F459259

General Info

Members Datasets Scaffolds Average Seq Length
525 360 435 362

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10004570|Ga0105243_100045703
Length 397
Sequence MGVLVIDSMNQIIEIQNFPYEHALPRLRRMTLAAPTPAPFTLEAMLRAIPKVELHCHLFGTVRHDTFRQLNRRAGAPLADAEIDGFYTRGEKPVGVLRVLRALDAQLVRSADDLYQLTLEYLQDAASHEVRYAEFFWNPTGTVHGSGIAYPLAQGAIVRAIHDAQQAFGITGRLIAAIDREASAEAAVEMVEWVKSHRCDEVIGIGIDYRENDRPPELFARAYAEAKKAGLKTTAHAGEFGMPWTNVRTALELLQVDRIDHGYTVVDQPDFARQCAERGVIFTVVPTNSYYLRTLPPERWALDHPIRRMPGLGLRIHPNTDDPTLHQVTPTGAWLMMVRDFGFGLDDLRGFMHNGLAGAWIDDTQRRQWRAEWSADFDALRARLPCEPTPSATPFPG

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
10 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
11 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
12 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
13 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
14 2643221658 Variovorax sp. Root411 Isolate Unclassified
15 2643221672 Variovorax sp. Root434 Isolate Unclassified
16 2643221683 Variovorax sp. Root473 Isolate Unclassified
17 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
24 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
25 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
26 2816332133 Acidovorax radicis 2721A Isolate Unclassified
27 2818991436 Collimonas arenae 515 Isolate Unclassified
28 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
29 2818991446 Variovorax sp. 1180 Isolate Unclassified
30 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
31 2818991452 Burkholderia cepacia 561 Isolate Unclassified
32 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
33 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
34 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
35 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
36 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
37 2842677519 Variovorax sp. R-72495 Isolate Unclassified
38 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
39 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
40 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
41 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
42 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
43 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
44 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
45 2885198086 Variovorax sp. 679 Isolate Unclassified
46 2885211737 Variovorax sp. 553 Isolate Unclassified
47 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
48 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
49 2899924645 Variovorax sp. 369 Isolate Unclassified
50 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
51 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
52 2904456579 Variovorax sp. 2002 Isolate Unclassified
53 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
54 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
55 2904564687 Burkholderia sp. 571 Isolate Unclassified
56 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
57 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
58 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
59 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
60 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
61 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
62 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
63 2928037797 Variovorax sp. 1126 Isolate Unclassified
64 2928044640 Variovorax sp. 1128 Isolate Unclassified
65 2928051484 Variovorax sp. 1133 Isolate Unclassified
66 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
67 2928070936 Variovorax gossypii 1167 Isolate Unclassified
68 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
69 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
70 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
71 2928163908 Burkholderia sp. 567 Isolate Unclassified
72 2928170801 Burkholderia sp. 572 Isolate Unclassified
73 2928536128 Burkholderia sola 565 Isolate Unclassified
74 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
75 2929520902 Variovorax beijingensis 502 Isolate Unclassified
76 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
77 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
78 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
79 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
80 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
81 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
82 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
83 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
84 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
85 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
86 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
87 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
88 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
89 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
90 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
91 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
92 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
93 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
94 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
95 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
96 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
97 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
98 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
99 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
100 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
101 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
102 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
103 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
104 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
105 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
106 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
107 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
108 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
109 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
110 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
111 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
112 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
113 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
114 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
115 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
116 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
117 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
118 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
119 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
120 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
121 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
122 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
123 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
124 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
125 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
126 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
127 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
128 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
129 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
130 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
131 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
132 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
133 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
134 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
135 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
136 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
137 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
138 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
141 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
142 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
145 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
146 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
147 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
148 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
149 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
