F459112

General Info

Members Datasets Scaffolds Average Seq Length
524 256 1048 67

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10534873|Ga0075432_105348731
Length 76
Sequence MLNGLEQVTLMASTGTIKRKTDKGFGFIAAADGTEYFFHQSACIATSFDQLREGQRVSFTVGQGPKGPRAENVKPE

Samples

Sample ID Description Type Environment
1 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
151 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
152 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
175 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
182 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
183 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
184 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
185 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
237 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
238 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 7.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.57
Nodule 0
Rhizoplane 0.38
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 27.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075432_10534873 3300006058 Unclassified 527
2 Ga0006778J45830_1028128 3300003162 Bacteria 908
3 Ga0006759J45824_1056342 3300003163 Bacteria 665
4 Ga0006777J48905_1017969 3300003308 Bacteria 1053
5 Ga0007417J51691_1037060 3300003544 Bacteria 1002
6 Ga0007427J51700_116602 3300003559 Bacteria 949
7 Ga0006781J51513_1014858 3300003568 Bacteria 847
8 Ga0007410J51695_1030170 3300003574 Bacteria 1009
9 Ga0007409J51694_1043070 3300003575 Bacteria 847
10 Ga0007416J51690_1018545 3300003577 Bacteria 850
11 Ga0007429J51699_1019793 3300003579 Bacteria 992
12 Ga0032354_1009578 3300003693 Bacteria 970
13 Ga0006780_1009764 3300003735 Bacteria 1081
14 Ga0065714_10104281 3300005288 Bacteria 1587
15 Ga0065714_10108786 3300005288 Bacteria 1510
16 Ga0065704_10026740 3300005289 Bacteria 1653
17 Ga0065704_10284054 3300005289 Bacteria 916
18 Ga0065712_10020427 3300005290 Bacteria 1220
19 Ga0065712_10024818 3300005290 Unclassified 1034
20 Ga0065712_10192630 3300005290 Bacteria 1142
21 Ga0065712_10323954 3300005290 Bacteria 824
22 Ga0065715_10135777 3300005293 Bacteria 1933
23 Ga0065707_10102121 3300005295 Unclassified 2825
24 Ga0065707_10254482 3300005295 Bacteria 1115
25 Ga0065707_10296068 3300005295 Bacteria 1014
26 Ga0065707_10546539 3300005295 Bacteria 724
27 Ga0070676_10133378 3300005328 Bacteria 1573
28 Ga0070676_10217006 3300005328 Bacteria 1261
29 Ga0070690_100146395 3300005330 Bacteria 1608
30 Ga0070670_100000452 3300005331 Bacteria 33186
31 Ga0070670_100035852 3300005331 Unclassified 4270
32 Ga0070670_100046001 3300005331 Bacteria 3752
33 Ga0070670_101528265 3300005331 Bacteria 613
34 Ga0070670_101774473 3300005331 Bacteria 568
35 Ga0070677_10233929 3300005333 Unclassified 904
36 Ga0070677_10246288 3300005333 Bacteria 885
37 Ga0070677_10605219 3300005333 Bacteria 607
38 Ga0070677_10651925 3300005333 Bacteria 588
39 Ga0070666_10247609 3300005335 Bacteria 1261
40 Ga0070666_11156975 3300005335 Unclassified 576
41 Ga0070689_100069504 3300005340 Bacteria 2747
42 Ga0070689_100484859 3300005340 Unclassified 1057
43 Ga0070689_100494306 3300005340 Bacteria 1047
44 Ga0070687_100194889 3300005343 Bacteria 1223
45 Ga0070687_100599118 3300005343 Bacteria 757
46 Ga0070661_100622120 3300005344 Bacteria 874
47 Ga0070661_100631498 3300005344 Bacteria 868
48 Ga0070661_100943077 3300005344 Bacteria 714
49 Ga0070692_10353529 3300005345 Bacteria 914
50 Ga0070692_10750002 3300005345 Bacteria 662
51 Ga0070692_11086182 3300005345 Unclassified 564
52 Ga0070668_101127612 3300005347 Unclassified 709
53 Ga0070668_101620583 3300005347 Bacteria 593
54 Ga0070669_100008687 3300005353 Bacteria 7246
55 Ga0070669_100114016 3300005353 Bacteria 2054
56 Ga0070669_100334513 3300005353 Bacteria 1226
57 Ga0070669_101188254 3300005353 Bacteria 659
58 Ga0070675_100001766 3300005354 Bacteria 15937
59 Ga0070675_100009069 3300005354 Bacteria 7727
60 Ga0070675_100038625 3300005354 Bacteria 3892
61 Ga0070675_100055976 3300005354 Bacteria 3248
62 Ga0070675_100069126 3300005354 Bacteria 2925
63 Ga0070675_100700784 3300005354 Bacteria 922
64 Ga0070675_101015003 3300005354 Unclassified 762
65 Ga0070675_101297584 3300005354 Unclassified 671
66 Ga0070675_101441045 3300005354 Bacteria 635
67 Ga0070671_100457118 3300005355 Bacteria 1096
68 Ga0070671_100522056 3300005355 Bacteria 1023
69 Ga0070671_100649496 3300005355 Bacteria 913
70 Ga0070674_100000630 3300005356 Bacteria 17719
71 Ga0070674_100141588 3300005356 Bacteria 1805
72 Ga0070674_100301885 3300005356 Bacteria 1277
73 Ga0070674_100387392 3300005356 Unclassified 1139
74 Ga0070674_100589821 3300005356 Unclassified 938
75 Ga0070674_100666465 3300005356 Unclassified 886
76 Ga0070674_101137857 3300005356 Bacteria 691
77 Ga0070674_101437781 3300005356 Unclassified 618
78 Ga0070674_101688256 3300005356 Bacteria 572
79 Ga0070673_100026890 3300005364 Bacteria 4256
80 Ga0070673_100039613 3300005364 Bacteria 3608
81 Ga0070673_100204883 3300005364 Bacteria 1700
82 Ga0070673_100760971 3300005364 Bacteria 892
