F459212

General Info

Members Datasets Scaffolds Average Seq Length
525 267 1050 154

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1048292|JGI24736J21556_10482921
Length 161
Sequence MIIATTAPTNEMPRLNWRAPFGLLARIGSTLFSPSLVLLVQRLGIAAVFFMSGRTKIAEGTWLTLSDDAFELFRTDYKLPFISPVPGAYAATTAEHLFPILLVLGLLTRFSACGLLVMTLVIEIFVYPDAWPTHLSWAGLLLPLIAFGGGKLSLDRALRIP

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
157 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
158 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
162 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
219 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
220 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
236 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
244 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
245 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
246 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
247 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
252 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
256 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
257 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
258 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
259 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
260 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
261 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
262 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
263 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
264 2816332133 Acidovorax radicis 2721A Isolate Unclassified
265 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
266 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
267 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 0.57
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4
Nodule 0.19
Rhizoplane 6.29
Rhizosphere 75.81
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1048292 3300001904 Bacteria 655
2 SwRhRL2b_contig_1793279 2162886007 Bacteria 5449
3 SwRhRL2b_contig_3665959 2162886007 Bacteria 6817
4 SwRhRL2b_contig_875286 2162886007 Bacteria 1370
5 JGI24736J21556_1001357 3300001904 Bacteria 4467
6 JGI24740J21852_10067811 3300001979 Bacteria 964
7 JGI24739J22299_10014380 3300001989 Bacteria 2880
8 JGI24739J22299_10027977 3300001989 Bacteria 1968
9 JGI24737J22298_10072303 3300001990 Bacteria 1029
10 JGI24735J21928_10006833 3300002067 Bacteria 3738
11 rootH2_10065310 3300003320 Bacteria 6765
12 rootL2_10321619 3300003322 Bacteria 2279
13 Ga0055526_1003911 3300003771 Bacteria 9195
14 Ga0065704_10001975 3300005289 Bacteria 9225
15 Ga0065704_10072411 3300005289 Bacteria 8575
16 Ga0065704_10090137 3300005289 Bacteria 2810
17 Ga0065704_10094279 3300005289 Bacteria 2551
18 Ga0065707_10120005 3300005295 Bacteria 2145
19 Ga0070658_11100512 3300005327 Bacteria 691
20 Ga0070690_100001607 3300005330 Bacteria 11862
21 Ga0070670_100082900 3300005331 Bacteria 2755
22 Ga0070666_10000479 3300005335 Bacteria 24181
23 Ga0070666_10041134 3300005335 Bacteria 3087
24 Ga0068868_100000635 3300005338 Bacteria 23648
25 Ga0068868_101650346 3300005338 Bacteria 603
26 Ga0070660_100004200 3300005339 Bacteria 9947
27 Ga0070660_100009128 3300005339 Bacteria 6961
28 Ga0070660_100038884 3300005339 Bacteria 3614
29 Ga0070660_100563477 3300005339 Bacteria 951
30 Ga0070689_100233340 3300005340 Bacteria 1513
31 Ga0070689_101676395 3300005340 Bacteria 578
32 Ga0070687_100499913 3300005343 Bacteria 818
33 Ga0070661_100019603 3300005344 Bacteria 4821
34 Ga0070668_100005762 3300005347 Bacteria 9188
35 Ga0070668_100015102 3300005347 Bacteria 5770
36 Ga0070669_100002401 3300005353 Bacteria 13554
37 Ga0070669_100331721 3300005353 Bacteria 1231
38 Ga0070675_100143279 3300005354 Bacteria 2044
39 Ga0070675_100312855 3300005354 Bacteria 1386
40 Ga0070671_100006910 3300005355 Bacteria 9087
41 Ga0070671_100016603 3300005355 Bacteria 5951
42 Ga0070671_100354978 3300005355 Bacteria 1252
43 Ga0070671_100486842 3300005355 Bacteria 1060
44 Ga0070674_100000246 3300005356 Bacteria 26886
45 Ga0070674_100138505 3300005356 Bacteria 1824
46 Ga0070673_100010066 3300005364 Bacteria 6384
47 Ga0070673_100156831 3300005364 Bacteria 1932
48 Ga0070673_100198270 3300005364 Bacteria 1728
49 Ga0070673_100245457 3300005364 Bacteria 1558
50 Ga0070673_100332713 3300005364 Bacteria 1344
51 Ga0070688_100225628 3300005365 Bacteria 1323
52 Ga0070659_100005094 3300005366 Bacteria 9427
53 Ga0070659_100036279 3300005366 Bacteria 3843
54 Ga0070667_100001121 3300005367 Bacteria 24448
55 Ga0070667_100016694 3300005367 Bacteria 6076
56 Ga0070667_100017742 3300005367 Bacteria 5899
57 Ga0070667_100089557 3300005367 Bacteria 2643
58 Ga0070667_100095796 3300005367 Bacteria 2559
59 Ga0070667_100540919 3300005367 Bacteria 1070
60 Ga0070667_100576611 3300005367 Bacteria 1035
61 Ga0070705_100096093 3300005440 Bacteria 1859
62 Ga0070700_100555781 3300005441 Bacteria 892
63 Ga0070678_100000187 3300005456 Bacteria 27177
64 Ga0070678_100088587 3300005456 Bacteria 2366
65 Ga0070662_100021818 3300005457 Bacteria 4377