150 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
151 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
152 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
153 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
154 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
155 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
156 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
157 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
158 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
167 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
168 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
169 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
172 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
173 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
174 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
181 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
183 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
184 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
198 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
201 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
232 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
233 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
249 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
250 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
251 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
252 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
253 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
254 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
255 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
256 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
257 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
258 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
304 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
305 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
306 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
321 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
322 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
334 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
337 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
338 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
339 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
342 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
343 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
344 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
345 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
346 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
347 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
348 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
349 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
350 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
351 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
352 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
353 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
354 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
357 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
358 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
359 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
360 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.67
Metatranscriptomes 0.19
Isolates 17.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.19
Nodule 1.33
Rhizoplane 3.62
Rhizosphere 45.52
Stem 0
Stem Tuber 0
Unclassified 17.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005833 3300001979 Bacteria 5166
2 JGI24739J22299_10011382 3300001989 Bacteria 3286
3 JGI24739J22299_10018561 3300001989 Bacteria 2498
4 JGI25155J39150_1000030 3300002704 Bacteria 114492
5 JGI25155J39150_1000203 3300002704 Bacteria 24470
6 JGI25156J39149_1000059 3300002705 Bacteria 86130
7 JGI25162J39368_1005172 3300002737 Bacteria 2674
8 JGI25154J39366_1000056 3300002738 Bacteria 114494
9 JGI25154J39366_1000273 3300002738 Bacteria 31922
10 JGI25157J39369_1000615 3300002741 Bacteria 20275
11 JGI25152J39213_1003511 3300002773 Bacteria 5315
12 JGI25150J39212_1001615 3300002774 Bacteria 6140
13 JGI25151J46595_10001428 3300003187 Bacteria 16264
14 JGI25153J46596_10007572 3300003215 Bacteria 5315
15 rootH1_10123316 3300003316 Bacteria 1647
16 rootH2_10221804 3300003320 Bacteria 1580
17 rootH1_10019511 3300003323 Bacteria 1636
18 JGI25160J50197_1000554 3300003354 Bacteria 21181
19 JGI25160J50197_1012213 3300003354 Bacteria 2997
20 JGI25161J50226_1003431 3300003374 Bacteria 3625
21 Ga0006562J51391_1102716 3300003578 Bacteria 3320
22 Ga0055538_1000002 3300003751 Bacteria 999437
23 Ga0055539_1000002 3300003752 Bacteria 999437
24 Ga0055533_1000004 3300003756 Bacteria 999437
25 Ga0055532_1000059 3300003758 Bacteria 152948
26 Ga0055532_1000199 3300003758 Bacteria 49349
27 Ga0055532_1000717 3300003758 Bacteria 12333
28 Ga0055525_1000002 3300003759 Bacteria 999437
29 Ga0055527_1000810 3300003760 Bacteria 8427
30 Ga0055535_1000535 3300003761 Bacteria 32872
31 Ga0055535_1000948 3300003761 Bacteria 19240
32 Ga0055542_1000560 3300003762 Bacteria 32881
33 Ga0055542_1000806 3300003762 Bacteria 23135
34 Ga0055529_1000801 3300003763 Bacteria 19258
35 Ga0055526_1000577 3300003771 Bacteria 28807
36 Ga0055537_1000394 3300003773 Bacteria 29381
37 Ga0055537_1000411 3300003773 Bacteria 28094
38 Ga0055524_1000537 3300003775 Bacteria 28807
39 Ga0055524_1002376 3300003775 Bacteria 9764
40 Ga0055536_1001872 3300003781 Bacteria 12264
41 Ga0055536_1006150 3300003781 Bacteria 5676
42 Ga0055536_1010039 3300003781 Bacteria 3822
43 Ga0055534_1000131 3300003784 Bacteria 56581
44 Ga0055534_1001204 3300003784 Bacteria 10879
45 Ga0055528_1000568 3300003790 Bacteria 28094
46 Ga0055528_1000629 3300003790 Bacteria 26158
47 Ga0055528_1015616 3300003790 Bacteria 2733
48 Ga0055530_10004520 3300003791 Bacteria 7120
49 Ga0055540_1000555 3300003792 Bacteria 27644
50 Ga0055540_1007122 3300003792 Bacteria 4285
51 Ga0055540_1007985 3300003792 Bacteria 3884
52 Ga0055540_1012938 3300003792 Bacteria 2583
53 Ga0055540_1016168 3300003792 Bacteria 2136
54 Ga0055531_10011417 3300003794 Bacteria 4285
55 Ga0055541_1000002 3300003841 Bacteria 896405
56 Ga0055543_1000371 3300004625 Bacteria 29718
57 Ga0055543_1007531 3300004625 Bacteria 2502
58 Ga0065165_1023435 3300005262 Bacteria 2093
59 Ga0065714_10068637 3300005288 Bacteria 4614
60 Ga0065704_10077202 3300005289 Bacteria 4821
61 Ga0070660_100000642 3300005339 Bacteria 23150
62 Ga0070674_100171240 3300005356 Bacteria 1656
63 Ga0070673_100135399 3300005364 Bacteria 2073
64 Ga0070659_100000301 3300005366 Bacteria 38549
65 Ga0070667_100153461 3300005367 Bacteria 2025
66 Ga0070714_100063727 3300005435 Bacteria 3170
67 Ga0070663_100000215 3300005455 Bacteria 28937
68 Ga0070662_100009397 3300005457 Bacteria 6390
69 Ga0070697_100054420 3300005536 Bacteria 3252
70 Ga0068853_100030422 3300005539 Bacteria 4560
71 Ga0070672_100304384 3300005543 Bacteria 1352
72 Ga0070686_100125377 3300005544 Bacteria 1769
73 Ga0070695_100009985 3300005545 Bacteria 5662
74 Ga0070696_100005600 3300005546 Bacteria 8384
75 Ga0068855_100105073 3300005563 Bacteria 3247
76 Ga0068855_100254800 3300005563 Bacteria 1957
77 Ga0070664_100062883 3300005564 Bacteria 3165
78 Ga0068854_100009221 3300005578 Bacteria 6368
79 Ga0068856_100061126 3300005614 Bacteria 3721
80 Ga0068856_100183666 3300005614 Bacteria 2105
81 Ga0068852_100001123 3300005616 Bacteria 17688
82 Ga0068852_100005851 3300005616 Bacteria 8833
83 Ga0068852_100161316 3300005616 Bacteria 2094
84 Ga0068851_10016681 3300005834 Bacteria 3519
85 Ga0081539_10000539 3300005985 Bacteria 78266
86 Ga0075365_10074298 3300006038 Bacteria 2292
87 Ga0075365_10133302 3300006038 Bacteria 1720
88 Ga0075362_10009225 3300006177 Bacteria 3806
89 Ga0075366_10015640 3300006195 Bacteria 4353
90 Ga0075366_10040157 3300006195 Bacteria 2767
91 Ga0075370_10009646 3300006353 Bacteria 5023
92 Ga0075370_10026273 3300006353 Bacteria 3224
93 Ga0075370_10127177 3300006353 Bacteria 1486
94 Ga0075436_100004775 3300006914 Bacteria 9306