83 Ga0070673_100930687 3300005364 Bacteria 807
84 Ga0070673_101060148 3300005364 Unclassified 756
85 Ga0070688_100149624 3300005365 Bacteria 1595
86 Ga0070688_100160640 3300005365 Bacteria 1543
87 Ga0070659_100422116 3300005366 Unclassified 1128
88 Ga0070667_100253456 3300005367 Bacteria 1574
89 Ga0070667_101106370 3300005367 Bacteria 741
90 Ga0070701_10310667 3300005438 Bacteria 972
91 Ga0070705_100383229 3300005440 Archaea 1035
92 Ga0070705_101544782 3300005440 Unclassified 557
93 Ga0070700_100441968 3300005441 Unclassified 988
94 Ga0070694_100140301 3300005444 Bacteria 1755
95 Ga0070708_101443927 3300005445 Bacteria 641
96 Ga0070663_100147966 3300005455 Bacteria 1798
97 Ga0070678_100086118 3300005456 Bacteria 2396
98 Ga0070678_100221587 3300005456 Bacteria 1572
99 Ga0070678_100480786 3300005456 Unclassified 1093
100 Ga0070678_100719242 3300005456 Unclassified 901
101 Ga0070678_100791983 3300005456 Bacteria 860
102 Ga0070678_102236536 3300005456 Bacteria 519
103 Ga0070662_100670959 3300005457 Bacteria 875
104 Ga0070662_101096839 3300005457 Bacteria 683
105 Ga0068867_100157372 3300005459 Bacteria 1789
106 Ga0068867_101888422 3300005459 Bacteria 563
107 Ga0070685_10576064 3300005466 Bacteria 807
108 Ga0070706_101229451 3300005467 Bacteria 688
109 Ga0070706_101793514 3300005467 Bacteria 558
110 Ga0070707_100946687 3300005468 Bacteria 826
111 Ga0070707_101070961 3300005468 Bacteria 772
112 Ga0070698_100067733 3300005471 Unclassified 3589
113 Ga0070698_100197863 3300005471 Bacteria 1946
114 Ga0070698_100757861 3300005471 Bacteria 914
115 Ga0070699_100003305 3300005518 Bacteria 14261
116 Ga0070699_100118828 3300005518 Bacteria 2324
117 Ga0070697_101477363 3300005536 Unclassified 607
118 Ga0070672_100005657 3300005543 Bacteria 8319
119 Ga0070672_100021655 3300005543 Unclassified 4708
120 Ga0070672_100456705 3300005543 Bacteria 1101
121 Ga0070672_100535847 3300005543 Bacteria 1015
122 Ga0070672_100611547 3300005543 Bacteria 950
123 Ga0070672_100738838 3300005543 Unclassified 863
124 Ga0070672_101058598 3300005543 Bacteria 720
125 Ga0070686_100004045 3300005544 Bacteria 8066
126 Ga0070686_100383721 3300005544 Archaea 1064
127 Ga0070686_101688995 3300005544 Bacteria 537
128 Ga0070696_101162960 3300005546 Unclassified 651
129 Ga0070665_100219871 3300005548 Bacteria 1900
130 Ga0070665_100801150 3300005548 Bacteria 955
131 Ga0070665_102453270 3300005548 Bacteria 523
132 Ga0070704_100008127 3300005549 Bacteria 6273
133 Ga0070704_100008704 3300005549 Bacteria 6104
134 Ga0070704_102316754 3300005549 Bacteria 500
135 Ga0070664_100806412 3300005564 Unclassified 878
136 Ga0068857_100411786 3300005577 Bacteria 1259
137 Ga0068857_100762346 3300005577 Unclassified 922
138 Ga0068857_101415134 3300005577 Unclassified 677
139 Ga0068859_100344977 3300005617 Bacteria 1584
140 Ga0068859_100374409 3300005617 Bacteria 1520
141 Ga0068859_100396030 3300005617 Bacteria 1477
142 Ga0068859_100645275 3300005617 Bacteria 1151
143 Ga0068859_100875610 3300005617 Bacteria 984
144 Ga0068864_100003802 3300005618 Bacteria 12446
145 Ga0068864_100165781 3300005618 Bacteria 2011
146 Ga0068864_100393193 3300005618 Bacteria 1316
147 Ga0068866_11401133 3300005718 Unclassified 511
148 Ga0068861_100417308 3300005719 Bacteria 1195
149 Ga0068861_100499349 3300005719 Bacteria 1099
150 Ga0068870_10070620 3300005840 Bacteria 1903
151 Ga0068870_10312429 3300005840 Bacteria 996
152 Ga0068870_10787608 3300005840 Unclassified 663
153 Ga0068870_11412027 3300005840 Unclassified 510
154 Ga0068863_100049792 3300005841 Bacteria 3972
155 Ga0068863_101300763 3300005841 Unclassified 734
156 Ga0068858_100386597 3300005842 Bacteria 1343
157 Ga0068858_101549795 3300005842 Unclassified 654
158 Ga0068860_100822631 3300005843 Bacteria 943
159 Ga0068860_101183563 3300005843 Unclassified 784
160 Ga0068862_100606322 3300005844 Bacteria 1052
161 Ga0068862_100771967 3300005844 Unclassified 936
162 Ga0068862_100938179 3300005844 Bacteria 853
163 Ga0068862_101000806 3300005844 Bacteria 827
164 Ga0068862_102330293 3300005844 Unclassified 547
165 Ga0081455_10130431 3300005937 Bacteria 1966
166 Ga0070712_101394605 3300006175 Unclassified 611
167 Ga0075367_10015062 3300006178 Bacteria 4193
168 Ga0075366_10035230 3300006195 Bacteria 2951
169 Ga0097621_100236190 3300006237 Bacteria 1597
170 Ga0097621_100949081 3300006237 Unclassified 803
171 Ga0097621_101043137 3300006237 Unclassified 766
172 Ga0068871_100078399 3300006358 Bacteria 2732
173 Ga0068871_100335274 3300006358 Bacteria 1335
174 Ga0075428_100099695 3300006844 Unclassified 3167
175 Ga0075428_100526582 3300006844 Bacteria 1264
176 Ga0075428_100654493 3300006844 Bacteria 1120
177 Ga0075428_101260450 3300006844 Unclassified 778
178 Ga0075428_101734815 3300006844 Unclassified 651
179 Ga0075430_100019942 3300006846 Bacteria 5705
180 Ga0075430_100167242 3300006846 Bacteria 1830
181 Ga0075430_100296099 3300006846 Bacteria 1338
182 Ga0075430_101539295 3300006846 Bacteria 546
183 Ga0075431_100943449 3300006847 Bacteria 831
184 Ga0075431_101308557 3300006847 Bacteria 686