66 Ga0070662_100130023 3300005457 Bacteria 1940
67 Ga0070662_100168073 3300005457 Bacteria 1720
68 Ga0070662_101124767 3300005457 Bacteria 674
69 Ga0070681_11403643 3300005458 Bacteria 622
70 Ga0068867_100134612 3300005459 Bacteria 1925
71 Ga0068867_100604870 3300005459 Bacteria 956
72 Ga0070679_101599606 3300005530 Bacteria 599
73 Ga0068853_100278550 3300005539 Bacteria 1541
74 Ga0070672_100004299 3300005543 Bacteria 9316
75 Ga0070672_100135447 3300005543 Bacteria 2028
76 Ga0070672_100630132 3300005543 Bacteria 935
77 Ga0070686_101690383 3300005544 Bacteria 537
78 Ga0070665_100008625 3300005548 Bacteria 10317
79 Ga0070665_100022421 3300005548 Bacteria 6354
80 Ga0070665_100065537 3300005548 Bacteria 3644
81 Ga0070665_100168264 3300005548 Bacteria 2194
82 Ga0070665_100220573 3300005548 Bacteria 1897
83 Ga0068855_100192044 3300005563 Bacteria 2303
84 Ga0068855_100586790 3300005563 Bacteria 1203
85 Ga0068855_101917306 3300005563 Bacteria 600
86 Ga0070664_102260646 3300005564 Bacteria 516
87 Ga0068857_100030929 3300005577 Bacteria 4730
88 Ga0068854_100143073 3300005578 Bacteria 1837
89 Ga0068854_100721807 3300005578 Bacteria 862
90 Ga0068856_100014726 3300005614 Bacteria 7548
91 Ga0068856_100346664 3300005614 Bacteria 1504
92 Ga0068852_100012931 3300005616 Bacteria 6365
93 Ga0068852_100064682 3300005616 Bacteria 3189
94 Ga0068864_100055595 3300005618 Bacteria 3418
95 Ga0068864_100179977 3300005618 Bacteria 1932
96 Ga0068864_100307583 3300005618 Bacteria 1485
97 Ga0068864_101275321 3300005618 Bacteria 735
98 Ga0068866_10013963 3300005718 Bacteria 3535
99 Ga0068866_10633747 3300005718 Bacteria 726
100 Ga0068851_10112431 3300005834 Bacteria 1455
101 Ga0068870_11117047 3300005840 Bacteria 567
102 Ga0068863_100017809 3300005841 Bacteria 6800
103 Ga0068863_100022777 3300005841 Bacteria 5983
104 Ga0068863_100388341 3300005841 Bacteria 1364
105 Ga0068863_100489582 3300005841 Bacteria 1210
106 Ga0068858_100000310 3300005842 Bacteria 51909
107 Ga0068858_100000438 3300005842 Bacteria 43458
108 Ga0068858_100006991 3300005842 Bacteria 10963
109 Ga0068860_100051896 3300005843 Bacteria 3901
110 Ga0068860_100144614 3300005843 Bacteria 2287
111 Ga0068860_100327930 3300005843 Bacteria 1503
112 Ga0068860_100452845 3300005843 Bacteria 1276
113 Ga0068862_100016278 3300005844 Bacteria 6187
114 Ga0068862_100109858 3300005844 Bacteria 2419
115 Ga0068862_100133785 3300005844 Bacteria 2195
116 Ga0068862_100180026 3300005844 Bacteria 1897
117 Ga0097621_100048541 3300006237 Bacteria 3444
118 Ga0097621_100171811 3300006237 Bacteria 1869
119 Ga0097621_100217324 3300006237 Bacteria 1664
120 Ga0097621_101760654 3300006237 Bacteria 590
121 Ga0068871_100071578 3300006358 Bacteria 2852
122 Ga0075429_100286166 3300006880 Bacteria 1443
123 Ga0068865_101147267 3300006881 Bacteria 686
124 Ga0097620_100111006 3300006931 Bacteria 2804
125 Ga0105251_10052904 3300009011 Bacteria 1932
126 Ga0105251_10212572 3300009011 Bacteria 871
127 Ga0105250_10006080 3300009092 Bacteria 5314
128 Ga0105240_10000206 3300009093 Bacteria 119835
129 Ga0105240_10014310 3300009093 Bacteria 10835
130 Ga0105245_10075518 3300009098 Bacteria 3069
131 Ga0105245_10435056 3300009098 Bacteria 1317
132 Ga0105247_10122917 3300009101 Bacteria 1684
133 Ga0105243_10000077 3300009148 Bacteria 110432
134 Ga0105243_10045805 3300009148 Bacteria 3439
135 Ga0105242_10060071 3300009176 Bacteria 3121
136 Ga0105248_10000119 3300009177 Bacteria 89987
137 Ga0105248_10006802 3300009177 Bacteria 12535
138 Ga0105248_10012383 3300009177 Bacteria 9411
139 Ga0105248_10090684 3300009177 Bacteria 3442
140 Ga0105248_10171040 3300009177 Bacteria 2449
141 Ga0105248_10242747 3300009177 Bacteria 2028
142 Ga0105248_10296514 3300009177 Bacteria 1821
143 Ga0105248_10372960 3300009177 Bacteria 1607
144 Ga0105248_10393913 3300009177 Bacteria 1560
145 Ga0105237_10001347 3300009545 Bacteria 32527
146 Ga0105238_10538715 3300009551 Bacteria 1171
147 Ga0105249_10008812 3300009553 Bacteria 8808
148 Ga0105249_10158880 3300009553 Bacteria 2183
149 Ga0105249_10353216 3300009553 Bacteria 1490
150 Ga0105239_10000113 3300010375 Bacteria 114562
151 Ga0105239_10004322 3300010375 Bacteria 17032
152 Ga0157373_10001163 3300013100 Bacteria 20167
153 Ga0157371_10066794 3300013102 Bacteria 2546
154 Ga0157371_10290212 3300013102 Bacteria 1183
155 Ga0157370_10000176 3300013104 Bacteria 79656
156 Ga0157370_10300236 3300013104 Bacteria 1483
157 Ga0157369_10053466 3300013105 Bacteria 4365
158 Ga0157369_10229679 3300013105 Bacteria 1940
159 Ga0157374_10015658 3300013296 Bacteria 6657
160 Ga0157378_10082984 3300013297 Bacteria 2899
161 Ga0163162_10000793 3300013306 Bacteria 29396
162 Ga0163162_10021506 3300013306 Bacteria 6354
163 Ga0163162_10150550 3300013306 Bacteria 2444
164 Ga0163162_10648031 3300013306 Bacteria 1180
165 Ga0163162_11041418 3300013306 Bacteria 926
166 Ga0163162_11597483 3300013306 Bacteria 744
167 Ga0157372_11215970 3300013307 Bacteria 870
168 Ga0157375_10032576 3300013308 Bacteria 4944
169 Ga0157375_10375570 3300013308 Bacteria 1588
170 Ga0163163_10003777 3300014325 Bacteria 12903