95 Ga0075436_100037117 3300006914 Bacteria 3365
96 Ga0099826_10018596 3300006948 Bacteria 5241
97 Ga0105251_10037674 3300009011 Bacteria 2371
98 Ga0105250_10022688 3300009092 Bacteria 2529
99 Ga0105240_10000787 3300009093 Bacteria 57466
100 Ga0105240_10003701 3300009093 Bacteria 23628
101 Ga0105240_10007279 3300009093 Bacteria 16110
102 Ga0105240_10121567 3300009093 Bacteria 3143
103 Ga0105240_10123993 3300009093 Bacteria 3107
104 Ga0105240_10310942 3300009093 Bacteria 1799
105 Ga0114129_10152988 3300009147 Bacteria 3156
106 Ga0105243_10004570 3300009148 Bacteria 10923
107 Ga0105243_10181848 3300009148 Bacteria 1829
108 Ga0105237_10015344 3300009545 Bacteria 7978
109 Ga0105238_10005545 3300009551 Bacteria 12464
110 Ga0105238_10023167 3300009551 Bacteria 6332
111 Ga0105239_10071083 3300010375 Bacteria 3823
112 Ga0105239_10306954 3300010375 Bacteria 1788
113 Ga0157373_10006492 3300013100 Bacteria 8728
114 Ga0157370_10008731 3300013104 Bacteria 10900
115 Ga0157369_10049761 3300013105 Bacteria 4541
116 Ga0157369_10055393 3300013105 Bacteria 4281
117 Ga0157369_10272837 3300013105 Bacteria 1762
118 Ga0163162_10042797 3300013306 Bacteria 4534
119 Ga0163162_10059083 3300013306 Bacteria 3866
120 Ga0157372_10266119 3300013307 Bacteria 1991
121 Ga0182008_10000139 3300014497 Bacteria 55735
122 Ga0182008_10000998 3300014497 Bacteria 19680
123 Ga0182008_10001824 3300014497 Bacteria 13887
124 Ga0182008_10005011 3300014497 Bacteria 7621
125 Ga0182008_10024549 3300014497 Bacteria 3068
126 Ga0182008_10093273 3300014497 Bacteria 1485
127 Ga0182006_1000010 3300015261 Bacteria 413414
128 Ga0182006_1008590 3300015261 Bacteria 4628
129 Ga0182006_1048993 3300015261 Bacteria 1632
130 Ga0182007_10000021 3300015262 Bacteria 193408
131 Ga0182007_10000383 3300015262 Bacteria 27816
132 Ga0182007_10005424 3300015262 Bacteria 5605
133 Ga0182007_10009478 3300015262 Bacteria 3919
134 Ga0182005_1000009 3300015265 Bacteria 455334
135 Ga0182005_1000361 3300015265 Bacteria 25411
136 Ga0183362_10003 3300015683 Bacteria 977584
137 Ga0163161_10011509 3300017792 Bacteria 6140
138 Ga0163161_10012165 3300017792 Bacteria 5968
139 Ga0163161_10016177 3300017792 Bacteria 5207
140 Ga0213872_10001060 3300021361 Bacteria 19085
141 Ga0209435_100032 3300025206 Bacteria 153068
142 Ga0209435_100111 3300025206 Bacteria 31379
143 Ga0209436_103849 3300025208 Bacteria 3839
144 Ga0209436_105762 3300025208 Bacteria 2803
145 Ga0209784_100002 3300025224 Bacteria 1753105
146 Ga0209566_100003 3300025225 Bacteria 1753105
147 Ga0209566_100503 3300025225 Bacteria 27100
148 Ga0209674_100004 3300025226 Bacteria 1753105
149 Ga0209672_100145 3300025228 Bacteria 66093
150 Ga0209672_103456 3300025228 Bacteria 3266
151 Ga0209147_100109 3300025229 Bacteria 153068
152 Ga0209147_100201 3300025229 Bacteria 65943
153 Ga0209147_100258 3300025229 Bacteria 49401
154 Ga0209147_101536 3300025229 Bacteria 7998
155 Ga0209563_100006 3300025230 Bacteria 1753105
156 Ga0209437_100261 3300025233 Bacteria 82127
157 Ga0209258_100190 3300025242 Bacteria 126878
158 Ga0209258_100350 3300025242 Bacteria 66093
159 Ga0209258_100556 3300025242 Bacteria 32949
160 Ga0207425_1000394 3300025245 Bacteria 29469
161 Ga0207425_1009497 3300025245 Bacteria 2414
162 Ga0209646_1000052 3300025246 Bacteria 286370
163 Ga0209646_1000113 3300025246 Bacteria 153068
164 Ga0209026_1000102 3300025250 Bacteria 153068
165 Ga0209026_1003192 3300025250 Bacteria 5550
166 Ga0209677_100003 3300025253 Bacteria 1753105
167 Ga0209148_1000327 3300025254 Bacteria 65997
168 Ga0209148_1000589 3300025254 Bacteria 33096
169 Ga0209759_1000104 3300025256 Bacteria 153068
170 Ga0209759_1000303 3300025256 Bacteria 67661
171 Ga0209129_1000033 3300025258 Bacteria 336894
172 Ga0209129_1006735 3300025258 Bacteria 3622
173 Ga0209565_1000164 3300025263 Bacteria 86911
174 Ga0209565_1000188 3300025263 Bacteria 75532
175 Ga0209565_1007477 3300025263 Bacteria 2944
176 Ga0209565_1007562 3300025263 Bacteria 2919
177 Ga0209455_1000248 3300025272 Bacteria 65943
178 Ga0209455_1005766 3300025272 Bacteria 3765
179 Ga0209673_1000057 3300025273 Bacteria 270150
180 Ga0209673_1000185 3300025273 Bacteria 125742
181 Ga0209673_1000344 3300025273 Bacteria 85344
182 Ga0209673_1000411 3300025273 Bacteria 75532
183 Ga0209673_1014114 3300025273 Bacteria 3109
184 Ga0209673_1017713 3300025273 Bacteria 2618
185 Ga0209130_1000402 3300025284 Bacteria 47370
186 Ga0209130_1000663 3300025284 Bacteria 31315
187 Ga0209130_1001742 3300025284 Bacteria 12970
188 Ga0209130_1014734 3300025284 Bacteria 1952
189 Ga0209675_1000172 3300025291 Bacteria 75532
190 Ga0209675_1004172 3300025291 Bacteria 6543
191 Ga0209675_1007309 3300025291 Bacteria 4261
192 Ga0209676_1000179 3300025292 Bacteria 150096
193 Ga0209676_1000505 3300025292 Bacteria 61665
194 Ga0209676_1009118 3300025292 Bacteria 4324
195 Ga0209676_1011844 3300025292 Bacteria 3479
196 Ga0209676_1013053 3300025292 Bacteria 3216
197 Ga0209676_1022540 3300025292 Bacteria 2084
198 Ga0209025_1000244 3300025294 Bacteria 127938
199 Ga0209025_1000541 3300025294 Bacteria 71090
200 Ga0209025_1001083 3300025294 Bacteria 39415
201 Ga0209025_1013087 3300025294 Bacteria 5243
202 Ga0209564_1000317 3300025295 Bacteria 93914
203 Ga0209564_1000538 3300025295 Bacteria 61260
204 Ga0209564_1008883 3300025295 Bacteria 4883
205 Ga0209758_1000027 3300025297 Bacteria 549650
206 Ga0209758_1009169 3300025297 Bacteria 6226
207 Ga0209758_1011168 3300025297 Bacteria 5243
208 Ga0209050_1000172 3300025298 Bacteria 150096
209 Ga0209050_1011068 3300025298 Bacteria 4337
210 Ga0209050_1018599 3300025298 Bacteria 2689
211 Ga0209256_1000069 3300025299 Bacteria 245640
212 Ga0209256_1000261 3300025299 Bacteria 93914
213 Ga0209256_1016965 3300025299 Bacteria 2449
214 Ga0207426_1000027 3300025302 Bacteria 513176
215 Ga0207426_1000115 3300025302 Bacteria 227423
216 Ga0209051_1000025 3300025303 Bacteria 415397
217 Ga0209051_1000046 3300025303 Bacteria 296424
218 Ga0209051_1000183 3300025303 Bacteria 113192
219 Ga0209051_1000240 3300025303 Bacteria 92221
220 Ga0209051_1000331 3300025303 Bacteria 71198
221 Ga0209051_1010425 3300025303 Bacteria 4694
222 Ga0209051_1013459 3300025303 Bacteria 3893
223 Ga0209257_1000039 3300025304 Bacteria 591694
224 Ga0209257_1000410 3300025304 Bacteria 83167
225 Ga0209257_1000716 3300025304 Bacteria 50931
226 Ga0209257_1008249 3300025304 Bacteria 5992
227 Ga0209257_1010840 3300025304 Bacteria 4516
228 Ga0207656_10013906 3300025321 Bacteria 3088
229 Ga0207696_1033864 3300025711 Bacteria 1529
230 Ga0207655_1003427 3300025728 Bacteria 11812
231 Ga0207680_10086556 3300025903 Bacteria 1982
232 Ga0207647_10121018 3300025904 Bacteria 1543
233 Ga0207695_10000377 3300025913 Bacteria 101452
234 Ga0207695_10001940 3300025913 Bacteria 32143
235 Ga0207695_10003192 3300025913 Bacteria 23356
236 Ga0207695_10020180 3300025913 Bacteria 7640
237 Ga0207671_10034267 3300025914 Bacteria 3773
238 Ga0207671_10244871 3300025914 Bacteria 1409
239 Ga0207657_10000003 3300025919 Bacteria 263148
240 Ga0207681_10262386 3300025923 Bacteria 1353
241 Ga0207694_10033054 3300025924 Bacteria 3962
242 Ga0207694_10041863 3300025924 Bacteria 3531
243 Ga0207694_10105507 3300025924 Bacteria 2237
244 Ga0207687_10272316 3300025927 Bacteria 1354
245 Ga0207690_10000007 3300025932 Bacteria 388533
246 Ga0207706_10015133 3300025933 Bacteria 6981
247 Ga0207709_10000341 3300025935 Bacteria 48317
248 Ga0207709_10000705 3300025935 Bacteria 26910
249 Ga0207679_10000531 3300025945 Bacteria 25768
250 Ga0207667_10011408 3300025949 Bacteria 10328
251 Ga0207667_10015142 3300025949 Bacteria 8770
252 Ga0207667_10024478 3300025949 Bacteria 6629
253 Ga0207651_10107598 3300025960 Bacteria 2085
254 Ga0207658_10088057 3300025986 Bacteria 2399
255 Ga0207639_10054651 3300026041 Bacteria 3053
256 Ga0207678_10000792 3300026067 Bacteria 28960
257 Ga0207648_10198784 3300026089 Bacteria 1778
258 Ga0207683_10026080 3300026121 Bacteria 5046
259 Ga0207698_10001463 3300026142 Bacteria 13735
260 Ga0207698_10006782 3300026142 Bacteria 7158
261 Ga0209371_1000292 3300027312 Bacteria 57076
262 Ga0209282_1005897 3300027666 Bacteria 7575