185 Ga0075431_101343852 3300006847 Unclassified 675
186 Ga0075433_10922018 3300006852 Unclassified 762
187 Ga0075433_10977999 3300006852 Unclassified 737
188 Ga0075433_11818250 3300006852 Unclassified 523
189 Ga0075434_100495215 3300006871 Unclassified 1243
190 Ga0075429_100813838 3300006880 Unclassified 818
191 Ga0075429_100850199 3300006880 Bacteria 799
192 Ga0068865_100043320 3300006881 Unclassified 3074
193 Ga0097620_100344951 3300006931 Bacteria 1584
194 Ga0097620_100374423 3300006931 Bacteria 1520
195 Ga0097620_100396063 3300006931 Bacteria 1477
196 Ga0097620_100645294 3300006931 Bacteria 1151
197 Ga0097620_100875569 3300006931 Bacteria 984
198 Ga0111539_10025712 3300009094 Bacteria 7212
199 Ga0111539_10055303 3300009094 Unclassified 4718
200 Ga0111539_10208363 3300009094 Bacteria 2278
201 Ga0111539_10363460 3300009094 Unclassified 1685
202 Ga0111539_10433111 3300009094 Bacteria 1531
203 Ga0111539_10547199 3300009094 Bacteria 1348
204 Ga0111539_10747848 3300009094 Unclassified 1138
205 Ga0105245_11534767 3300009098 Unclassified 717
206 Ga0105247_10103570 3300009101 Unclassified 1823
207 Ga0114129_10010653 3300009147 Bacteria 13110
208 Ga0114129_10103146 3300009147 Unclassified 3944
209 Ga0114129_10337059 3300009147 Bacteria 2001
210 Ga0105242_13182313 3300009176 Bacteria 509
211 Ga0105248_11171632 3300009177 Bacteria 869
212 Ga0105249_10365705 3300009553 Bacteria 1465
213 Ga0105249_11045977 3300009553 Unclassified 886
214 Ga0105249_12793427 3300009553 Unclassified 560
215 Ga0105246_10336073 3300011119 Bacteria 1233
216 Ga0157345_1055321 3300012498 Unclassified 515
217 Ga0157370_10890817 3300013104 Bacteria 808
218 Ga0163162_10448361 3300013306 Bacteria 1422
219 Ga0157375_10792087 3300013308 Bacteria 1097
220 Ga0157375_11803241 3300013308 Bacteria 725
221 Ga0163163_10028089 3300014325 Bacteria 5397
222 Ga0163163_10065703 3300014325 Bacteria 3602
223 Ga0163163_10086218 3300014325 Unclassified 3149
224 Ga0163163_11796941 3300014325 Unclassified 673
225 Ga0157380_10029344 3300014326 Bacteria 4204
226 Ga0157380_10146204 3300014326 Bacteria 2037
227 Ga0157380_10176771 3300014326 Bacteria 1871
228 Ga0157380_10920964 3300014326 Bacteria 902
229 Ga0157380_10922059 3300014326 Bacteria 901
230 Ga0157380_11423274 3300014326 Bacteria 744
231 Ga0182008_10238112 3300014497 Bacteria 935
232 Ga0157379_10434089 3300014968 Bacteria 1211
233 Ga0157376_10415975 3300014969 Bacteria 1303
234 Ga0157376_10661333 3300014969 Bacteria 1046
235 Ga0157376_10977477 3300014969 Bacteria 868
236 Ga0163161_10070204 3300017792 Bacteria 2561
237 Ga0207697_10487690 3300025315 Bacteria 545
238 Ga0207653_10114526 3300025885 Bacteria 965
239 Ga0207682_10102998 3300025893 Bacteria 1250
240 Ga0207682_10105520 3300025893 Unclassified 1236
241 Ga0207682_10246562 3300025893 Bacteria 831
242 Ga0207688_10016212 3300025901 Bacteria 4040
243 Ga0207688_10367326 3300025901 Bacteria 889
244 Ga0207680_10518475 3300025903 Bacteria 850
245 Ga0207680_10803254 3300025903 Unclassified 674
246 Ga0207645_10197580 3300025907 Bacteria 1322
247 Ga0207645_10568763 3300025907 Unclassified 769
248 Ga0207643_10069742 3300025908 Bacteria 2021
249 Ga0207643_10249530 3300025908 Bacteria 1093
250 Ga0207643_10266740 3300025908 Bacteria 1058
251 Ga0207684_11266207 3300025910 Bacteria 608
252 Ga0207707_11653188 3300025912 Bacteria 503
253 Ga0207693_10689980 3300025915 Unclassified 791
254 Ga0207663_10552084 3300025916 Unclassified 901
255 Ga0207660_10771017 3300025917 Bacteria 785
256 Ga0207662_10048977 3300025918 Bacteria 2505
257 Ga0207662_10307919 3300025918 Unclassified 1055
258 Ga0207649_10461932 3300025920 Bacteria 960
259 Ga0207649_10691100 3300025920 Archaea 791
260 Ga0207646_10707207 3300025922 Bacteria 901
261 Ga0207646_11027645 3300025922 Bacteria 727
262 Ga0207646_11322463 3300025922 Bacteria 629
263 Ga0207681_10011845 3300025923 Bacteria 5367
264 Ga0207681_10107960 3300025923 Unclassified 2019
265 Ga0207681_10268031 3300025923 Bacteria 1339
266 Ga0207681_10835407 3300025923 Bacteria 770
267 Ga0207681_10838171 3300025923 Bacteria 769
268 Ga0207681_11671804 3300025923 Unclassified 532
269 Ga0207650_10003744 3300025925 Bacteria 10408
270 Ga0207650_10018764 3300025925 Bacteria 4858
271 Ga0207650_10019406 3300025925 Bacteria 4777
272 Ga0207659_10002171 3300025926 Bacteria 11657
273 Ga0207659_10045473 3300025926 Bacteria 3095
274 Ga0207659_10051060 3300025926 Bacteria 2939
275 Ga0207659_10089618 3300025926 Bacteria 2294
276 Ga0207659_10805661 3300025926 Unclassified 807
277 Ga0207659_10981892 3300025926 Bacteria 726
278 Ga0207659_11098780 3300025926 Unclassified 684
279 Ga0207659_11880538 3300025926 Unclassified 507
280 Ga0207644_10199949 3300025931 Bacteria 1576
281 Ga0207644_10562018 3300025931 Bacteria 945
282 Ga0207644_11861948 3300025931 Bacteria 503
283 Ga0207706_10115105 3300025933 Bacteria 2365
284 Ga0207706_10131686 3300025933 Bacteria 2199
285 Ga0207686_10915683 3300025934 Unclassified 708
286 Ga0207709_11377934 3300025935 Bacteria 584
287 Ga0207670_10043858 3300025936 Bacteria 2956
288 Ga0207670_10146546 3300025936 Bacteria 1747