171 Ga0163161_10047822 3300017792 Bacteria 3088
172 Ga0207427_100436 3300025231 Bacteria 23280
173 Ga0209437_105693 3300025233 Bacteria 2112
174 Ga0209026_1001456 3300025250 Bacteria 10450
175 Ga0209759_1023813 3300025256 Bacteria 1339
176 Ga0209233_1000213 3300025261 Bacteria 109881
177 Ga0209233_1000291 3300025261 Bacteria 64111
178 Ga0209564_1000670 3300025295 Bacteria 50564
179 Ga0209050_1001657 3300025298 Bacteria 22579
180 Ga0207697_10071765 3300025315 Bacteria 1451
181 Ga0207656_10172730 3300025321 Bacteria 1034
182 Ga0207696_1003816 3300025711 Bacteria 6703
183 Ga0207713_1010826 3300025735 Bacteria 5014
184 Ga0207713_1038698 3300025735 Bacteria 2021
185 Ga0207713_1165659 3300025735 Bacteria 701
186 Ga0207642_10023989 3300025899 Bacteria 2446
187 Ga0207710_10012934 3300025900 Bacteria 3515
188 Ga0207680_10001352 3300025903 Bacteria 11614
189 Ga0207680_10005803 3300025903 Bacteria 5927
190 Ga0207680_10027983 3300025903 Bacteria 3147
191 Ga0207647_10000447 3300025904 Bacteria 33519
192 Ga0207647_10015339 3300025904 Bacteria 5256
193 Ga0207647_10017721 3300025904 Bacteria 4836
194 Ga0207647_10139638 3300025904 Bacteria 1420
195 Ga0207645_10081372 3300025907 Bacteria 2076
196 Ga0207705_10000008 3300025909 Bacteria 589717
197 Ga0207705_10074150 3300025909 Bacteria 2470
198 Ga0207695_10046718 3300025913 Bacteria 4587
199 Ga0207695_10072811 3300025913 Bacteria 3504
200 Ga0207671_10001107 3300025914 Bacteria 32491
201 Ga0207671_10469146 3300025914 Bacteria 1003
202 Ga0207671_10905249 3300025914 Bacteria 697
203 Ga0207657_10000676 3300025919 Bacteria 36328
204 Ga0207657_10006429 3300025919 Bacteria 12187
205 Ga0207657_10054451 3300025919 Bacteria 3460
206 Ga0207657_10258412 3300025919 Bacteria 1386
207 Ga0207649_10229477 3300025920 Bacteria 1327
208 Ga0207681_10001728 3300025923 Bacteria 14035
209 Ga0207681_10272175 3300025923 Bacteria 1330
210 Ga0207681_10341987 3300025923 Bacteria 1195
211 Ga0207650_10085982 3300025925 Bacteria 2393
212 Ga0207659_10113360 3300025926 Bacteria 2065
213 Ga0207644_10003817 3300025931 Bacteria 9759
214 Ga0207644_10010505 3300025931 Bacteria 6102
215 Ga0207644_10014136 3300025931 Bacteria 5340
216 Ga0207644_10227048 3300025931 Bacteria 1482
217 Ga0207644_11657622 3300025931 Bacteria 536
218 Ga0207690_10007834 3300025932 Bacteria 6342
219 Ga0207690_10038499 3300025932 Bacteria 3113
220 Ga0207706_10015188 3300025933 Bacteria 6969
221 Ga0207706_10105371 3300025933 Bacteria 2481
222 Ga0207709_10000110 3300025935 Bacteria 127725
223 Ga0207709_10014707 3300025935 Bacteria 4325
224 Ga0207670_10838618 3300025936 Bacteria 767
225 Ga0207669_10000015 3300025937 Bacteria 125492
226 Ga0207669_10816877 3300025937 Bacteria 774
227 Ga0207691_10006960 3300025940 Bacteria 10909
228 Ga0207691_10324640 3300025940 Bacteria 1319
229 Ga0207711_10000047 3300025941 Bacteria 150849
230 Ga0207711_10020872 3300025941 Bacteria 5467
231 Ga0207711_10027260 3300025941 Bacteria 4798
232 Ga0207711_10037419 3300025941 Bacteria 4121
233 Ga0207711_10052190 3300025941 Bacteria 3504
234 Ga0207711_10170438 3300025941 Bacteria 1975
235 Ga0207711_10179823 3300025941 Bacteria 1923
236 Ga0207689_10755109 3300025942 Bacteria 821
237 Ga0207667_10139729 3300025949 Bacteria 2494
238 Ga0207667_10315477 3300025949 Bacteria 1597
239 Ga0207651_10000205 3300025960 Bacteria 25581
240 Ga0207651_10010071 3300025960 Bacteria 5217
241 Ga0207651_10167043 3300025960 Bacteria 1731
242 Ga0207712_10097482 3300025961 Bacteria 2178
243 Ga0207668_10005073 3300025972 Bacteria 7748
244 Ga0207668_10010874 3300025972 Bacteria 5515
245 Ga0207668_10021629 3300025972 Bacteria 4105
246 Ga0207668_10155036 3300025972 Bacteria 1778
247 Ga0207640_10164699 3300025981 Bacteria 1645
248 Ga0207640_10630780 3300025981 Bacteria 911
249 Ga0207658_10011589 3300025986 Bacteria 6001
250 Ga0207658_10029634 3300025986 Bacteria 3868
251 Ga0207658_10035471 3300025986 Bacteria 3573
252 Ga0207658_10083076 3300025986 Bacteria 2461
253 Ga0207658_10157189 3300025986 Bacteria 1859
254 Ga0207658_10882509 3300025986 Bacteria 814
255 Ga0207677_10003084 3300026023 Bacteria 8794
256 Ga0207703_10000917 3300026035 Bacteria 28709
257 Ga0207703_10009773 3300026035 Bacteria 7525
258 Ga0207703_10017621 3300026035 Bacteria 5575
259 Ga0207639_10050993 3300026041 Bacteria 3145
260 Ga0207678_10707731 3300026067 Bacteria 887
261 Ga0207708_10291811 3300026075 Bacteria 1324
262 Ga0207702_10006519 3300026078 Bacteria 10041
263 Ga0207641_10007041 3300026088 Bacteria 9397
264 Ga0207641_10047342 3300026088 Bacteria 3626
265 Ga0207641_10319522 3300026088 Bacteria 1472
266 Ga0207648_10126269 3300026089 Bacteria 2250
267 Ga0207676_10083723 3300026095 Bacteria 2598
268 Ga0207676_10197717 3300026095 Bacteria 1774
269 Ga0207676_10307474 3300026095 Bacteria 1450
270 Ga0207676_11227794 3300026095 Bacteria 743
271 Ga0207676_12082710 3300026095 Bacteria 566
272 Ga0207674_10431670 3300026116 Bacteria 1273
273 Ga0207683_10000954 3300026121 Bacteria 26517
274 Ga0207683_10031689 3300026121 Bacteria 4589
275 Ga0207683_10109620 3300026121 Bacteria 2471