263 Ga0268265_10090411 3300028380 Bacteria 2445
264 Ga0265319_1045668 3300028563 Bacteria 1463
265 Ga0307515_10000026 3300028794 Bacteria 382411
266 Ga0307515_10000132 3300028794 Bacteria 176547
267 Ga0307515_10003144 3300028794 Bacteria 34920
268 Ga0307515_10036691 3300028794 Bacteria 7919
269 Ga0307515_10145233 3300028794 Bacteria 2517
270 Ga0268256_1000255 3300030500 Bacteria 56398
271 Ga0316179_1091897 3300030734 Bacteria 3151
272 Ga0316183_1009761 3300030742 Bacteria 5399
273 Ga0307513_10016875 3300031456 Bacteria 8782
274 Ga0307408_100005473 3300031548 Bacteria 8493
275 Ga0307408_100156926 3300031548 Bacteria 1803
276 Ga0307514_10021962 3300031649 Bacteria 5196
277 Ga0307405_10048682 3300031731 Bacteria 2615
278 Ga0307405_10275199 3300031731 Bacteria 1264
279 Ga0307406_10000563 3300031901 Bacteria 21360
280 Ga0307412_10063494 3300031911 Bacteria 2491
281 Ga0307412_10131144 3300031911 Bacteria 1820
282 Ga0307414_10059682 3300032004 Bacteria 2694
283 Ga0307414_10190040 3300032004 Bacteria 1660
284 Ga0395899_0007757 3300037312 Bacteria 8276
285 Ga0395899_0046541 3300037312 Bacteria 3231
286 Ga0395899_0060359 3300037312 Bacteria 2794
287 Ga0395900_0007104 3300037418 Bacteria 11599
288 Ga0395900_0033785 3300037418 Bacteria 5263
289 Ga0395898_0005632 3300037466 Bacteria 13499
290 Ga0395898_0041621 3300037466 Bacteria 4537
291 Ga0395905_0189170 3300037471 Bacteria 1931
292 Ga0395901_0016202 3300038443 Bacteria 7594
293 Ga0395901_0027852 3300038443 Bacteria 5810
294 Ga0395901_0063807 3300038443 Bacteria 3834
295 Ga0395901_0309931 3300038443 Bacteria 1635
296 Ga0395901_0587631 3300038443 Bacteria 1124
297 Ga0436360_0945601 3300039438 Bacteria 1608
298 Ga0436361_0443921 3300039447 Bacteria 5573
299 Ga0439436_0012107 3300041404 Bacteria 2618
300 Ga0439465_0032357 3300041413 Bacteria 1670
301 Ga0439431_0006257 3300041997 Bacteria 2628
302 Ga0439433_0004365 3300041999 Bacteria 3049
303 Ga0439449_0002195 3300042007 Bacteria 7684
304 Ga0439452_014481 3300042010 Bacteria 2189
305 Ga0439462_0001878 3300042015 Bacteria 4771
306 Ga0450894_001918 3300042131 Bacteria 2874
307 Ga0450898_006192 3300042134 Bacteria 1830
308 Ga0439434_0002314 3300042435 Bacteria 5539
309 Ga0450918_002432 3300042531 Bacteria 3520
310 Ga0466965_0012361 3300044683 Bacteria 4013
311 Ga0466963_0016130 3300044694 Bacteria 4641
312 Ga0451576_0305095 3300045051 Bacteria 1665
313 Ga0495627_000342 3300046453 Bacteria 43925
314 Ga0495627_015031 3300046453 Bacteria 2681
315 Ga0495638_0008651 3300046460 Bacteria 7200
316 Ga0495651_0006540 3300046462 Bacteria 8901
317 Ga0495651_0077466 3300046462 Bacteria 2517
318 Ga0495650_0001133 3300046471 Bacteria 28973
319 Ga0495580_0004320 3300046472 Bacteria 11941
320 Ga0495607_0012464 3300046501 Bacteria 5612
321 Ga0495616_0000607 3300046513 Bacteria 27000
322 Ga0495631_0000086 3300046518 Bacteria 59927
323 Ga0495637_0043703 3300046520 Bacteria 1911
324 Ga0495643_0031117 3300046522 Bacteria 2973
325 Ga0495652_0105157 3300046529 Bacteria 2281
326 Ga0495654_0007379 3300046530 Bacteria 6143
327 Ga0495654_0057108 3300046530 Bacteria 1886
328 Ga0495654_0061431 3300046530 Bacteria 1804
329 Ga0495622_0015332 3300046557 Bacteria 3563
330 Ga0495633_0000751 3300046558 Bacteria 29251
331 Ga0495667_0097340 3300046559 Bacteria 1905
332 Ga0495668_0008641 3300046616 Bacteria 6332
333 Ga0495611_0041359 3300046648 Bacteria 2056
334 Ga0495625_0000416 3300046660 Bacteria 64225
335 Ga0495625_0000606 3300046660 Bacteria 52107
336 Ga0495625_0021343 3300046660 Bacteria 4988
337 Ga0495661_0074891 3300046665 Bacteria 1969
338 Ga0495588_0018285 3300046674 Bacteria 3415
339 Ga0495657_0190417 3300046675 Bacteria 1254
340 Ga0495669_0024465 3300046684 Bacteria 2630
341 Ga0495624_0033244 3300046690 Bacteria 3340
342 Ga0495671_0009027 3300046692 Bacteria 5595
343 Ga0495600_0122886 3300046809 Bacteria 1688
344 Ga0495660_0097066 3300046810 Bacteria 1522
345 Ga0495604_0012892 3300047317 Bacteria 6659
346 Ga0495672_0018732 3300047320 Bacteria 4585
347 Ga0495681_0000061 3300047470 Bacteria 99933
348 Ga0495686_0000044 3300047472 Bacteria 288079
349 Ga0495602_0025261 3300048088 Bacteria 5750
350 Ga0495602_0111793 3300048088 Bacteria 2218
351 Ga0495614_0020553 3300048089 Bacteria 2853
352 Ga0496101_0023970 3300048904 Bacteria 4220
353 Ga0496101_0120836 3300048904 Bacteria 1980
354 Ga0496102_0112308 3300048905 Bacteria 2541
355 Ga0496104_0110326 3300048907 Bacteria 2637
356 Ga0496105_0007279 3300048908 Bacteria 8550
357 Ga0496108_0119180 3300048911 Bacteria 2263
358 Ga0496110_0408691 3300048913 Bacteria 1237
359 Ga0496111_0102790 3300048914 Bacteria 2101
360 Ga0496111_0151420 3300048914 Bacteria 1720
361 Ga0496112_0000069 3300048915 Bacteria 68177
362 Ga0496114_0201424 3300048917 Bacteria 1743
363 Ga0496116_0003223 3300048919 Bacteria 16271
364 Ga0496116_0034141 3300048919 Bacteria 3595
365 Ga0496116_0038279 3300048919 Bacteria 3332
366 Ga0496116_0104016 3300048919 Bacteria 1688
367 Ga0496117_0000010 3300048920 Bacteria 611954
368 Ga0496118_0000009 3300048921 Bacteria 611954
369 Ga0496118_0026347 3300048921 Bacteria 4956
370 Ga0496119_0047083 3300048922 Bacteria 2686
371 Ga0496121_0002276 3300048924 Bacteria 29886
372 Ga0496121_0020373 3300048924 Bacteria 6571
373 Ga0496121_0022092 3300048924 Bacteria 6193
374 Ga0496121_0194880 3300048924 Bacteria 1449
375 Ga0496122_0000225 3300048925 Bacteria 126304
376 Ga0496122_0000890 3300048925 Bacteria 55628
377 Ga0496123_0000192 3300048926 Bacteria 124096
378 Ga0496123_0001424 3300048926 Bacteria 33453
379 Ga0496124_0047616 3300048927 Bacteria 3667
380 Ga0496125_0001640 3300048928 Bacteria 31557
381 Ga0496125_0008898 3300048928 Bacteria 10428
382 Ga0496125_0050396 3300048928 Bacteria 3447
383 Ga0496125_0052377 3300048928 Bacteria 3356
384 Ga0496126_0018925 3300048929 Bacteria 6803
385 Ga0501034_0155478 3300049571 Bacteria 2261
386 Ga0501042_0102889 3300049578 Bacteria 2055
387 Ga0501043_0000053 3300049579 Bacteria 106085
388 Ga0501046_0001410 3300049580 Bacteria 23115
389 Ga0501047_0000020 3300049581 Bacteria 259377
390 Ga0501048_0000933 3300049582 Bacteria 21585
391 Ga0501072_0132554 3300049588 Bacteria 1987
392 Ga0501249_001320 3300049679 Bacteria 5161
393 Ga0501225_0005261 3300049705 Bacteria 3809
394 Ga0501262_000730 3300049759 Bacteria 3798
395 Ga0501045_0003120 3300049824 Bacteria 11332
396 nmdc:mga03683_1238_c1 3300050489 Bacteria 7551
397 nmdc:mga03683_4945_c1 3300050489 Bacteria 4459
398 nmdc:mga00v17_4436_c1 3300050491 Bacteria 7304
399 nmdc:mga0yw44_146914_c1 3300050492 Bacteria 1536
400 nmdc:mga0k408_23251_c1 3300050493 Bacteria 3495
401 nmdc:mga07m45_10784_c1 3300050496 Bacteria 4785
402 nmdc:mga07m45_16430_c1 3300050496 Bacteria 3962
403 nmdc:mga07m45_445_c1 3300050496 Bacteria 17245
404 nmdc:mga05p37_464611_c1 3300050507 Bacteria 1461
405 nmdc:mga09592_158812_c1 3300050508 Bacteria 1952
406 nmdc:mga0n895_139830_c1 3300050512 Bacteria 2449
407 nmdc:mga08x19_48901_c1 3300050514 Bacteria 2710
408 Ga0500643_012974 3300053087 Bacteria 2964
409 Ga0500651_0000037 3300053093 Bacteria 103433
410 Ga0500566_0049319 3300053094 Bacteria 2412
411 Ga0500562_001112 3300053108 Bacteria 6609
412 Ga0500562_006225 3300053108 Bacteria 3011
413 Ga0500562_015316 3300053108 Bacteria 1966
414 Ga0500569_027490 3300053109 Bacteria 1568
415 Ga0500571_000011 3300053110 Bacteria 77816
416 Ga0500593_001317 3300053117 Bacteria 8953
417 Ga0500595_000811 3300053119 Bacteria 18044
418 Ga0500607_000595 3300053121 Bacteria 34809
419 Ga0500618_000308 3300053125 Bacteria 36190
420 Ga0500618_002059 3300053125 Bacteria 8104
421 Ga0500626_021641 3300053128 Bacteria 2869
422 Ga0500655_002414 3300053133 Bacteria 3417
423 Ga0500658_0000235 3300053134 Bacteria 25856
424 Ga0500658_0002728 3300053134 Bacteria 6790
425 Ga0500559_0007106 3300053136 Bacteria 4991
426 Ga0500568_0002005 3300053139 Bacteria 12398
427 Ga0500574_010678 3300053141 Bacteria 2045
428 Ga0500616_0094159 3300053153 Bacteria 1476
429 Ga0500627_0007511 3300053158 Bacteria 3803
430 Ga0500634_0020927 3300053161 Bacteria 3541
431 Ga0500634_0077580 3300053161 Bacteria 1721
432 Ga0500638_002028 3300053162 Bacteria 6830