289 Ga0207670_10277605 3300025936 Bacteria 1305
290 Ga0207669_10010765 3300025937 Bacteria 4417
291 Ga0207669_10351266 3300025937 Unclassified 1139
292 Ga0207669_11289163 3300025937 Bacteria 620
293 Ga0207669_11631540 3300025937 Bacteria 550
294 Ga0207691_10033613 3300025940 Bacteria 4775
295 Ga0207691_10069352 3300025940 Bacteria 3185
296 Ga0207691_10107020 3300025940 Bacteria 2490
297 Ga0207691_10112570 3300025940 Bacteria 2419
298 Ga0207711_10787688 3300025941 Bacteria 886
299 Ga0207711_10923725 3300025941 Bacteria 811
300 Ga0207689_10054348 3300025942 Bacteria 3298
301 Ga0207689_10897591 3300025942 Bacteria 748
302 Ga0207679_10228300 3300025945 Bacteria 1570
303 Ga0207679_10931840 3300025945 Unclassified 795
304 Ga0207651_10041736 3300025960 Bacteria 3047
305 Ga0207651_10072804 3300025960 Unclassified 2441
306 Ga0207651_10173687 3300025960 Bacteria 1702
307 Ga0207651_10631558 3300025960 Bacteria 939
308 Ga0207712_11086655 3300025961 Unclassified 712
309 Ga0207668_11147879 3300025972 Bacteria 697
310 Ga0207668_11153196 3300025972 Unclassified 696
311 Ga0207658_10240367 3300025986 Bacteria 1534
312 Ga0207658_11014734 3300025986 Bacteria 757
313 Ga0207658_11845123 3300025986 Unclassified 551
314 Ga0207703_10474101 3300026035 Bacteria 1172
315 Ga0207703_10797558 3300026035 Bacteria 901
316 Ga0207678_10067548 3300026067 Bacteria 3069
317 Ga0207678_11552482 3300026067 Unclassified 584
318 Ga0207708_10328515 3300026075 Bacteria 1250
319 Ga0207708_10527941 3300026075 Unclassified 993
320 Ga0207641_10944105 3300026088 Bacteria 858
321 Ga0207641_11298074 3300026088 Bacteria 728
322 Ga0207641_12406882 3300026088 Unclassified 525
323 Ga0207648_10162485 3300026089 Bacteria 1972
324 Ga0207676_10020413 3300026095 Bacteria 4848
325 Ga0207676_10430736 3300026095 Bacteria 1239
326 Ga0207676_11343044 3300026095 Bacteria 710
327 Ga0207676_11989219 3300026095 Unclassified 580
328 Ga0207674_10019981 3300026116 Bacteria 7248
329 Ga0207674_10549185 3300026116 Bacteria 1116
330 Ga0207674_10944644 3300026116 Unclassified 831
331 Ga0207675_100056823 3300026118 Unclassified 3650
332 Ga0207675_100343440 3300026118 Bacteria 1461
333 Ga0207675_100736057 3300026118 Bacteria 997
334 Ga0207683_10061593 3300026121 Bacteria 3303
335 Ga0207683_10280565 3300026121 Bacteria 1522
336 Ga0207683_10667952 3300026121 Unclassified 963
337 Ga0207683_10847061 3300026121 Unclassified 849
338 Ga0207683_10925313 3300026121 Bacteria 810
339 Ga0209982_1064951 3300027552 Unclassified 596
340 Ga0209966_1126249 3300027695 Bacteria 589
341 Ga0209974_10125982 3300027876 Bacteria 910
342 Ga0207428_10014049 3300027907 Bacteria 6973
343 Ga0207428_10018481 3300027907 Bacteria 5953
344 Ga0207428_10932211 3300027907 Bacteria 612
345 Ga0268266_10145788 3300028379 Unclassified 2129
346 Ga0268266_11894533 3300028379 Bacteria 570
347 Ga0268265_10279174 3300028380 Bacteria 1494
348 Ga0268265_10920792 3300028380 Bacteria 859
349 Ga0268265_12184358 3300028380 Unclassified 560
350 Ga0268265_12515882 3300028380 Bacteria 521
351 Ga0268264_10146543 3300028381 Bacteria 2112
352 Ga0268264_10352268 3300028381 Bacteria 1402
353 Ga0265337_1058606 3300028556 Bacteria 1070
354 Ga0265326_10165789 3300028558 Bacteria 632
355 Ga0265323_10010034 3300028653 Bacteria 3848
356 Ga0265322_10011411 3300028654 Bacteria 2577
357 Ga0265330_10006988 3300031235 Bacteria 5539
358 Ga0265332_10114907 3300031238 Bacteria 1132
359 Ga0265328_10282696 3300031239 Bacteria 639
360 Ga0265320_10059802 3300031240 Bacteria 1821
361 Ga0265340_10000288 3300031247 Bacteria 26461
362 Ga0265316_10062544 3300031344 Bacteria 2888
363 Ga0307408_100125558 3300031548 Bacteria 1995
364 Ga0307408_101209161 3300031548 Bacteria 705
365 Ga0307408_101585564 3300031548 Unclassified 621
366 Ga0265314_10000009 3300031711 Bacteria 476805
367 Ga0265342_10000733 3300031712 Bacteria 33732
368 Ga0307405_10890939 3300031731 Bacteria 752
369 Ga0307405_11877200 3300031731 Bacteria 534
370 Ga0307405_12011974 3300031731 Bacteria 517
371 Ga0307413_10393371 3300031824 Unclassified 1084
372 Ga0307413_10742379 3300031824 Bacteria 820
373 Ga0307413_11575621 3300031824 Unclassified 583
374 Ga0307410_11668511 3300031852 Bacteria 564
375 Ga0307406_10125058 3300031901 Bacteria 1795
376 Ga0307409_100200237 3300031995 Unclassified 1786
377 Ga0307409_101657364 3300031995 Bacteria 668
378 Ga0307409_101934568 3300031995 Unclassified 619
379 Ga0307416_100055144 3300032002 Bacteria 3199
380 Ga0307416_100856440 3300032002 Bacteria 1007
381 Ga0307416_101256881 3300032002 Bacteria 846
382 Ga0307416_101394822 3300032002 Bacteria 806
383 Ga0307416_101414594 3300032002 Bacteria 801
384 Ga0307416_102539467 3300032002 Bacteria 611
385 Ga0307414_10076471 3300032004 Bacteria 2433
386 Ga0307414_10848928 3300032004 Bacteria 835
387 Ga0307411_10322828 3300032005 Bacteria 1247
388 Ga0307415_101024464 3300032126 Unclassified 769
389 Ga0373931_0838540 3300035691 Bacteria 615
390 Ga0395900_1535796 3300037418 Unclassified 578
391 Ga0395898_1596200 3300037466 Unclassified 577