276 Ga0207683_10353357 3300026121 Bacteria 1349
277 Ga0207683_11090466 3300026121 Bacteria 741
278 Ga0207698_10025031 3300026142 Bacteria 4198
279 Ga0207698_10087405 3300026142 Bacteria 2539
280 Ga0268266_10022849 3300028379 Bacteria 5323
281 Ga0268266_10022870 3300028379 Bacteria 5320
282 Ga0268266_10169223 3300028379 Bacteria 1982
283 Ga0268265_10010725 3300028380 Bacteria 6187
284 Ga0268265_10142153 3300028380 Bacteria 2010
285 Ga0268265_10162816 3300028380 Bacteria 1897
286 Ga0268265_10516453 3300028380 Bacteria 1128
287 Ga0268265_10804836 3300028380 Bacteria 916
288 Ga0268264_10015982 3300028381 Bacteria 6149
289 Ga0268264_10034353 3300028381 Bacteria 4171
290 Ga0268264_10414456 3300028381 Bacteria 1298
291 Ga0268264_11419343 3300028381 Bacteria 705
292 Ga0307408_100005457 3300031548 Bacteria 8510
293 Ga0307408_102001355 3300031548 Unclassified 557
294 Ga0307405_10018176 3300031731 Bacteria 3874
295 Ga0307410_10020715 3300031852 Bacteria 4029
296 Ga0307410_10147107 3300031852 Bacteria 1749
297 Ga0307406_11055236 3300031901 Bacteria 700
298 Ga0307407_10090146 3300031903 Bacteria 1877
299 Ga0307412_10003194 3300031911 Bacteria 9106
300 Ga0307412_10010732 3300031911 Bacteria 5283
301 Ga0307412_10060156 3300031911 Bacteria 2549
302 Ga0307412_10148740 3300031911 Bacteria 1725
303 Ga0307409_100060952 3300031995 Bacteria 2945
304 Ga0307409_100309521 3300031995 Bacteria 1473
305 Ga0307409_101401522 3300031995 Bacteria 725
306 Ga0307416_100001205 3300032002 Bacteria 13922
307 Ga0307416_100813351 3300032002 Bacteria 1031
308 Ga0307414_10117900 3300032004 Bacteria 2035
309 Ga0307411_10055509 3300032005 Bacteria 2606
310 Ga0307411_10074250 3300032005 Bacteria 2316
311 Ga0307411_10779360 3300032005 Bacteria 840
312 Ga0307411_12065523 3300032005 Bacteria 533
313 Ga0307415_100078375 3300032126 Bacteria 2350
314 Ga0307415_100136558 3300032126 Bacteria 1866
315 Ga0307415_100202805 3300032126 Bacteria 1575
316 Ga0373923_0200539 3300035111 Bacteria 922
317 Ga0395899_0006882 3300037312 Bacteria 8809
318 Ga0395899_0335255 3300037312 Bacteria 1015
319 Ga0395899_0592458 3300037312 Bacteria 707
320 Ga0395900_0101796 3300037418 Bacteria 2950
321 Ga0395900_0117624 3300037418 Bacteria 2727
322 Ga0395900_0578306 3300037418 Bacteria 1065
323 Ga0395898_0092215 3300037466 Bacteria 2913
324 Ga0395898_0893651 3300037466 Bacteria 827
325 Ga0395905_0002182 3300037471 Bacteria 22130
326 Ga0395905_0056128 3300037471 Bacteria 3686
327 Ga0395905_0789010 3300037471 Bacteria 853
328 Ga0395905_1339783 3300037471 Bacteria 620
329 Ga0395901_0011294 3300038443 Bacteria 9048
330 Ga0395901_0048402 3300038443 Bacteria 4415
331 Ga0436361_0850351 3300039447 Bacteria 3849
332 Ga0436363_0572110 3300039450 Bacteria 983
333 Ga0439438_009321 3300041405 Bacteria 3185
334 Ga0439438_049690 3300041405 Bacteria 1070
335 Ga0439447_014661 3300041407 Bacteria 2191
336 Ga0439447_038392 3300041407 Bacteria 1177
337 Ga0439466_0000502 3300041411 Bacteria 14823
338 Ga0439448_0036751 3300042005 Bacteria 1571
339 Ga0439432_000094 3300042006 Bacteria 28344
340 Ga0439455_0057445 3300042012 Bacteria 1026
341 Ga0450890_064093 3300042127 Bacteria 579
342 Ga0439446_0247561 3300042156 Bacteria 614
343 Ga0439458_0002046 3300042157 Bacteria 5014
344 Ga0466970_0280109 3300044765 Bacteria 938
345 Ga0495627_053343 3300046453 Bacteria 1210
346 Ga0495591_017335 3300046458 Bacteria 2476
347 Ga0495650_0003769 3300046471 Bacteria 10813
348 Ga0495605_0000033 3300046474 Bacteria 209203
349 Ga0495605_0000119 3300046474 Bacteria 102569
350 Ga0495605_0003643 3300046474 Bacteria 9143
351 Ga0495584_0001222 3300046491 Bacteria 15675
352 Ga0495594_0005312 3300046499 Bacteria 6614
353 Ga0495583_0000031 3300046506 Bacteria 253982
354 Ga0495606_0147793 3300046507 Bacteria 1382
355 Ga0495610_0022393 3300046512 Bacteria 3457
356 Ga0495620_0000038 3300046515 Bacteria 114064
357 Ga0495631_0000969 3300046518 Bacteria 17811
358 Ga0495632_0320546 3300046519 Bacteria 685
359 Ga0495637_0020492 3300046520 Bacteria 3043
360 Ga0495643_0004076 3300046522 Bacteria 10403
361 Ga0495654_0023230 3300046530 Bacteria 3212
362 Ga0495609_0000018 3300046538 Bacteria 302609
363 Ga0495621_0011850 3300046539 Bacteria 2708
364 Ga0495597_0004117 3300046542 Bacteria 8096
365 Ga0495633_0000062 3300046558 Bacteria 142101
366 Ga0495633_0011529 3300046558 Bacteria 4760
367 Ga0495668_0195554 3300046616 Bacteria 1107
368 Ga0495611_0032538 3300046648 Bacteria 2298
369 Ga0495625_0001696 3300046660 Bacteria 25671
370 Ga0495625_0020685 3300046660 Bacteria 5073
371 Ga0495661_0000016 3300046665 Bacteria 213593
372 Ga0495669_0000269 3300046684 Bacteria 29811
373 Ga0495669_0034049 3300046684 Bacteria 2244
374 Ga0495669_0130119 3300046684 Bacteria 1184
375 Ga0495671_0206338 3300046692 Bacteria 952
376 Ga0495649_0000030 3300046694 Bacteria 152164
377 Ga0495589_0000246 3300046794 Bacteria 44673
378 Ga0495660_0027129 3300046810 Bacteria 3240
379 Ga0495672_0000292 3300047320 Bacteria 69008
380 Ga0495672_0003559 3300047320 Bacteria 13256
381 Ga0495683_0000092 3300047323 Bacteria 91056