433 Ga0500636_0061711 3300053177 Bacteria 2187
434 Ga0500570_000097 3300053724 Bacteria 24774
435 Ga0500645_031501 3300053730 Bacteria 1593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003784 Ga0055534_1001204 Ga0055534_10012042 293
2 3300009147 Ga0114129_10152988 Ga0114129_101529882 330
3 3300050507 nmdc:mga05p37_464611_c1 nmdc:mga05p37_464611_c1_165_1184 330
4 3300046684 Ga0495669_0024465 Ga0495669_0024465_411_1412 333
5 3300048914 Ga0496111_0151420 Ga0496111_0151420_389_1402 337
6 3300048924 Ga0496121_0020373 Ga0496121_0020373_938_1957 338
7 3300005536 Ga0070697_100054420 Ga0070697_1000544202 339
8 3300005545 Ga0070695_100009985 Ga0070695_1000099855 339
9 3300005546 Ga0070696_100005600 Ga0070696_1000056005 339
10 3300006914 Ga0075436_100037117 Ga0075436_1000371173 339
11 3300044694 Ga0466963_0016130 Ga0466963_0016130_25_1113 339
12 3300005985 Ga0081539_10000539 Ga0081539_1000053949 341
13 3300050512 nmdc:mga0n895_139830_c1 nmdc:mga0n895_139830_c1_465_1490 341
14 3300050514 nmdc:mga08x19_48901_c1 nmdc:mga08x19_48901_c1_1519_2544 341
15 3300053108 Ga0500562_001112 Ga0500562_001112_5292_6350 341
16 3300048911 Ga0496108_0119180 Ga0496108_0119180_393_1430 342
17 3300049588 Ga0501072_0132554 Ga0501072_0132554_787_1815 342
18 iso_pu_bacteria 2928115317 2928119303 343
19 3300003792 Ga0055540_1016168 Ga0055540_10161682 345
20 3300025273 Ga0209673_1014114 Ga0209673_10141142 345
21 3300025303 Ga0209051_1000025 Ga0209051_1000025370 345
22 3300025304 Ga0209257_1000039 Ga0209257_1000039238 345
23 3300028794 Ga0307515_10036691 Ga0307515_100366917 345
24 3300031456 Ga0307513_10016875 Ga0307513_100168755 345
25 3300037312 Ga0395899_0007757 Ga0395899_0007757_4524_5561 345
26 3300037466 Ga0395898_0041621 Ga0395898_0041621_233_1270 345
27 3300038443 Ga0395901_0063807 Ga0395901_0063807_2610_3647 345
28 iso_pu_bacteria 2894772417 2894772957 345
29 3300005435 Ga0070714_100063727 Ga0070714_1000637274 346
30 3300006914 Ga0075436_100004775 Ga0075436_1000047759 346
31 3300028794 Ga0307515_10000132 Ga0307515_10000132123 346
32 3300039438 Ga0436360_0945601 Ga0436360_0945601_14_1054 346
33 3300028794 Ga0307515_10000026 Ga0307515_1000002632 347
34 iso_pu_bacteria 2600255292 2601666703 347
35 iso_pu_bacteria 2945972063 2945974174 347
36 iso_pu_bacteria 2857547612 2857548469 348
37 iso_pu_bacteria 2932410948 2932413062 348
38 iso_pu_bacteria 2932416698 2932420577 348
39 3300006038 Ga0075365_10133302 Ga0075365_101333022 349
40 3300017792 Ga0163161_10016177 Ga0163161_100161775 350
41 3300025284 Ga0209130_1001742 Ga0209130_10017428 350
42 3300025291 Ga0209675_1004172 Ga0209675_10041724 350
43 3300025292 Ga0209676_1013053 Ga0209676_10130532 350
44 3300025304 Ga0209257_1010840 Ga0209257_10108402 350
45 3300046674 Ga0495588_0018285 Ga0495588_0018285_1194_2246 350
46 3300048088 Ga0495602_0111793 Ga0495602_0111793_248_1300 350
47 3300048089 Ga0495614_0020553 Ga0495614_0020553_423_1475 350
48 3300053087 Ga0500643_012974 Ga0500643_012974_1756_2808 350
49 3300053093 Ga0500651_0000037 Ga0500651_0000037_49572_50624 350
50 3300053094 Ga0500566_0049319 Ga0500566_0049319_447_1499 350
51 3300053108 Ga0500562_006225 Ga0500562_006225_915_1967 350
52 3300053134 Ga0500658_0000235 Ga0500658_0000235_2184_3236 350
53 3300053134 Ga0500658_0002728 Ga0500658_0002728_2522_3574 350
54 3300053139 Ga0500568_0002005 Ga0500568_0002005_9676_10728 350
55 3300053153 Ga0500616_0094159 Ga0500616_0094159_42_1094 350
56 3300053161 Ga0500634_0077580 Ga0500634_0077580_471_1523 350
57 3300014497 Ga0182008_10000139 Ga0182008_1000013942 351
58 3300015261 Ga0182006_1000010 Ga0182006_1000010278 351
59 3300015262 Ga0182007_10000021 Ga0182007_1000002167 351
60 3300015265 Ga0182005_1000009 Ga0182005_1000009107 351
61 3300025273 Ga0209673_1017713 Ga0209673_10177132 351
62 3300028380 Ga0268265_10090411 Ga0268265_100904113 351
63 3300028794 Ga0307515_10145233 Ga0307515_101452333 351
64 3300037471 Ga0395905_0189170 Ga0395905_0189170_496_1563 351
65 3300038443 Ga0395901_0309931 Ga0395901_0309931_463_1530 351
66 3300048919 Ga0496116_0104016 Ga0496116_0104016_259_1314 351
67 3300048920 Ga0496117_0000010 Ga0496117_0000010_488750_489805 351
68 3300048921 Ga0496118_0000009 Ga0496118_0000009_122150_123205 351
69 3300048924 Ga0496121_0002276 Ga0496121_0002276_17797_18852 351
70 3300048925 Ga0496122_0000890 Ga0496122_0000890_32420_33475 351
71 3300048926 Ga0496123_0001424 Ga0496123_0001424_13872_14927 351
72 iso_pu_bacteria 2511231003 2511248226 351
73 3300046501 Ga0495607_0012464 Ga0495607_0012464_3258_4316 352
74 3300053108 Ga0500562_015316 Ga0500562_015316_699_1775 352
75 3300042134 Ga0450898_006192 Ga0450898_006192_18_1103 353
76 3300046472 Ga0495580_0004320 Ga0495580_0004320_2369_3466 353
77 iso_pu_bacteria 2511231026 2511386285 353
78 iso_pu_bacteria 2551306416 2553003434 353
79 iso_pu_bacteria 2738543012 2739240880 353
80 iso_pu_bacteria 2816332133 2816472041 353
81 iso_pu_bacteria 2818991445 2819594882 353
82 iso_pu_bacteria 2884811622 2884811714 353
83 iso_pu_bacteria 2884836552 2884838297 353
84 iso_pu_bacteria 2884852848 2884854589 353
85 iso_pu_bacteria 2885080285 2885084496 353
86 iso_pu_bacteria 2896154374 2896156743 353
87 iso_pu_bacteria 2919046199 2919046828 353
88 3300005544 Ga0070686_100125377 Ga0070686_1001253772 354
89 3300006195 Ga0075366_10015640 Ga0075366_100156405 354
90 3300017792 Ga0163161_10011509 Ga0163161_100115096 354
91 3300026089 Ga0207648_10198784 Ga0207648_101987842 354
92 3300032004 Ga0307414_10190040 Ga0307414_101900402 354
93 3300038443 Ga0395901_0587631 Ga0395901_0587631_11_1084 354
94 3300045051 Ga0451576_0305095 Ga0451576_0305095_200_1276 354
95 3300048915 Ga0496112_0000069 Ga0496112_0000069_15654_16718 354
96 3300002704 JGI25155J39150_1000203 JGI25155J39150_10002038 355
97 3300002738 JGI25154J39366_1000273 JGI25154J39366_100027311 355
98 3300009093 Ga0105240_10007279 Ga0105240_100072795 355
99 3300025206 Ga0209435_100111 Ga0209435_10011118 355
100 3300025246 Ga0209646_1000052 Ga0209646_1000052123 355
101 3300025250 Ga0209026_1003192 Ga0209026_10031922 355
102 3300025256 Ga0209759_1000303 Ga0209759_100030333 355
103 3300025913 Ga0207695_10020180 Ga0207695_100201802 355
104 3300028794 Ga0307515_10003144 Ga0307515_1000314419 355
105 3300048924 Ga0496121_0194880 Ga0496121_0194880_174_1241 355
106 iso_pu_bacteria 2738543013 2739249924 355
107 iso_pu_bacteria 2904439833 2904445068 355
108 iso_pu_bacteria 2904530477 2904534104 355
109 iso_pu_bacteria 2904584206 2904589055 355
110 iso_pu_bacteria 2904589729 2904590464 355
111 iso_pu_bacteria 2904601388 2904603662 355
112 iso_pu_bacteria 2919079590 2919080326 355
113 3300002704 JGI25155J39150_1000030 JGI25155J39150_100003027 356
114 3300002705 JGI25156J39149_1000059 JGI25156J39149_100005965 356
115 3300002737 JGI25162J39368_1005172 JGI25162J39368_10051723 356
116 3300002738 JGI25154J39366_1000056 JGI25154J39366_100005627 356
117 3300002741 JGI25157J39369_1000615 JGI25157J39369_10006154 356
118 3300003751 Ga0055538_1000002 Ga0055538_1000002166 356
119 3300003752 Ga0055539_1000002 Ga0055539_1000002166 356
120 3300003756 Ga0055533_1000004 Ga0055533_1000004166 356
121 3300003758 Ga0055532_1000059 Ga0055532_100005963 356
122 3300003759 Ga0055525_1000002 Ga0055525_1000002166 356
123 3300003841 Ga0055541_1000002 Ga0055541_1000002675 356
124 3300005356 Ga0070674_100171240 Ga0070674_1001712401 356
125 3300006177 Ga0075362_10009225 Ga0075362_100092254 356
126 3300014497 Ga0182008_10024549 Ga0182008_100245492 356
127 3300021361 Ga0213872_10001060 Ga0213872_1000106014 356
128 3300025206 Ga0209435_100032 Ga0209435_10003280 356
129 3300025224 Ga0209784_100002 Ga0209784_100002400 356
130 3300025225 Ga0209566_100003 Ga0209566_100003400 356
131 3300025226 Ga0209674_100004 Ga0209674_100004400 356
132 3300025229 Ga0209147_100109 Ga0209147_10010980 356
133 3300025230 Ga0209563_100006 Ga0209563_100006400 356
134 3300025233 Ga0209437_100261 Ga0209437_10026158 356
135 3300025242 Ga0209258_100190 Ga0209258_10019053 356
136 3300025246 Ga0209646_1000113 Ga0209646_100011380 356
137 3300025250 Ga0209026_1000102 Ga0209026_100010280 356