392 Ga0395901_1024471 3300038443 Unclassified 800
393 Ga0439453_0153922 3300041408 Bacteria 547
394 Ga0439453_0170526 3300041408 Unclassified 526
395 Ga0439461_0213834 3300041410 Bacteria 523
396 Ga0451800_1037747 3300041459 Bacteria 1078
397 Ga0451839_0778194 3300041496 Unclassified 636
398 Ga0451849_0322558 3300041505 Bacteria 827
399 Ga0451853_1083851 3300041512 Bacteria 726
400 Ga0451853_2471527 3300041512 Bacteria 1165
401 Ga0439431_0140073 3300041997 Unclassified 683
402 Ga0439433_0002747 3300041999 Bacteria 3747
403 Ga0439433_0027527 3300041999 Bacteria 1290
404 Ga0439450_087551 3300042008 Unclassified 780
405 Ga0439451_068085 3300042009 Unclassified 713
406 Ga0439456_166609 3300042013 Unclassified 517
407 Ga0439457_052416 3300042014 Bacteria 917
408 Ga0439462_0071360 3300042015 Bacteria 943
409 Ga0439462_0120273 3300042015 Unclassified 730
410 Ga0450906_102700 3300042145 Bacteria 522
411 Ga0439446_0030470 3300042156 Bacteria 1559
412 Ga0439446_0177985 3300042156 Unclassified 710
413 Ga0439446_0185151 3300042156 Unclassified 698
414 Ga0439434_0155106 3300042435 Unclassified 759
415 Ga0439435_0087991 3300042436 Unclassified 940
416 Ga0439460_0006212 3300042461 Bacteria 2956
417 Ga0439460_0120687 3300042461 Bacteria 857
418 Ga0451577_1099036 3300042876 Bacteria 712
419 Ga0466963_0731155 3300044694 Bacteria 698
420 Ga0451576_0182935 3300045051 Bacteria 2188
421 Ga0451576_0511307 3300045051 Bacteria 1262
422 Ga0451576_2441262 3300045051 Bacteria 534
423 Ga0495603_0464615 3300046455 Bacteria 725
424 Ga0495629_0005042 3300046459 Bacteria 9883
425 Ga0495629_1036199 3300046459 Unclassified 533
426 Ga0495582_0540758 3300046473 Bacteria 674
427 Ga0495594_0235658 3300046499 Unclassified 1043
428 Ga0495607_0475108 3300046501 Unclassified 558
429 Ga0495644_0247479 3300046523 Unclassified 692
430 Ga0495598_0024231 3300046537 Bacteria 1643
431 Ga0495621_0022235 3300046539 Bacteria 2100
432 Ga0495621_0069381 3300046539 Bacteria 1295
433 Ga0495621_0142560 3300046539 Bacteria 938
434 Ga0495621_0405940 3300046539 Unclassified 578
435 Ga0495621_0535314 3300046539 Unclassified 508
436 Ga0495622_0172293 3300046557 Unclassified 973
437 Ga0495656_0017300 3300046615 Bacteria 2750
438 Ga0495659_0269517 3300046664 Bacteria 713
439 Ga0495659_0272068 3300046664 Bacteria 710
440 Ga0495588_0317596 3300046674 Unclassified 819
441 Ga0495658_0197758 3300046683 Bacteria 1252
442 Ga0495669_0259490 3300046684 Bacteria 835
443 Ga0495636_0125236 3300047318 Bacteria 1140
444 Ga0495636_0692163 3300047318 Unclassified 503
445 Ga0495676_0232660 3300047321 Unclassified 1265
446 Ga0495681_0225920 3300047470 Bacteria 749
447 Ga0495614_0426598 3300048089 Unclassified 625
448 Ga0495615_0230771 3300048090 Bacteria 581
449 Ga0496115_0778373 3300048918 Unclassified 746
450 Ga0501306_052307 3300049127 Bacteria 657
451 Ga0501306_105412 3300049127 Bacteria 508
452 Ga0501308_051268 3300049128 Bacteria 605
453 Ga0501308_057755 3300049128 Bacteria 580
454 Ga0501309_025959 3300049129 Bacteria 844
455 Ga0501309_086518 3300049129 Bacteria 531
456 Ga0501310_024836 3300049130 Bacteria 769
457 Ga0501304_012031 3300049160 Bacteria 776
458 Ga0501305_100390 3300049161 Bacteria 538
459 Ga0501305_111256 3300049161 Bacteria 518
460 Ga0501307_036134 3300049162 Bacteria 703
461 Ga0501307_053874 3300049162 Bacteria 610
462 Ga0501307_062745 3300049162 Bacteria 579
463 Ga0501312_069896 3300049528 Bacteria 621
464 Ga0501312_072728 3300049528 Bacteria 612
465 Ga0501313_048057 3300049529 Bacteria 585
466 Ga0501313_050245 3300049529 Bacteria 575
467 Ga0501314_020068 3300049530 Bacteria 690
468 Ga0501315_063314 3300049531 Unclassified 602
469 Ga0501315_086901 3300049531 Bacteria 537
470 Ga0501316_031187 3300049532 Bacteria 714
471 Ga0501318_068614 3300049534 Bacteria 556
472 Ga0501318_091112 3300049534 Unclassified 505
473 Ga0501320_068719 3300049536 Bacteria 509
474 Ga0501340_027669 3300049556 Bacteria 502
475 Ga0501032_0744745 3300049569 Bacteria 620
476 Ga0501033_1027780 3300049570 Unclassified 550
477 Ga0501039_0652167 3300049575 Bacteria 824
478 Ga0501042_0864851 3300049578 Bacteria 658
479 Ga0501075_0273326 3300049591 Bacteria 1288
480 Ga0501075_0786627 3300049591 Unclassified 724
481 Ga0501076_0389852 3300049592 Unclassified 1145
482 Ga0501216_023350 3300049660 Bacteria 1100
483 Ga0501216_144472 3300049660 Unclassified 561
484 Ga0501233_099163 3300049668 Bacteria 768
485 Ga0501249_154099 3300049679 Bacteria 580
486 Ga0501079_0746992 3300049741 Bacteria 770
487 Ga0501079_0754516 3300049741 Bacteria 766
488 Ga0501080_0919567 3300049742 Unclassified 762
489 Ga0501081_0419614 3300049743 Bacteria 992
490 Ga0501273_055772 3300049770 Unclassified 613
491 nmdc:mga03683_574601_c1 3300050489 Bacteria 550
492 nmdc:mga05p37_101798_c1 3300050507 Unclassified 2255
493 nmdc:mga05p37_1039168_c1 3300050507 Unclassified 866
494 nmdc:mga05p37_55830_c1 3300050507 Bacteria 4862
495 nmdc:mga09592_105907_c1 3300050508 Bacteria 2412
496 nmdc:mga09592_1085341_c1 3300050508 Bacteria 666
497 nmdc:mga09592_698022_c1 3300050508 Unclassified 864