382 Ga0495687_002072 3300047443 Bacteria 16858
383 Ga0495679_000241 3300047446 Bacteria 45465
384 Ga0495685_066898 3300047447 Bacteria 1207
385 Ga0495673_0005253 3300047469 Bacteria 7866
386 Ga0495681_0035527 3300047470 Bacteria 2473
387 Ga0495686_0000550 3300047472 Bacteria 53672
388 Ga0495686_0054454 3300047472 Bacteria 2505
389 Ga0495686_0366045 3300047472 Bacteria 781
390 Ga0495686_0677342 3300047472 Bacteria 528
391 Ga0495626_0003882 3300048091 Bacteria 9372
392 Ga0496100_0005139 3300048903 Bacteria 7017
393 Ga0496100_0240101 3300048903 Bacteria 1336
394 Ga0496101_0027208 3300048904 Bacteria 3981
395 Ga0496102_0001484 3300048905 Bacteria 20725
396 Ga0496102_0167368 3300048905 Bacteria 2069
397 Ga0496102_0178333 3300048905 Bacteria 2001
398 Ga0496102_0399104 3300048905 Bacteria 1293
399 Ga0496103_0000111 3300048906 Bacteria 89596
400 Ga0496103_0426987 3300048906 Bacteria 851
401 Ga0496104_0005088 3300048907 Bacteria 11475
402 Ga0496105_0006966 3300048908 Bacteria 8709
403 Ga0496106_0037998 3300048909 Bacteria 3602
404 Ga0496106_0144335 3300048909 Bacteria 1874
405 Ga0496107_0286112 3300048910 Bacteria 1227
406 Ga0496107_1102491 3300048910 Bacteria 573
407 Ga0496108_0003893 3300048911 Bacteria 11988
408 Ga0496108_0022095 3300048911 Bacteria 5230
409 Ga0496108_1108993 3300048911 Bacteria 672
410 Ga0496109_0002880 3300048912 Bacteria 14401
411 Ga0496109_0046658 3300048912 Bacteria 3936
412 Ga0496109_0237705 3300048912 Bacteria 1714
413 Ga0496111_0621142 3300048914 Bacteria 790
414 Ga0496112_0003717 3300048915 Bacteria 12734
415 Ga0496112_0419941 3300048915 Bacteria 1276
416 Ga0496112_0867400 3300048915 Bacteria 826
417 Ga0496112_0946932 3300048915 Bacteria 782
418 Ga0496112_1296129 3300048915 Bacteria 644
419 Ga0496113_0000042 3300048916 Bacteria 53513
420 Ga0496113_0115471 3300048916 Bacteria 2094
421 Ga0496113_0231559 3300048916 Bacteria 1473
422 Ga0496114_0051132 3300048917 Bacteria 3440
423 Ga0496114_0758751 3300048917 Bacteria 848
424 Ga0496115_0103946 3300048918 Bacteria 2331
425 Ga0496116_0017586 3300048919 Bacteria 5542
426 Ga0496116_0036869 3300048919 Bacteria 3416
427 Ga0496116_0040950 3300048919 Bacteria 3184
428 Ga0496116_0104569 3300048919 Bacteria 1682
429 Ga0496116_0247704 3300048919 Bacteria 889
430 Ga0496117_0000414 3300048920 Bacteria 71876
431 Ga0496117_0006949 3300048920 Bacteria 11221
432 Ga0496117_0027635 3300048920 Bacteria 4414
433 Ga0496117_0222750 3300048920 Bacteria 1048
434 Ga0496117_0483760 3300048920 Bacteria 604
435 Ga0496117_0518743 3300048920 Bacteria 574
436 Ga0496118_0000901 3300048921 Bacteria 46540
437 Ga0496118_0006842 3300048921 Bacteria 12373
438 Ga0496118_0020431 3300048921 Bacteria 5872
439 Ga0496118_0024301 3300048921 Bacteria 5236
440 Ga0496118_0070633 3300048921 Bacteria 2520
441 Ga0496118_0323087 3300048921 Bacteria 836
442 Ga0496118_0361265 3300048921 Bacteria 769
443 Ga0496119_0000838 3300048922 Bacteria 40796
444 Ga0496119_0028662 3300048922 Bacteria 3793
445 Ga0496120_0006566 3300048923 Bacteria 8885
446 Ga0496120_0024469 3300048923 Bacteria 3765
447 Ga0496120_0076345 3300048923 Bacteria 1826
448 Ga0496120_0450757 3300048923 Bacteria 560
449 Ga0496121_0000072 3300048924 Bacteria 244975
450 Ga0496121_0000356 3300048924 Bacteria 94447
451 Ga0496121_0000600 3300048924 Bacteria 67818
452 Ga0496121_0000653 3300048924 Bacteria 64947
453 Ga0496121_0002248 3300048924 Bacteria 30091
454 Ga0496121_0003957 3300048924 Bacteria 20469
455 Ga0496121_0012732 3300048924 Bacteria 9119
456 Ga0496121_0044616 3300048924 Bacteria 3821
457 Ga0496121_0165870 3300048924 Bacteria 1610
458 Ga0496121_0201411 3300048924 Bacteria 1418
459 Ga0496121_0283558 3300048924 Bacteria 1132
460 Ga0496122_0000269 3300048925 Bacteria 116292
461 Ga0496122_0005009 3300048925 Bacteria 16023
462 Ga0496122_0020346 3300048925 Bacteria 6001
463 Ga0496122_0029888 3300048925 Bacteria 4581
464 Ga0496122_0054464 3300048925 Bacteria 3004
465 Ga0496123_0000712 3300048926 Bacteria 54440
466 Ga0496123_0002434 3300048926 Bacteria 23130
467 Ga0496123_0004617 3300048926 Bacteria 14324
468 Ga0496123_0004954 3300048926 Bacteria 13649
469 Ga0496123_0006377 3300048926 Bacteria 11449
470 Ga0496123_0017117 3300048926 Bacteria 5849
471 Ga0496124_0000110 3300048927 Bacteria 166321
472 Ga0496124_0001293 3300048927 Bacteria 37983
473 Ga0496124_0001811 3300048927 Bacteria 29573
474 Ga0496124_0079230 3300048927 Bacteria 2705
475 Ga0496125_0000229 3300048928 Bacteria 114537
476 Ga0496125_0002079 3300048928 Bacteria 26983
477 Ga0496125_0016849 3300048928 Bacteria 7000
478 Ga0496125_0027965 3300048928 Bacteria 5100
479 Ga0496125_0748107 3300048928 Bacteria 512
480 Ga0496126_0000219 3300048929 Bacteria 125157
481 Ga0496126_0001930 3300048929 Bacteria 29576
482 Ga0496126_0015060 3300048929 Bacteria 7794
483 Ga0496126_0015817 3300048929 Bacteria 7577
484 Ga0496126_0089368 3300048929 Bacteria 2712
485 Ga0495678_000021 3300049459 Bacteria 239150
486 Ga0495678_000234 3300049459 Bacteria 63308
487 Ga0495678_025797 3300049459 Bacteria 2519
488 Ga0501043_0072404 3300049579 Bacteria 2707