138 3300025253 Ga0209677_100003 Ga0209677_100003400 356
139 3300025256 Ga0209759_1000104 Ga0209759_100010480 356
140 3300025272 Ga0209455_1005766 Ga0209455_10057662 356
141 3300031911 Ga0307412_10063494 Ga0307412_100634942 356
142 3300039447 Ga0436361_0443921 Ga0436361_0443921_2459_3532 356
143 3300041404 Ga0439436_0012107 Ga0439436_0012107_261_1340 356
144 3300041997 Ga0439431_0006257 Ga0439431_0006257_183_1262 356
145 3300041999 Ga0439433_0004365 Ga0439433_0004365_1044_2123 356
146 3300042007 Ga0439449_0002195 Ga0439449_0002195_3634_4713 356
147 3300042010 Ga0439452_014481 Ga0439452_014481_118_1197 356
148 3300042015 Ga0439462_0001878 Ga0439462_0001878_1456_2535 356
149 3300042131 Ga0450894_001918 Ga0450894_001918_942_2021 356
150 3300042435 Ga0439434_0002314 Ga0439434_0002314_2549_3628 356
151 3300046530 Ga0495654_0057108 Ga0495654_0057108_141_1211 356
152 3300046557 Ga0495622_0015332 Ga0495622_0015332_609_1679 356
153 3300046558 Ga0495633_0000751 Ga0495633_0000751_15023_16093 356
154 3300050489 nmdc:mga03683_4945_c1 nmdc:mga03683_4945_c1_1325_2404 356
155 3300050493 nmdc:mga0k408_23251_c1 nmdc:mga0k408_23251_c1_548_1651 356
156 iso_pu_bacteria 2818991436 2819541900 356
157 3300013105 Ga0157369_10049761 Ga0157369_100497614 357
158 3300044683 Ga0466965_0012361 Ga0466965_0012361_458_1603 357
159 3300049578 Ga0501042_0102889 Ga0501042_0102889_948_2021 357
160 3300049579 Ga0501043_0000053 Ga0501043_0000053_96283_97356 357
161 3300049580 Ga0501046_0001410 Ga0501046_0001410_4878_5951 357
162 3300049581 Ga0501047_0000020 Ga0501047_0000020_7742_8815 357
163 3300049582 Ga0501048_0000933 Ga0501048_0000933_7742_8815 357
164 3300049824 Ga0501045_0003120 Ga0501045_0003120_7742_8815 357
165 iso_pu_bacteria 2818991449 2819614370 357
166 iso_pu_bacteria 2842324504 2842327381 357
167 iso_pu_bacteria 2842348783 2842352012 357
168 iso_pu_bacteria 2842454564 2842458255 357
169 iso_pu_bacteria 2939631187 2939632710 357
170 3300005543 Ga0070672_100304384 Ga0070672_1003043841 358
171 3300005563 Ga0068855_100105073 Ga0068855_1001050732 358
172 3300005563 Ga0068855_100254800 Ga0068855_1002548002 358
173 3300005578 Ga0068854_100009221 Ga0068854_1000092213 358
174 3300005614 Ga0068856_100061126 Ga0068856_1000611263 358
175 3300005616 Ga0068852_100161316 Ga0068852_1001613163 358
176 3300009093 Ga0105240_10310942 Ga0105240_103109422 358
177 3300009148 Ga0105243_10181848 Ga0105243_101818482 358
178 3300009545 Ga0105237_10015344 Ga0105237_100153443 358
179 3300009551 Ga0105238_10023167 Ga0105238_100231674 358
180 3300010375 Ga0105239_10071083 Ga0105239_100710832 358
181 3300013105 Ga0157369_10272837 Ga0157369_102728372 358
182 3300013307 Ga0157372_10266119 Ga0157372_102661192 358
183 3300025904 Ga0207647_10121018 Ga0207647_101210182 358
184 3300025913 Ga0207695_10000377 Ga0207695_100003772 358
185 3300025914 Ga0207671_10034267 Ga0207671_100342672 358
186 3300025923 Ga0207681_10262386 Ga0207681_102623862 358
187 3300025924 Ga0207694_10033054 Ga0207694_100330542 358
188 3300025924 Ga0207694_10105507 Ga0207694_101055073 358
189 3300025949 Ga0207667_10011408 Ga0207667_100114088 358
190 3300025949 Ga0207667_10015142 Ga0207667_100151422 358
191 3300037312 Ga0395899_0046541 Ga0395899_0046541_1121_2209 358
192 3300037312 Ga0395899_0060359 Ga0395899_0060359_233_1378 358
193 3300037418 Ga0395900_0007104 Ga0395900_0007104_2578_3723 358
194 3300037418 Ga0395900_0033785 Ga0395900_0033785_3474_4562 358
195 3300037466 Ga0395898_0005632 Ga0395898_0005632_7932_9020 358
196 3300038443 Ga0395901_0016202 Ga0395901_0016202_3116_4261 358
197 3300038443 Ga0395901_0027852 Ga0395901_0027852_2839_3927 358
198 3300046453 Ga0495627_000342 Ga0495627_000342_24974_26083 358
199 3300046471 Ga0495650_0001133 Ga0495650_0001133_14371_15480 358
200 3300046530 Ga0495654_0061431 Ga0495654_0061431_198_1316 358
201 3300046660 Ga0495625_0000606 Ga0495625_0000606_28165_29295 358
202 3300046810 Ga0495660_0097066 Ga0495660_0097066_311_1411 358
203 3300047470 Ga0495681_0000061 Ga0495681_0000061_34851_35960 358
204 3300048928 Ga0496125_0001640 Ga0496125_0001640_9846_10958 358
205 3300049571 Ga0501034_0155478 Ga0501034_0155478_331_1476 358
206 3300053125 Ga0500618_000308 Ga0500618_000308_32294_33373 358
207 iso_pu_bacteria 2599185239 2599740700 358
208 iso_pu_bacteria 2599185240 2599748294 358
209 iso_pu_bacteria 2599185355 2600210206 358
210 iso_pu_bacteria 2675903129 2676745696 358
211 iso_pu_bacteria 2808606384 2808967587 358
212 iso_pu_bacteria 2808606390 2809002418 358
213 iso_pu_bacteria 2808606391 2809009696 358
214 iso_pu_bacteria 2818991452 2819636925 358
215 iso_pu_bacteria 2863421361 2863427113 358
216 iso_pu_bacteria 2870068957 2870073701 358
217 iso_pu_bacteria 2904564687 2904571093 358
218 iso_pu_bacteria 2904571731 2904578195 358
219 iso_pu_bacteria 2928157003 2928158233 358
220 iso_pu_bacteria 2928163908 2928167545 358
221 iso_pu_bacteria 2928170801 2928177867 358
222 iso_pu_bacteria 2928536128 2928542875 358
223 iso_pu_bacteria 2929520902 2929520935 358
224 iso_pu_bacteria 2945972063 2945973021 358
225 iso_pu_bacteria 2981990288 2981996628 358
226 iso_pu_bacteria 641736154 642418493 358
227 iso_pu_bacteria 8018845410 8018850025 358
228 iso_pu_bacteria 8020938398 8020942465 358
229 iso_pu_bacteria 8020953355 8020954624 358
230 iso_pu_bacteria 8021120328 8021123715 358
231 3300005616 Ga0068852_100001123 Ga0068852_10000112315 359
232 3300009011 Ga0105251_10037674 Ga0105251_100376742 359
233 3300009093 Ga0105240_10000787 Ga0105240_1000078718 359
234 3300013306 Ga0163162_10042797 Ga0163162_100427972 359
235 3300014497 Ga0182008_10000998 Ga0182008_100009988 359
236 3300014497 Ga0182008_10005011 Ga0182008_100050115 359
237 3300014497 Ga0182008_10093273 Ga0182008_100932731 359
238 3300015262 Ga0182007_10009478 Ga0182007_100094783 359
239 3300015265 Ga0182005_1000361 Ga0182005_10003619 359
240 3300025913 Ga0207695_10001940 Ga0207695_100019402 359
241 3300026121 Ga0207683_10026080 Ga0207683_100260803 359
242 3300026142 Ga0207698_10001463 Ga0207698_100014635 359
243 3300046462 Ga0495651_0006540 Ga0495651_0006540_174_1259 359
244 3300046529 Ga0495652_0105157 Ga0495652_0105157_192_1277 359
245 3300046559 Ga0495667_0097340 Ga0495667_0097340_44_1138 359
246 3300046648 Ga0495611_0041359 Ga0495611_0041359_582_1667 359
247 3300046675 Ga0495657_0190417 Ga0495657_0190417_80_1162 359
248 3300046690 Ga0495624_0033244 Ga0495624_0033244_2106_3191 359
249 3300046809 Ga0495600_0122886 Ga0495600_0122886_428_1513 359
250 3300047317 Ga0495604_0012892 Ga0495604_0012892_3174_4259 359
251 3300047320 Ga0495672_0018732 Ga0495672_0018732_1649_2743 359
252 3300047472 Ga0495686_0000044 Ga0495686_0000044_86897_87991 359
253 3300048088 Ga0495602_0025261 Ga0495602_0025261_146_1231 359
254 3300048914 Ga0496111_0102790 Ga0496111_0102790_18_1106 359
255 3300048919 Ga0496116_0003223 Ga0496116_0003223_2855_3940 359
256 3300048921 Ga0496118_0026347 Ga0496118_0026347_3223_4350 359
257 3300048924 Ga0496121_0022092 Ga0496121_0022092_586_1671 359
258 3300048925 Ga0496122_0000225 Ga0496122_0000225_26103_27188 359
259 3300048926 Ga0496123_0000192 Ga0496123_0000192_99117_100202 359
260 3300048928 Ga0496125_0008898 Ga0496125_0008898_4621_5706 359
261 3300048929 Ga0496126_0018925 Ga0496126_0018925_5652_6746 359
262 3300053119 Ga0500595_000811 Ga0500595_000811_9469_10554 359
263 iso_pu_bacteria 2513020051 2513229986 359
264 iso_pu_bacteria 2599185214 2599624350 359
265 iso_pu_bacteria 2599185226 2599672362 359
266 iso_pu_bacteria 2599185227 2599681554 359
267 iso_pu_bacteria 2599185229 2599693568 359
268 iso_pu_bacteria 2643221628 2644160612 359
269 iso_pu_bacteria 2643221658 2644328970 359
270 iso_pu_bacteria 2643221672 2644397661 359
271 iso_pu_bacteria 2738541307 2738879848 359
272 iso_pu_bacteria 2842677519 2842677969 359
273 iso_pu_bacteria 2885198086 2885199419 359
274 iso_pu_bacteria 2885211737 2885213070 359
275 iso_pu_bacteria 2904449895 2904450244 359
276 iso_pu_bacteria 2904456579 2904456933 359
277 iso_pu_bacteria 2919462493 2919463309 359
278 iso_pu_bacteria 2928070936 2928076957 359
279 iso_pu_bacteria 2945909444 2945913356 359
