16_174119_c1 nmdc:mga08y16_174119_c1_742_1464 239
525 3300050512 nmdc:mga0n895_18283_c1 nmdc:mga0n895_18283_c1_1121_1843 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

38

260

0.91

PF01965

DJ-1_PfpI

DJ-1/PfpI family

60

144

0.88

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

55

168

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9316 5 230
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9146 5 230
6lyk-assembly1.cif.gz_A crystal structure of r1263a mutant of formylglycinamidine synthetase 0.8889 6 231
6jt8-assembly1.cif.gz_A crystal structure of 450-451_deletion mutant of fgam synthetase 0.8881 5 231
4l78-assembly1.cif.gz_A xenon trapping and statistical coupling analysis uncover regions important for structure and function of multidomain protein stpurl 0.8864 5 231
ID Description Score Start End Superfamily
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.964 8 232 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9567 5 232 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9517 8 232 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9483 5 232 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9435 8 232 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A6J7KM29-F1-model_v4 Unannotated protein 0.9882 76 237 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A2V8RZ66-F1-model_v4 Phosphoribosylformylglycinamidine synthase I 0.9869 85 207 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A6J6JNV2-F1-model_v4 Unannotated protein 0.9868 76 230 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A6I2WDR2-F1-model_v4 deleted 0.9858 76 229
AF-X1CA12-F1-model_v4 Uncharacterized protein 0.9828 84 221 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787

Feature Viewer

pLDDT pTM Quality
92.21 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map