489 Ga0501047_1388977 3300049581 Bacteria 517
490 Ga0501067_0146106 3300049583 Bacteria 1317
491 Ga0501068_0061842 3300049584 Bacteria 2276
492 Ga0501069_0223039 3300049585 Bacteria 1096
493 Ga0501222_000325 3300049662 Bacteria 7504
494 Ga0501257_084424 3300049686 Bacteria 821
495 Ga0501044_0030400 3300049823 Bacteria 5693
496 nmdc:mga00v17_425755_c1 3300050491 Bacteria 862
497 nmdc:mga07m45_446147_c1 3300050496 Bacteria 750
498 nmdc:mga0sz30_14580_c1 3300050516 Bacteria 3096
499 Ga0500583_0035133 3300053092 Bacteria 2234
500 Ga0500595_048421 3300053119 Bacteria 1328
501 Ga0500607_239431 3300053121 Bacteria 735
502 Ga0500618_108526 3300053125 Bacteria 626
503 Ga0500658_0000051 3300053134 Bacteria 62135
504 Ga0500568_0001663 3300053139 Bacteria 13936
505 Ga0500590_000472 3300053148 Bacteria 13775
506 Ga0500616_0080822 3300053153 Bacteria 1634
507 Ga0500627_0036386 3300053158 Bacteria 2096
508 Ga0500636_0045489 3300053177 Bacteria 2589
509 Ga0500596_047747 3300053735 Bacteria 695
510 Ga0587066_063268 3300059490 Bacteria 761
511 Ga0587068_036094 3300059641 Bacteria 878
512 Ga0587069_046471 3300059642 Bacteria 758
513 2515688268 2515154123 Bacteria 6387382
514 2738712365 2738541275 Bacteria 4830863
515 2738850790 2738541301 Bacteria 4834102
516 2738866519 2738541304 Bacteria 4833665
517 2739299037 2738543022 Bacteria 4835059
518 2739360715 2738543033 Bacteria 4833336
519 2808929793 2808606377 Bacteria 6646337
520 2808952132 2808606381 Bacteria 6646461
521 2808961698 2808606382 Bacteria 6841132
522 2816470888 2816332133 Bacteria 7249298
523 2842819875 2842815866 Bacteria 5947510
524 2884961776 2884960567 Bacteria 5437054
525 2928534941 2928531327 Bacteria 5101314
526 JGI24736J21556_1048292
527 SwRhRL2b_contig_1793279
528 SwRhRL2b_contig_3665959
529 SwRhRL2b_contig_875286
530 JGI24736J21556_1001357
531 JGI24740J21852_10067811
532 JGI24739J22299_10014380
533 JGI24739J22299_10027977
534 JGI24737J22298_10072303
535 JGI24735J21928_10006833
536 rootH2_10065310
537 rootL2_10321619
538 Ga0055526_1003911
539 Ga0065704_10001975
540 Ga0065704_10072411
541 Ga0065704_10090137
542 Ga0065704_10094279
543 Ga0065707_10120005
544 Ga0070658_11100512
545 Ga0070690_100001607
546 Ga0070670_100082900
547 Ga0070666_10000479
548 Ga0070666_10041134
549 Ga0068868_100000635
550 Ga0068868_101650346
551 Ga0070660_100004200
552 Ga0070660_100009128
553 Ga0070660_100038884
554 Ga0070660_100563477
555 Ga0070689_100233340
556 Ga0070689_101676395
557 Ga0070687_100499913
558 Ga0070661_100019603
559 Ga0070668_100005762
560 Ga0070668_100015102
561 Ga0070669_100002401
562 Ga0070669_100331721
563 Ga0070675_100143279
564 Ga0070675_100312855
565 Ga0070671_100006910
566 Ga0070671_100016603
567 Ga0070671_100354978
568 Ga0070671_100486842
569 Ga0070674_100000246
570 Ga0070674_100138505
571 Ga0070673_100010066
572 Ga0070673_100156831
573 Ga0070673_100198270
574 Ga0070673_100245457
575 Ga0070673_100332713
576 Ga0070688_100225628
577 Ga0070659_100005094
578 Ga0070659_100036279
579 Ga0070667_100001121
580 Ga0070667_100016694
581 Ga0070667_100017742
582 Ga0070667_100089557
583 Ga0070667_100095796
584 Ga0070667_100540919
585 Ga0070667_100576611
586 Ga0070705_100096093
587 Ga0070700_100555781
588 Ga0070678_100000187
589 Ga0070678_100088587
590 Ga0070662_100021818
591 Ga0070662_100130023
592 Ga0070662_100168073
593 Ga0070662_101124767
594 Ga0070681_11403643
595 Ga0068867_100134612
596 Ga0068867_100604870
597 Ga0070679_101599606
598 Ga0068853_100278550
599 Ga0070672_100004299
600 Ga0070672_100135447
601 Ga0070672_100630132
602 Ga0070686_101690383
603 Ga0070665_100008625
604 Ga0070665_100022421
605 Ga0070665_100065537
606 Ga0070665_100168264
607 Ga0070665_100220573
608 Ga0068855_100192044
609 Ga0068855_100586790
610 Ga0068855_101917306
611 Ga0070664_102260646
612 Ga0068857_100030929
613 Ga0068854_100143073
614 Ga0068854_100721807
615 Ga0068856_100014726
616 Ga0068856_100346664
617 Ga0068852_100012931
618 Ga0068852_100064682
619 Ga0068864_100055595
620 Ga0068864_100179977
621 Ga0068864_100307583
622 Ga0068864_101275321
623 Ga0068866_10013963
624 Ga0068866_10633747
625 Ga0068851_10112431
626 Ga0068870_11117047
627 Ga0068863_100017809
628 Ga0068863_100022777
629 Ga0068863_100388341
630 Ga0068863_100489582
631 Ga0068858_100000310
632 Ga0068858_100000438
633 Ga0068858_100006991
634 Ga0068860_100051896
635 Ga0068860_100144614
636 Ga0068860_100327930
637 Ga0068860_100452845
638 Ga0068862_100016278
639 Ga0068862_100109858
640 Ga0068862_100133785
641 Ga0068862_100180026
642 Ga0097621_100048541
643 Ga0097621_100171811
644 Ga0097621_100217324
645 Ga0097621_101760654
646 Ga0068871_100071578
647 Ga0075429_100286166
648 Ga0068865_101147267
649 Ga0097620_100111006
650 Ga0105251_10052904
651 Ga0105251_10212572
652 Ga0105250_10006080
653 Ga0105240_10000206
654 Ga0105240_10014310
655 Ga0105245_10075518
656 Ga0105245_10435056
657 Ga0105247_10122917
658 Ga0105243_10000077
659 Ga0105243_10045805
660 Ga0105242_10060071
661 Ga0105248_10000119
662 Ga0105248_10006802
663 Ga0105248_10012383
664 Ga0105248_10090684
665 Ga0105248_10171040