280 iso_pu_bacteria 2945945610 2945948906 359
281 3300005364 Ga0070673_100135399 Ga0070673_1001353992 360
282 3300013306 Ga0163162_10059083 Ga0163162_100590832 360
283 3300025903 Ga0207680_10086556 Ga0207680_100865563 360
284 3300025960 Ga0207651_10107598 Ga0207651_101075981 360
285 3300025986 Ga0207658_10088057 Ga0207658_100880572 360
286 3300031731 Ga0307405_10275199 Ga0307405_102751991 360
287 3300046462 Ga0495651_0077466 Ga0495651_0077466_681_1772 360
288 3300048904 Ga0496101_0023970 Ga0496101_0023970_2084_3175 360
289 3300048905 Ga0496102_0112308 Ga0496102_0112308_1059_2150 360
290 3300048907 Ga0496104_0110326 Ga0496104_0110326_698_1789 360
291 3300048908 Ga0496105_0007279 Ga0496105_0007279_6460_7551 360
292 3300048913 Ga0496110_0408691 Ga0496110_0408691_116_1207 360
293 3300048917 Ga0496114_0201424 Ga0496114_0201424_469_1560 360
294 iso_pu_bacteria 2945984333 2945984414 360
295 iso_pu_bacteria 2954767861 2954773035 360
296 3300003316 rootH1_10123316 rootH1_101233161 361
297 3300003320 rootH2_10221804 rootH2_102218042 361
298 3300003758 Ga0055532_1000199 Ga0055532_10001992 361
299 3300003758 Ga0055532_1000717 Ga0055532_10007172 361
300 3300003760 Ga0055527_1000810 Ga0055527_10008106 361
301 3300003761 Ga0055535_1000948 Ga0055535_100094812 361
302 3300003762 Ga0055542_1000806 Ga0055542_10008068 361
303 3300003763 Ga0055529_1000801 Ga0055529_100080112 361
304 3300003790 Ga0055528_1015616 Ga0055528_10156162 361
305 3300005339 Ga0070660_100000642 Ga0070660_10000064212 361
306 3300005366 Ga0070659_100000301 Ga0070659_10000030128 361
307 3300005455 Ga0070663_100000215 Ga0070663_1000002159 361
308 3300005614 Ga0068856_100183666 Ga0068856_1001836662 361
309 3300005616 Ga0068852_100005851 Ga0068852_1000058515 361
310 3300009092 Ga0105250_10022688 Ga0105250_100226882 361
311 3300009093 Ga0105240_10003701 Ga0105240_1000370123 361
312 3300009093 Ga0105240_10121567 Ga0105240_101215672 361
313 3300009551 Ga0105238_10005545 Ga0105238_100055452 361
314 3300015262 Ga0182007_10005424 Ga0182007_100054244 361
315 3300025225 Ga0209566_100503 Ga0209566_1005039 361
316 3300025228 Ga0209672_100145 Ga0209672_1001458 361
317 3300025229 Ga0209147_100201 Ga0209147_1002018 361
318 3300025229 Ga0209147_100258 Ga0209147_10025846 361
319 3300025242 Ga0209258_100350 Ga0209258_1003508 361
320 3300025254 Ga0209148_1000327 Ga0209148_10003278 361
321 3300025272 Ga0209455_1000248 Ga0209455_10002488 361
322 3300025273 Ga0209673_1000057 Ga0209673_1000057183 361
323 3300025294 Ga0209025_1001083 Ga0209025_10010834 361
324 3300025295 Ga0209564_1008883 Ga0209564_10088833 361
325 3300025711 Ga0207696_1033864 Ga0207696_10338642 361
326 3300025913 Ga0207695_10003192 Ga0207695_1000319223 361
327 3300025914 Ga0207671_10244871 Ga0207671_102448712 361
328 3300025919 Ga0207657_10000003 Ga0207657_1000000336 361
329 3300025924 Ga0207694_10041863 Ga0207694_100418632 361
330 3300025932 Ga0207690_10000007 Ga0207690_1000000737 361
331 3300025949 Ga0207667_10024478 Ga0207667_100244782 361
332 3300026067 Ga0207678_10000792 Ga0207678_1000079217 361
333 3300026142 Ga0207698_10006782 Ga0207698_100067822 361
334 3300027312 Ga0209371_1000292 Ga0209371_100029239 361
335 3300030500 Ga0268256_1000255 Ga0268256_100025539 361
336 3300046522 Ga0495643_0031117 Ga0495643_0031117_783_1904 361
337 3300050496 nmdc:mga07m45_16430_c1 nmdc:mga07m45_16430_c1_1230_2342 361
338 3300050508 nmdc:mga09592_158812_c1 nmdc:mga09592_158812_c1_394_1515 361
339 3300053724 Ga0500570_000097 Ga0500570_000097_2597_3718 361
340 3300053730 Ga0500645_031501 Ga0500645_031501_117_1238 361
341 3300003792 Ga0055540_1007985 Ga0055540_10079853 362
342 3300015683 Ga0183362_10003 Ga0183362_10003279 362
343 3300025303 Ga0209051_1000240 Ga0209051_100024046 362
344 3300031649 Ga0307514_10021962 Ga0307514_100219626 362
345 iso_pu_bacteria 2928084124 2928087941 362
346 3300001989 JGI24739J22299_10018561 JGI24739J22299_100185612 363
347 3300003578 Ga0006562J51391_1102716 Ga0006562J51391_11027164 363
348 3300003773 Ga0055537_1000394 Ga0055537_100039425 363
349 3300003781 Ga0055536_1006150 Ga0055536_10061505 363
350 3300003781 Ga0055536_1010039 Ga0055536_10100392 363
351 3300003784 Ga0055534_1000131 Ga0055534_100013133 363
352 3300003790 Ga0055528_1000629 Ga0055528_10006293 363
353 3300003791 Ga0055530_10004520 Ga0055530_100045205 363
354 3300003792 Ga0055540_1007122 Ga0055540_10071223 363
355 3300003794 Ga0055531_10011417 Ga0055531_100114173 363
356 3300005288 Ga0065714_10068637 Ga0065714_100686373 363
357 3300005289 Ga0065704_10077202 Ga0065704_100772022 363
358 3300005457 Ga0070662_100009397 Ga0070662_1000093974 363
359 3300005564 Ga0070664_100062883 Ga0070664_1000628833 363
360 3300006038 Ga0075365_10074298 Ga0075365_100742982 363
361 3300006195 Ga0075366_10040157 Ga0075366_100401573 363
362 3300006353 Ga0075370_10009646 Ga0075370_100096464 363
363 3300006353 Ga0075370_10026273 Ga0075370_100262733 363
364 3300006353 Ga0075370_10127177 Ga0075370_101271772 363
365 3300006948 Ga0099826_10018596 Ga0099826_100185964 363
366 3300013100 Ga0157373_10006492 Ga0157373_100064926 363
367 3300013105 Ga0157369_10055393 Ga0157369_100553935 363
368 3300014497 Ga0182008_10001824 Ga0182008_100018246 363
369 3300015261 Ga0182006_1008590 Ga0182006_10085903 363
370 3300015261 Ga0182006_1048993 Ga0182006_10489932 363
371 3300015262 Ga0182007_10000383 Ga0182007_1000038328 363
372 3300017792 Ga0163161_10012165 Ga0163161_100121656 363
373 3300025263 Ga0209565_1000188 Ga0209565_100018853 363
374 3300025263 Ga0209565_1007562 Ga0209565_10075622 363
375 3300025273 Ga0209673_1000411 Ga0209673_100041153 363
376 3300025291 Ga0209675_1000172 Ga0209675_100017253 363
377 3300025291 Ga0209675_1007309 Ga0209675_10073092 363
378 3300025292 Ga0209676_1000179 Ga0209676_10001794 363
379 3300025292 Ga0209676_1009118 Ga0209676_10091183 363
380 3300025298 Ga0209050_1000172 Ga0209050_1000172147 363
381 3300025298 Ga0209050_1011068 Ga0209050_10110683 363
382 3300025298 Ga0209050_1018599 Ga0209050_10185993 363
383 3300025299 Ga0209256_1016965 Ga0209256_10169654 363
384 3300025303 Ga0209051_1000046 Ga0209051_1000046147 363
385 3300025303 Ga0209051_1000183 Ga0209051_100018336 363
386 3300025304 Ga0209257_1000410 Ga0209257_100041024 363
387 3300025304 Ga0209257_1000716 Ga0209257_100071642 363
388 3300025728 Ga0207655_1003427 Ga0207655_10034275 363
389 3300025927 Ga0207687_10272316 Ga0207687_102723162 363
390 3300025933 Ga0207706_10015133 Ga0207706_100151335 363
391 3300025935 Ga0207709_10000705 Ga0207709_1000070523 363
392 3300025945 Ga0207679_10000531 Ga0207679_100005313 363
393 3300027666 Ga0209282_1005897 Ga0209282_10058973 363
394 3300028563 Ga0265319_1045668 Ga0265319_10456681 363
395 3300030734 Ga0316179_1091897 Ga0316179_10918973 363
396 3300030742 Ga0316183_1009761 Ga0316183_10097614 363
397 3300031548 Ga0307408_100005473 Ga0307408_1000054732 363
398 3300031548 Ga0307408_100156926 Ga0307408_1001569262 363
399 3300031901 Ga0307406_10000563 Ga0307406_1000056325 363
400 3300031911 Ga0307412_10131144 Ga0307412_101311441 363
401 3300032004 Ga0307414_10059682 Ga0307414_100596822 363
402 3300041413 Ga0439465_0032357 Ga0439465_0032357_90_1181 363
403 3300042531 Ga0450918_002432 Ga0450918_002432_1164_2255 363
404 3300046453 Ga0495627_015031 Ga0495627_015031_1287_2378 363
405 3300046616 Ga0495668_0008641 Ga0495668_0008641_3808_4899 363
406 3300046660 Ga0495625_0000416 Ga0495625_0000416_33458_34549 363
407 3300046665 Ga0495661_0074891 Ga0495661_0074891_211_1302 363
408 3300046692 Ga0495671_0009027 Ga0495671_0009027_1448_2539 363
409 3300048919 Ga0496116_0034141 Ga0496116_0034141_2322_3419 363
410 3300048919 Ga0496116_0038279 Ga0496116_0038279_2144_3235 363
411 3300048928 Ga0496125_0052377 Ga0496125_0052377_1590_2681 363
412 3300049679 Ga0501249_001320 Ga0501249_001320_2905_3996 363
413 3300049705 Ga0501225_0005261 Ga0501225_0005261_1150_2241 363
414 3300049759 Ga0501262_000730 Ga0501262_000730_2501_3592 363
415 3300050489 nmdc:mga03683_1238_c1 nmdc:mga03683_1238_c1_5100_6191 363
416 3300050491 nmdc:mga00v17_4436_c1 nmdc:mga00v17_4436_c1_159_1250 363
417 3300050492 nmdc:mga0yw44_146914_c1 nmdc:mga0yw44_146914_c1_163_1254 363