498 nmdc:mga09592_711676_c1 3300050508 Unclassified 854
499 nmdc:mga0qj67_203148_c1 3300050509 Bacteria 1610
500 nmdc:mga0qj67_216557_c1 3300050509 Unclassified 1555
501 nmdc:mga0qj67_274105_c1 3300050509 Bacteria 1368
502 nmdc:mga0qj67_304374_c1 3300050509 Bacteria 1291
503 nmdc:mga06r32_1001966_c1 3300050510 Bacteria 788
504 nmdc:mga06r32_1264734_c1 3300050510 Unclassified 683
505 nmdc:mga06r32_252125_c1 3300050510 Bacteria 1753
506 nmdc:mga06r32_570931_c1 3300050510 Unclassified 1104
507 nmdc:mga06r32_905938_c1 3300050510 Bacteria 838
508 nmdc:mga08y16_1075236_c1 3300050511 Unclassified 781
509 nmdc:mga08y16_22093_c1 3300050511 Bacteria 6718
510 nmdc:mga08y16_222846_c1 3300050511 Bacteria 1952
511 nmdc:mga08y16_799_c1 3300050511 Bacteria 30110
512 nmdc:mga08y16_811366_c1 3300050511 Bacteria 928
513 nmdc:mga0n895_331072_c1 3300050512 Unclassified 1543
514 nmdc:mga0rr50_1902668_c1 3300050513 Bacteria 500
515 nmdc:mga0rr50_512141_c1 3300050513 Unclassified 1021
516 nmdc:mga0a205_1417628_c1 3300050515 Unclassified 542
517 nmdc:mga0a205_291724_c1 3300050515 Bacteria 1505
518 nmdc:mga0a205_936737_c1 3300050515 Unclassified 713
519 nmdc:mga0a205_994949_c1 3300050515 Bacteria 685
520 Ga0501084_1012141 3300054114 Bacteria 698
521 Ga0590075_131130 3300059424 Bacteria 658
522 Ga0590077_020274 3300059426 Unclassified 1411
523 Ga0587066_150732 3300059490 Bacteria 576
524 Ga0587075_075818 3300059644 Bacteria 633
525 Ga0075432_10534873
526 Ga0006778J45830_1028128
527 Ga0006759J45824_1056342
528 Ga0006777J48905_1017969
529 Ga0007417J51691_1037060
530 Ga0007427J51700_116602
531 Ga0006781J51513_1014858
532 Ga0007410J51695_1030170
533 Ga0007409J51694_1043070
534 Ga0007416J51690_1018545
535 Ga0007429J51699_1019793
536 Ga0032354_1009578
537 Ga0006780_1009764
538 Ga0065714_10104281
539 Ga0065714_10108786
540 Ga0065704_10026740
541 Ga0065704_10284054
542 Ga0065712_10020427
543 Ga0065712_10024818
544 Ga0065712_10192630
545 Ga0065712_10323954
546 Ga0065715_10135777
547 Ga0065707_10102121
548 Ga0065707_10254482
549 Ga0065707_10296068
550 Ga0065707_10546539
551 Ga0070676_10133378
552 Ga0070676_10217006
553 Ga0070690_100146395
554 Ga0070670_100000452
555 Ga0070670_100035852
556 Ga0070670_100046001
557 Ga0070670_101528265
558 Ga0070670_101774473
559 Ga0070677_10233929
560 Ga0070677_10246288
561 Ga0070677_10605219
562 Ga0070677_10651925
563 Ga0070666_10247609
564 Ga0070666_11156975
565 Ga0070689_100069504
566 Ga0070689_100484859
567 Ga0070689_100494306
568 Ga0070687_100194889
569 Ga0070687_100599118
570 Ga0070661_100622120
571 Ga0070661_100631498
572 Ga0070661_100943077
573 Ga0070692_10353529
574 Ga0070692_10750002
575 Ga0070692_11086182
576 Ga0070668_101127612
577 Ga0070668_101620583
578 Ga0070669_100008687
579 Ga0070669_100114016
580 Ga0070669_100334513
581 Ga0070669_101188254
582 Ga0070675_100001766
583 Ga0070675_100009069
584 Ga0070675_100038625
585 Ga0070675_100055976
586 Ga0070675_100069126
587 Ga0070675_100700784
588 Ga0070675_101015003
589 Ga0070675_101297584
590 Ga0070675_101441045
591 Ga0070671_100457118
592 Ga0070671_100522056
593 Ga0070671_100649496
594 Ga0070674_100000630
595 Ga0070674_100141588
596 Ga0070674_100301885
597 Ga0070674_100387392
598 Ga0070674_100589821
599 Ga0070674_100666465
600 Ga0070674_101137857
601 Ga0070674_101437781
602 Ga0070674_101688256
603 Ga0070673_100026890
604 Ga0070673_100039613
605 Ga0070673_100204883
606 Ga0070673_100760971
607 Ga0070673_100930687
608 Ga0070673_101060148
609 Ga0070688_100149624
610 Ga0070688_100160640
611 Ga0070659_100422116
612 Ga0070667_100253456
613 Ga0070667_101106370
614 Ga0070701_10310667
615 Ga0070705_100383229
616 Ga0070705_101544782
617 Ga0070700_100441968
618 Ga0070694_100140301
619 Ga0070708_101443927
620 Ga0070663_100147966
621 Ga0070678_100086118
622 Ga0070678_100221587
623 Ga0070678_100480786
624 Ga0070678_100719242
625 Ga0070678_100791983
626 Ga0070678_102236536
627 Ga0070662_100670959
628 Ga0070662_101096839
629 Ga0068867_100157372
630 Ga0068867_101888422
631 Ga0070685_10576064
632 Ga0070706_101229451
633 Ga0070706_101793514
634 Ga0070707_100946687
635 Ga0070707_101070961
636 Ga0070698_100067733
637 Ga0070698_100197863
638 Ga0070698_100757861
639 Ga0070699_100003305
640 Ga0070699_100118828
641 Ga0070697_101477363
642 Ga0070672_100005657
643 Ga0070672_100021655
644 Ga0070672_100456705
645 Ga0070672_100535847
646 Ga0070672_100611547
647 Ga0070672_100738838
648 Ga0070672_101058598
649 Ga0070686_100004045
650 Ga0070686_100383721
651 Ga0070686_101688995
652 Ga0070696_101162960
653 Ga0070665_100219871
654 Ga0070665_100801150
655 Ga0070665_102453270
656 Ga0070704_100008127
657 Ga0070704_100008704
658 Ga0070704_102316754
659 Ga0070664_100806412
660 Ga0068857_100411786
661 Ga0068857_100762346
662 Ga0068857_101415134
663 Ga0068859_100344977
664 Ga0068859_100374409
665 Ga0068859_100396030
666 Ga0068859_100645275
667 Ga0068859_100875610
668 Ga0068864_100003802
669 Ga0068864_100165781
670 Ga0068864_100393193
671 Ga0068866_11401133
672 Ga0068861_100417308
673 Ga0068861_100499349
674 Ga0068870_10070620
675 Ga0068870_10312429