666 Ga0105248_10242747
667 Ga0105248_10296514
668 Ga0105248_10372960
669 Ga0105248_10393913
670 Ga0105237_10001347
671 Ga0105238_10538715
672 Ga0105249_10008812
673 Ga0105249_10158880
674 Ga0105249_10353216
675 Ga0105239_10000113
676 Ga0105239_10004322
677 Ga0157373_10001163
678 Ga0157371_10066794
679 Ga0157371_10290212
680 Ga0157370_10000176
681 Ga0157370_10300236
682 Ga0157369_10053466
683 Ga0157369_10229679
684 Ga0157374_10015658
685 Ga0157378_10082984
686 Ga0163162_10000793
687 Ga0163162_10021506
688 Ga0163162_10150550
689 Ga0163162_10648031
690 Ga0163162_11041418
691 Ga0163162_11597483
692 Ga0157372_11215970
693 Ga0157375_10032576
694 Ga0157375_10375570
695 Ga0163163_10003777
696 Ga0163161_10047822
697 Ga0207427_100436
698 Ga0209437_105693
699 Ga0209026_1001456
700 Ga0209759_1023813
701 Ga0209233_1000213
702 Ga0209233_1000291
703 Ga0209564_1000670
704 Ga0209050_1001657
705 Ga0207697_10071765
706 Ga0207656_10172730
707 Ga0207696_1003816
708 Ga0207713_1010826
709 Ga0207713_1038698
710 Ga0207713_1165659
711 Ga0207642_10023989
712 Ga0207710_10012934
713 Ga0207680_10001352
714 Ga0207680_10005803
715 Ga0207680_10027983
716 Ga0207647_10000447
717 Ga0207647_10015339
718 Ga0207647_10017721
719 Ga0207647_10139638
720 Ga0207645_10081372
721 Ga0207705_10000008
722 Ga0207705_10074150
723 Ga0207695_10046718
724 Ga0207695_10072811
725 Ga0207671_10001107
726 Ga0207671_10469146
727 Ga0207671_10905249
728 Ga0207657_10000676
729 Ga0207657_10006429
730 Ga0207657_10054451
731 Ga0207657_10258412
732 Ga0207649_10229477
733 Ga0207681_10001728
734 Ga0207681_10272175
735 Ga0207681_10341987
736 Ga0207650_10085982
737 Ga0207659_10113360
738 Ga0207644_10003817
739 Ga0207644_10010505
740 Ga0207644_10014136
741 Ga0207644_10227048
742 Ga0207644_11657622
743 Ga0207690_10007834
744 Ga0207690_10038499
745 Ga0207706_10015188
746 Ga0207706_10105371
747 Ga0207709_10000110
748 Ga0207709_10014707
749 Ga0207670_10838618
750 Ga0207669_10000015
751 Ga0207669_10816877
752 Ga0207691_10006960
753 Ga0207691_10324640
754 Ga0207711_10000047
755 Ga0207711_10020872
756 Ga0207711_10027260
757 Ga0207711_10037419
758 Ga0207711_10052190
759 Ga0207711_10170438
760 Ga0207711_10179823
761 Ga0207689_10755109
762 Ga0207667_10139729
763 Ga0207667_10315477
764 Ga0207651_10000205
765 Ga0207651_10010071
766 Ga0207651_10167043
767 Ga0207712_10097482
768 Ga0207668_10005073
769 Ga0207668_10010874
770 Ga0207668_10021629
771 Ga0207668_10155036
772 Ga0207640_10164699
773 Ga0207640_10630780
774 Ga0207658_10011589
775 Ga0207658_10029634
776 Ga0207658_10035471
777 Ga0207658_10083076
778 Ga0207658_10157189
779 Ga0207658_10882509
780 Ga0207677_10003084
781 Ga0207703_10000917
782 Ga0207703_10009773
783 Ga0207703_10017621
784 Ga0207639_10050993
785 Ga0207678_10707731
786 Ga0207708_10291811
787 Ga0207702_10006519
788 Ga0207641_10007041
789 Ga0207641_10047342
790 Ga0207641_10319522
791 Ga0207648_10126269
792 Ga0207676_10083723
793 Ga0207676_10197717
794 Ga0207676_10307474
795 Ga0207676_11227794
796 Ga0207676_12082710
797 Ga0207674_10431670
798 Ga0207683_10000954
799 Ga0207683_10031689
800 Ga0207683_10109620
801 Ga0207683_10353357
802 Ga0207683_11090466
803 Ga0207698_10025031
804 Ga0207698_10087405
805 Ga0268266_10022849
806 Ga0268266_10022870
807 Ga0268266_10169223
808 Ga0268265_10010725
809 Ga0268265_10142153
810 Ga0268265_10162816
811 Ga0268265_10516453
812 Ga0268265_10804836
813 Ga0268264_10015982
814 Ga0268264_10034353
815 Ga0268264_10414456
816 Ga0268264_11419343
817 Ga0307408_100005457
818 Ga0307408_102001355
819 Ga0307405_10018176
820 Ga0307410_10020715
821 Ga0307410_10147107
822 Ga0307406_11055236
823 Ga0307407_10090146
824 Ga0307412_10003194
825 Ga0307412_10010732
826 Ga0307412_10060156
827 Ga0307412_10148740
828 Ga0307409_100060952
829 Ga0307409_100309521
830 Ga0307409_101401522
831 Ga0307416_100001205
832 Ga0307416_100813351
833 Ga0307414_10117900
834 Ga0307411_10055509
835 Ga0307411_10074250
836 Ga0307411_10779360
837 Ga0307411_12065523
838 Ga0307415_100078375
839 Ga0307415_100136558
840 Ga0307415_100202805
841 Ga0373923_0200539
842 Ga0395899_0006882
843 Ga0395899_0335255
844 Ga0395899_0592458
845 Ga0395900_0101796
846 Ga0395900_0117624
847 Ga0395900_0578306
848 Ga0395898_0092215
849 Ga0395898_0893651
850 Ga0395905_0002182
851 Ga0395905_0056128
852 Ga0395905_0789010
853 Ga0395905_1339783
854 Ga0395901_0011294
855 Ga0395901_0048402
856 Ga0436361_0850351
857 Ga0436363_0572110
858 Ga0439438_009321
859 Ga0439438_049690
860 Ga0439447_014661
861 Ga0439447_038392
862 Ga0439466_0000502
863 Ga0439448_0036751
864 Ga0439432_000094
865 Ga0439455_0057445
866 Ga0450890_064093
867 Ga0439446_0247561
868 Ga0439458_0002046
869 Ga0466970_0280109
870 Ga0495627_053343
871 Ga0495591_017335
872 Ga0495650_0003769
873 Ga0495605_0000033
874 Ga0495605_0000119
875 Ga0495605_0003643
876 Ga0495584_0001222
877 Ga0495594_0005312
878 Ga0495583_0000031
879 Ga0495606_0147793
880 Ga0495610_0022393
881 Ga0495620_0000038
882 Ga0495631_0000969
883 Ga0495632_0320546
884 Ga0495637_0020492
885 Ga0495643_0004076
886 Ga0495654_0023230