418 3300050496 nmdc:mga07m45_10784_c1 nmdc:mga07m45_10784_c1_1398_2489 363
419 3300050496 nmdc:mga07m45_445_c1 nmdc:mga07m45_445_c1_1650_2741 363
420 3300053109 Ga0500569_027490 Ga0500569_027490_212_1303 363
421 3300053117 Ga0500593_001317 Ga0500593_001317_7473_8564 363
422 3300053121 Ga0500607_000595 Ga0500607_000595_3303_4394 363
423 3300053158 Ga0500627_0007511 Ga0500627_0007511_2298_3389 363
424 3300053161 Ga0500634_0020927 Ga0500634_0020927_1026_2117 363
425 iso_pu_bacteria 2738541277 2738719737 363
426 iso_pu_bacteria 2738543019 2739278936 363
427 3300009148 Ga0105243_10004570 Ga0105243_100045703 364
428 3300025935 Ga0207709_10000341 Ga0207709_1000034137 364
429 iso_pu_bacteria 2643221683 2644468967 364
430 3300025292 Ga0209676_1022540 Ga0209676_10225402 365
431 3300053125 Ga0500618_002059 Ga0500618_002059_5049_6182 365
432 iso_pu_bacteria 2818991446 2819596681 365
433 iso_pu_bacteria 2831265667 2831267844 365
434 iso_pu_bacteria 2899924645 2899931401 365
435 iso_pu_bacteria 2904541872 2904544124 365
436 iso_pu_bacteria 2928037797 2928037826 365
437 iso_pu_bacteria 2928044640 2928046568 365
438 iso_pu_bacteria 2928051484 2928054268 365
439 iso_pu_bacteria 2928064002 2928066016 365
440 iso_pu_bacteria 2929160207 2929162313 365
441 3300003781 Ga0055536_1001872 Ga0055536_10018724 366
442 3300003792 Ga0055540_1000555 Ga0055540_10005554 366
443 3300005367 Ga0070667_100153461 Ga0070667_1001534612 366
444 3300013104 Ga0157370_10008731 Ga0157370_100087316 366
445 3300025292 Ga0209676_1000505 Ga0209676_100050525 366
446 3300025303 Ga0209051_1000331 Ga0209051_100033137 366
447 3300025304 Ga0209257_1008249 Ga0209257_10082492 366
448 3300031731 Ga0307405_10048682 Ga0307405_100486823 366
449 3300046460 Ga0495638_0008651 Ga0495638_0008651_3623_4723 366
450 3300046513 Ga0495616_0000607 Ga0495616_0000607_2317_3417 366
451 3300046518 Ga0495631_0000086 Ga0495631_0000086_9132_10232 366
452 3300046520 Ga0495637_0043703 Ga0495637_0043703_46_1146 366
453 3300046660 Ga0495625_0021343 Ga0495625_0021343_2344_3534 366
454 3300048922 Ga0496119_0047083 Ga0496119_0047083_360_1460 366
455 3300053110 Ga0500571_000011 Ga0500571_000011_32113_33213 366
456 3300053128 Ga0500626_021641 Ga0500626_021641_478_1668 366
457 3300053133 Ga0500655_002414 Ga0500655_002414_586_1686 366
458 3300053136 Ga0500559_0007106 Ga0500559_0007106_832_2022 366
459 3300053141 Ga0500574_010678 Ga0500574_010678_170_1360 366
460 3300053162 Ga0500638_002028 Ga0500638_002028_4008_5108 366
461 3300053177 Ga0500636_0061711 Ga0500636_0061711_453_1553 366
462 3300046530 Ga0495654_0007379 Ga0495654_0007379_3660_4838 367
463 3300048904 Ga0496101_0120836 Ga0496101_0120836_342_1454 367
464 iso_pu_bacteria 2838054893 2838060214 367
465 3300003187 JGI25151J46595_10001428 JGI25151J46595_1000142811 368
466 3300025294 Ga0209025_1000244 Ga0209025_100024432 368
467 3300003323 rootH1_10019511 rootH1_100195113 369
468 3300003354 JGI25160J50197_1012213 JGI25160J50197_10122133 369
469 3300003374 JGI25161J50226_1003431 JGI25161J50226_10034313 369
470 3300003761 Ga0055535_1000535 Ga0055535_10005352 369
471 3300003762 Ga0055542_1000560 Ga0055542_100056026 369
472 3300003775 Ga0055524_1002376 Ga0055524_10023769 369
473 3300003792 Ga0055540_1012938 Ga0055540_10129382 369
474 3300004625 Ga0055543_1007531 Ga0055543_10075312 369
475 3300005262 Ga0065165_1023435 Ga0065165_10234352 369
476 3300005539 Ga0068853_100030422 Ga0068853_1000304224 369
477 3300005834 Ga0068851_10016681 Ga0068851_100166813 369
478 3300025208 Ga0209436_105762 Ga0209436_1057622 369
479 3300025228 Ga0209672_103456 Ga0209672_1034562 369
480 3300025229 Ga0209147_101536 Ga0209147_1015363 369
481 3300025242 Ga0209258_100556 Ga0209258_10055626 369
482 3300025245 Ga0207425_1009497 Ga0207425_10094972 369
483 3300025254 Ga0209148_1000589 Ga0209148_100058926 369
484 3300025258 Ga0209129_1006735 Ga0209129_10067352 369
485 3300025263 Ga0209565_1007477 Ga0209565_10074772 369
486 3300025273 Ga0209673_1000185 Ga0209673_100018525 369
487 3300025284 Ga0209130_1000402 Ga0209130_100040216 369
488 3300025284 Ga0209130_1014734 Ga0209130_10147342 369
489 3300025292 Ga0209676_1011844 Ga0209676_10118442 369
490 3300025294 Ga0209025_1013087 Ga0209025_10130873 369
491 3300025295 Ga0209564_1000538 Ga0209564_100053825 369
492 3300025297 Ga0209758_1009169 Ga0209758_10091694 369
493 3300025297 Ga0209758_1011168 Ga0209758_10111683 369
494 3300025299 Ga0209256_1000069 Ga0209256_100006946 369
495 3300025302 Ga0207426_1000115 Ga0207426_1000115139 369
496 3300025303 Ga0209051_1013459 Ga0209051_10134592 369
497 3300025321 Ga0207656_10013906 Ga0207656_100139062 369
498 3300026041 Ga0207639_10054651 Ga0207639_100546512 369
499 3300001979 JGI24740J21852_10005833 JGI24740J21852_100058332 371
500 3300001989 JGI24739J22299_10011382 JGI24739J22299_100113822 371
501 3300002773 JGI25152J39213_1003511 JGI25152J39213_10035113 371
502 3300002774 JGI25150J39212_1001615 JGI25150J39212_10016154 371
503 3300003215 JGI25153J46596_10007572 JGI25153J46596_100075723 371
504 3300003354 JGI25160J50197_1000554 JGI25160J50197_100055420 371
505 3300003771 Ga0055526_1000577 Ga0055526_10005774 371
506 3300003773 Ga0055537_1000411 Ga0055537_100041129 371
507 3300003775 Ga0055524_1000537 Ga0055524_10005374 371
508 3300003790 Ga0055528_1000568 Ga0055528_100056829 371
509 3300004625 Ga0055543_1000371 Ga0055543_10003714 371
510 3300009093 Ga0105240_10123993 Ga0105240_101239932 371
511 3300010375 Ga0105239_10306954 Ga0105239_103069542 371
512 3300025208 Ga0209436_103849 Ga0209436_1038493 371
513 3300025245 Ga0207425_1000394 Ga0207425_100039429 371
514 3300025258 Ga0209129_1000033 Ga0209129_100003385 371
515 3300025263 Ga0209565_1000164 Ga0209565_100016435 371
516 3300025273 Ga0209673_1000344 Ga0209673_100034436 371
517 3300025284 Ga0209130_1000663 Ga0209130_10006634 371
518 3300025294 Ga0209025_1000541 Ga0209025_10005417 371
519 3300025295 Ga0209564_1000317 Ga0209564_100031746 371
520 3300025297 Ga0209758_1000027 Ga0209758_100002785 371
521 3300025299 Ga0209256_1000261 Ga0209256_100026146 371
522 3300025302 Ga0207426_1000027 Ga0207426_100002745 371
523 3300025303 Ga0209051_1010425 Ga0209051_10104253 371
524 3300048927 Ga0496124_0047616 Ga0496124_0047616_270_1385 371
525 3300048928 Ga0496125_0050396 Ga0496125_0050396_948_2063 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00962

A_deaminase

Adenosine deaminase

50

374

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gxw-assembly2.cif.gz_B crystal structure of a cog1816 amidohydrolase (target efi-505188) from burkhoderia ambifaria, with bound zn 0.9791 12 357
4gxw-assembly2.cif.gz_B crystal structure of a cog1816 amidohydrolase (target efi-505188) from burkhoderia ambifaria, with bound zn 0.9285 12 357
3pbm-assembly1.cif.gz_A the crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa 0.9204 21 334
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.9201 23 353
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.9147 23 353
ID Description Score Start End Superfamily
4gxwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9791 12 357 3.20.20.140
af_Q9P6J8_2_337_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9309 17 353 3.20.20.140
4gxwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9285 12 357 3.20.20.140
af_Q9P6J8_2_337_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9202 17 353 3.20.20.140
3rysB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9201 23 353 3.20.20.140
ID Description Score Start End GO Terms
AF-R7XG19-F1-model_v4 Adenosine deaminase 0.9943 165 345 GO:0000034
GO:0005829
GO:0006146
GO:0043103
AF-A0A6N9BHG0-F1-model_v4 Adenosine deaminase 0.9922 179 357 GO:0000034
GO:0005829
GO:0006146
GO:0043103
AF-A0A448YGW7-F1-model_v4 DEKNAAC101076 0.9912 17 352 GO:0000034
GO:0005829
GO:0006146
GO:0043103
AF-A0A645IIS5-F1-model_v4 Adenine deaminase (EC 3.5.4.2) 0.9895 231 357 GO:0000034
AF-R6A0M8-F1-model_v4 Putative adenosine deaminase 0.9891 82 359 GO:0000034
GO:0005829
GO:0006146
GO:0043103

Feature Viewer

pLDDT pTM Quality
91.36 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map