676 Ga0068870_10787608
677 Ga0068870_11412027
678 Ga0068863_100049792
679 Ga0068863_101300763
680 Ga0068858_100386597
681 Ga0068858_101549795
682 Ga0068860_100822631
683 Ga0068860_101183563
684 Ga0068862_100606322
685 Ga0068862_100771967
686 Ga0068862_100938179
687 Ga0068862_101000806
688 Ga0068862_102330293
689 Ga0081455_10130431
690 Ga0070712_101394605
691 Ga0075367_10015062
692 Ga0075366_10035230
693 Ga0097621_100236190
694 Ga0097621_100949081
695 Ga0097621_101043137
696 Ga0068871_100078399
697 Ga0068871_100335274
698 Ga0075428_100099695
699 Ga0075428_100526582
700 Ga0075428_100654493
701 Ga0075428_101260450
702 Ga0075428_101734815
703 Ga0075430_100019942
704 Ga0075430_100167242
705 Ga0075430_100296099
706 Ga0075430_101539295
707 Ga0075431_100943449
708 Ga0075431_101308557
709 Ga0075431_101343852
710 Ga0075433_10922018
711 Ga0075433_10977999
712 Ga0075433_11818250
713 Ga0075434_100495215
714 Ga0075429_100813838
715 Ga0075429_100850199
716 Ga0068865_100043320
717 Ga0097620_100344951
718 Ga0097620_100374423
719 Ga0097620_100396063
720 Ga0097620_100645294
721 Ga0097620_100875569
722 Ga0111539_10025712
723 Ga0111539_10055303
724 Ga0111539_10208363
725 Ga0111539_10363460
726 Ga0111539_10433111
727 Ga0111539_10547199
728 Ga0111539_10747848
729 Ga0105245_11534767
730 Ga0105247_10103570
731 Ga0114129_10010653
732 Ga0114129_10103146
733 Ga0114129_10337059
734 Ga0105242_13182313
735 Ga0105248_11171632
736 Ga0105249_10365705
737 Ga0105249_11045977
738 Ga0105249_12793427
739 Ga0105246_10336073
740 Ga0157345_1055321
741 Ga0157370_10890817
742 Ga0163162_10448361
743 Ga0157375_10792087
744 Ga0157375_11803241
745 Ga0163163_10028089
746 Ga0163163_10065703
747 Ga0163163_10086218
748 Ga0163163_11796941
749 Ga0157380_10029344
750 Ga0157380_10146204
751 Ga0157380_10176771
752 Ga0157380_10920964
753 Ga0157380_10922059
754 Ga0157380_11423274
755 Ga0182008_10238112
756 Ga0157379_10434089
757 Ga0157376_10415975
758 Ga0157376_10661333
759 Ga0157376_10977477
760 Ga0163161_10070204
761 Ga0207697_10487690
762 Ga0207653_10114526
763 Ga0207682_10102998
764 Ga0207682_10105520
765 Ga0207682_10246562
766 Ga0207688_10016212
767 Ga0207688_10367326
768 Ga0207680_10518475
769 Ga0207680_10803254
770 Ga0207645_10197580
771 Ga0207645_10568763
772 Ga0207643_10069742
773 Ga0207643_10249530
774 Ga0207643_10266740
775 Ga0207684_11266207
776 Ga0207707_11653188
777 Ga0207693_10689980
778 Ga0207663_10552084
779 Ga0207660_10771017
780 Ga0207662_10048977
781 Ga0207662_10307919
782 Ga0207649_10461932
783 Ga0207649_10691100
784 Ga0207646_10707207
785 Ga0207646_11027645
786 Ga0207646_11322463
787 Ga0207681_10011845
788 Ga0207681_10107960
789 Ga0207681_10268031
790 Ga0207681_10835407
791 Ga0207681_10838171
792 Ga0207681_11671804
793 Ga0207650_10003744
794 Ga0207650_10018764
795 Ga0207650_10019406
796 Ga0207659_10002171
797 Ga0207659_10045473
798 Ga0207659_10051060
799 Ga0207659_10089618
800 Ga0207659_10805661
801 Ga0207659_10981892
802 Ga0207659_11098780
803 Ga0207659_11880538
804 Ga0207644_10199949
805 Ga0207644_10562018
806 Ga0207644_11861948
807 Ga0207706_10115105
808 Ga0207706_10131686
809 Ga0207686_10915683
810 Ga0207709_11377934
811 Ga0207670_10043858
812 Ga0207670_10146546
813 Ga0207670_10277605
814 Ga0207669_10010765
815 Ga0207669_10351266
816 Ga0207669_11289163
817 Ga0207669_11631540
818 Ga0207691_10033613
819 Ga0207691_10069352
820 Ga0207691_10107020
821 Ga0207691_10112570
822 Ga0207711_10787688
823 Ga0207711_10923725
824 Ga0207689_10054348
825 Ga0207689_10897591
826 Ga0207679_10228300
827 Ga0207679_10931840
828 Ga0207651_10041736
829 Ga0207651_10072804
830 Ga0207651_10173687
831 Ga0207651_10631558
832 Ga0207712_11086655
833 Ga0207668_11147879
834 Ga0207668_11153196
835 Ga0207658_10240367
836 Ga0207658_11014734
837 Ga0207658_11845123
838 Ga0207703_10474101
839 Ga0207703_10797558
840 Ga0207678_10067548
841 Ga0207678_11552482
842 Ga0207708_10328515
843 Ga0207708_10527941
844 Ga0207641_10944105
845 Ga0207641_11298074
846 Ga0207641_12406882
847 Ga0207648_10162485
848 Ga0207676_10020413
849 Ga0207676_10430736
850 Ga0207676_11343044
851 Ga0207676_11989219
852 Ga0207674_10019981
853 Ga0207674_10549185
854 Ga0207674_10944644
855 Ga0207675_100056823
856 Ga0207675_100343440
857 Ga0207675_100736057
858 Ga0207683_10061593
859 Ga0207683_10280565
860 Ga0207683_10667952
861 Ga0207683_10847061
862 Ga0207683_10925313
863 Ga0209982_1064951
864 Ga0209966_1126249
865 Ga0209974_10125982
866 Ga0207428_10014049
867 Ga0207428_10018481
868 Ga0207428_10932211
869 Ga0268266_10145788
870 Ga0268266_11894533
871 Ga0268265_10279174
872 Ga0268265_10920792
873 Ga0268265_12184358
874 Ga0268265_12515882
875 Ga0268264_10146543
876 Ga0268264_10352268
877 Ga0265337_1058606
878 Ga0265326_10165789
879 Ga0265323_10010034
880 Ga0265322_10011411
881 Ga0265330_10006988
882 Ga0265332_10114907
883 Ga0265328_10282696
884 Ga0265320_10059802
885 Ga0265340_10000288
886 Ga0265316_10062544
887 Ga0307408_100125558
888 Ga0307408_101209161
889 Ga0307408_101585564
890 Ga0265314_10000009
891 Ga0265342_10000733
892 Ga0307405_10890939
893 Ga0307405_11877200