887 Ga0495609_0000018
888 Ga0495621_0011850
889 Ga0495597_0004117
890 Ga0495633_0000062
891 Ga0495633_0011529
892 Ga0495668_0195554
893 Ga0495611_0032538
894 Ga0495625_0001696
895 Ga0495625_0020685
896 Ga0495661_0000016
897 Ga0495669_0000269
898 Ga0495669_0034049
899 Ga0495669_0130119
900 Ga0495671_0206338
901 Ga0495649_0000030
902 Ga0495589_0000246
903 Ga0495660_0027129
904 Ga0495672_0000292
905 Ga0495672_0003559
906 Ga0495683_0000092
907 Ga0495687_002072
908 Ga0495679_000241
909 Ga0495685_066898
910 Ga0495673_0005253
911 Ga0495681_0035527
912 Ga0495686_0000550
913 Ga0495686_0054454
914 Ga0495686_0366045
915 Ga0495686_0677342
916 Ga0495626_0003882
917 Ga0496100_0005139
918 Ga0496100_0240101
919 Ga0496101_0027208
920 Ga0496102_0001484
921 Ga0496102_0167368
922 Ga0496102_0178333
923 Ga0496102_0399104
924 Ga0496103_0000111
925 Ga0496103_0426987
926 Ga0496104_0005088
927 Ga0496105_0006966
928 Ga0496106_0037998
929 Ga0496106_0144335
930 Ga0496107_0286112
931 Ga0496107_1102491
932 Ga0496108_0003893
933 Ga0496108_0022095
934 Ga0496108_1108993
935 Ga0496109_0002880
936 Ga0496109_0046658
937 Ga0496109_0237705
938 Ga0496111_0621142
939 Ga0496112_0003717
940 Ga0496112_0419941
941 Ga0496112_0867400
942 Ga0496112_0946932
943 Ga0496112_1296129
944 Ga0496113_0000042
945 Ga0496113_0115471
946 Ga0496113_0231559
947 Ga0496114_0051132
948 Ga0496114_0758751
949 Ga0496115_0103946
950 Ga0496116_0017586
951 Ga0496116_0036869
952 Ga0496116_0040950
953 Ga0496116_0104569
954 Ga0496116_0247704
955 Ga0496117_0000414
956 Ga0496117_0006949
957 Ga0496117_0027635
958 Ga0496117_0222750
959 Ga0496117_0483760
960 Ga0496117_0518743
961 Ga0496118_0000901
962 Ga0496118_0006842
963 Ga0496118_0020431
964 Ga0496118_0024301
965 Ga0496118_0070633
966 Ga0496118_0323087
967 Ga0496118_0361265
968 Ga0496119_0000838
969 Ga0496119_0028662
970 Ga0496120_0006566
971 Ga0496120_0024469
972 Ga0496120_0076345
973 Ga0496120_0450757
974 Ga0496121_0000072
975 Ga0496121_0000356
976 Ga0496121_0000600
977 Ga0496121_0000653
978 Ga0496121_0002248
979 Ga0496121_0003957
980 Ga0496121_0012732
981 Ga0496121_0044616
982 Ga0496121_0165870
983 Ga0496121_0201411
984 Ga0496121_0283558
985 Ga0496122_0000269
986 Ga0496122_0005009
987 Ga0496122_0020346
988 Ga0496122_0029888
989 Ga0496122_0054464
990 Ga0496123_0000712
991 Ga0496123_0002434
992 Ga0496123_0004617
993 Ga0496123_0004954
994 Ga0496123_0006377
995 Ga0496123_0017117
996 Ga0496124_0000110
997 Ga0496124_0001293
998 Ga0496124_0001811
999 Ga0496124_0079230
1000 Ga0496125_0000229
1001 Ga0496125_0002079
1002 Ga0496125_0016849
1003 Ga0496125_0027965
1004 Ga0496125_0748107
1005 Ga0496126_0000219
1006 Ga0496126_0001930
1007 Ga0496126_0015060
1008 Ga0496126_0015817
1009 Ga0496126_0089368
1010 Ga0495678_000021
1011 Ga0495678_000234
1012 Ga0495678_025797
1013 Ga0501043_0072404
1014 Ga0501047_1388977
1015 Ga0501067_0146106
1016 Ga0501068_0061842
1017 Ga0501069_0223039
1018 Ga0501222_000325
1019 Ga0501257_084424
1020 Ga0501044_0030400
1021 nmdc:mga00v17_425755_c1
1022 nmdc:mga07m45_446147_c1
1023 nmdc:mga0sz30_14580_c1
1024 Ga0500583_0035133
1025 Ga0500595_048421
1026 Ga0500607_239431
1027 Ga0500618_108526
1028 Ga0500658_0000051
1029 Ga0500568_0001663
1030 Ga0500590_000472
1031 Ga0500616_0080822
1032 Ga0500627_0036386
1033 Ga0500636_0045489
1034 Ga0500596_047747
1035 Ga0587066_063268
1036 Ga0587068_036094
1037 Ga0587069_046471
1038 2515688268
1039 2738712365
1040 2738850790
1041 2738866519
1042 2739299037
1043 2739360715
1044 2808929793
1045 2808952132
1046 2808961698
1047 2816470888
1048 2842819875
1049 2884961776
1050 2928534941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

37

128

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f9f-assembly1.cif.gz_A crystal structure of rig-i helicase-rd in complex with 24-mer blunt-end hairpin rna 0.4197 25 134
5f9f-assembly1.cif.gz_G crystal structure of rig-i helicase-rd in complex with 24-mer blunt-end hairpin rna 0.4087 25 135
4r5l-assembly1.cif.gz_A crystal structure of the dnak c-terminus (dnak-sbd-c) 0.3942 1 81
4xxi-assembly1.cif.gz_B crystal structure of the bilin-binding domain of phycobilisome core-membrane linker apce 0.3886 13 130
8oir-assembly1.cif.gz_Aa 55s human mitochondrial ribosome with mtrf1 and p-site trna 0.3836 16 132
ID Description Score Start End Superfamily
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7305 20 133 1.20.120.550
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7269 21 144 1.20.120.550
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6676 15 132 1.20.120.550
af_D3ZYP5_7_123_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6628 28 127 1.20.120.550
af_P75685_2_182_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6563 7 133 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1G6RHJ0-F1-model_v4 deleted 0.9997 22 144
AF-A0A370X196-F1-model_v4 DoxX family protein 0.997 15 144 GO:0005886
AF-A0A3S0PRN6-F1-model_v4 DoxX family protein 0.9928 16 144 GO:0005886
AF-A0A4R1IQ19-F1-model_v4 deleted 0.9921 15 144
AF-W0VEU8-F1-model_v4 DoxX family protein 0.9918 11 144 GO:0005886

Map