894 Ga0307405_12011974
895 Ga0307413_10393371
896 Ga0307413_10742379
897 Ga0307413_11575621
898 Ga0307410_11668511
899 Ga0307406_10125058
900 Ga0307409_100200237
901 Ga0307409_101657364
902 Ga0307409_101934568
903 Ga0307416_100055144
904 Ga0307416_100856440
905 Ga0307416_101256881
906 Ga0307416_101394822
907 Ga0307416_101414594
908 Ga0307416_102539467
909 Ga0307414_10076471
910 Ga0307414_10848928
911 Ga0307411_10322828
912 Ga0307415_101024464
913 Ga0373931_0838540
914 Ga0395900_1535796
915 Ga0395898_1596200
916 Ga0395901_1024471
917 Ga0439453_0153922
918 Ga0439453_0170526
919 Ga0439461_0213834
920 Ga0451800_1037747
921 Ga0451839_0778194
922 Ga0451849_0322558
923 Ga0451853_1083851
924 Ga0451853_2471527
925 Ga0439431_0140073
926 Ga0439433_0002747
927 Ga0439433_0027527
928 Ga0439450_087551
929 Ga0439451_068085
930 Ga0439456_166609
931 Ga0439457_052416
932 Ga0439462_0071360
933 Ga0439462_0120273
934 Ga0450906_102700
935 Ga0439446_0030470
936 Ga0439446_0177985
937 Ga0439446_0185151
938 Ga0439434_0155106
939 Ga0439435_0087991
940 Ga0439460_0006212
941 Ga0439460_0120687
942 Ga0451577_1099036
943 Ga0466963_0731155
944 Ga0451576_0182935
945 Ga0451576_0511307
946 Ga0451576_2441262
947 Ga0495603_0464615
948 Ga0495629_0005042
949 Ga0495629_1036199
950 Ga0495582_0540758
951 Ga0495594_0235658
952 Ga0495607_0475108
953 Ga0495644_0247479
954 Ga0495598_0024231
955 Ga0495621_0022235
956 Ga0495621_0069381
957 Ga0495621_0142560
958 Ga0495621_0405940
959 Ga0495621_0535314
960 Ga0495622_0172293
961 Ga0495656_0017300
962 Ga0495659_0269517
963 Ga0495659_0272068
964 Ga0495588_0317596
965 Ga0495658_0197758
966 Ga0495669_0259490
967 Ga0495636_0125236
968 Ga0495636_0692163
969 Ga0495676_0232660
970 Ga0495681_0225920
971 Ga0495614_0426598
972 Ga0495615_0230771
973 Ga0496115_0778373
974 Ga0501306_052307
975 Ga0501306_105412
976 Ga0501308_051268
977 Ga0501308_057755
978 Ga0501309_025959
979 Ga0501309_086518
980 Ga0501310_024836
981 Ga0501304_012031
982 Ga0501305_100390
983 Ga0501305_111256
984 Ga0501307_036134
985 Ga0501307_053874
986 Ga0501307_062745
987 Ga0501312_069896
988 Ga0501312_072728
989 Ga0501313_048057
990 Ga0501313_050245
991 Ga0501314_020068
992 Ga0501315_063314
993 Ga0501315_086901
994 Ga0501316_031187
995 Ga0501318_068614
996 Ga0501318_091112
997 Ga0501320_068719
998 Ga0501340_027669
999 Ga0501032_0744745
1000 Ga0501033_1027780
1001 Ga0501039_0652167
1002 Ga0501042_0864851
1003 Ga0501075_0273326
1004 Ga0501075_0786627
1005 Ga0501076_0389852
1006 Ga0501216_023350
1007 Ga0501216_144472
1008 Ga0501233_099163
1009 Ga0501249_154099
1010 Ga0501079_0746992
1011 Ga0501079_0754516
1012 Ga0501080_0919567
1013 Ga0501081_0419614
1014 Ga0501273_055772
1015 nmdc:mga03683_574601_c1
1016 nmdc:mga05p37_101798_c1
1017 nmdc:mga05p37_1039168_c1
1018 nmdc:mga05p37_55830_c1
1019 nmdc:mga09592_105907_c1
1020 nmdc:mga09592_1085341_c1
1021 nmdc:mga09592_698022_c1
1022 nmdc:mga09592_711676_c1
1023 nmdc:mga0qj67_203148_c1
1024 nmdc:mga0qj67_216557_c1
1025 nmdc:mga0qj67_274105_c1
1026 nmdc:mga0qj67_304374_c1
1027 nmdc:mga06r32_1001966_c1
1028 nmdc:mga06r32_1264734_c1
1029 nmdc:mga06r32_252125_c1
1030 nmdc:mga06r32_570931_c1
1031 nmdc:mga06r32_905938_c1
1032 nmdc:mga08y16_1075236_c1
1033 nmdc:mga08y16_22093_c1
1034 nmdc:mga08y16_222846_c1
1035 nmdc:mga08y16_799_c1
1036 nmdc:mga08y16_811366_c1
1037 nmdc:mga0n895_331072_c1
1038 nmdc:mga0rr50_1902668_c1
1039 nmdc:mga0rr50_512141_c1
1040 nmdc:mga0a205_1417628_c1
1041 nmdc:mga0a205_291724_c1
1042 nmdc:mga0a205_936737_c1
1043 nmdc:mga0a205_994949_c1
1044 Ga0501084_1012141
1045 Ga0590075_131130
1046 Ga0590077_020274
1047 Ga0587066_150732
1048 Ga0587075_075818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

13

76

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jx4-assembly1.cif.gz_A crystal structure of e36-g37del mutant of the bacillus caldolyticus cold shock protein. 0.9048 2 67
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.902 1 67
5jx4-assembly1.cif.gz_A crystal structure of e36-g37del mutant of the bacillus caldolyticus cold shock protein. 0.892 2 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.891 4 67
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.8895 1 67
ID Description Score Start End Superfamily
af_E7F429_280_346_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9225 4 67 2.40.50.140
5jx4A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9046 2 67 2.40.50.140
af_P91306_55_138_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9012 3 66 2.40.50.140
af_P91398_61_146_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8918 1 66 2.40.50.140
5jx4A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8918 2 67 2.40.50.140
ID Description Score Start End GO Terms
AF-M5RCS7-F1-model_v4 Cold-shock protein, DNA-binding domain protein 0.9896 3 67 GO:0003677
GO:0005737
AF-A0A518G2B1-F1-model_v4 Cold shock-like protein CspLA 0.9877 4 66 GO:0003676
GO:0005737
AF-A0A2V8F4H3-F1-model_v4 Cold-shock protein 0.9857 4 67 GO:0003676
GO:0005737
AF-A0A1F2SGL8-F1-model_v4 Cold-shock protein 0.9848 5 67 GO:0003676
GO:0005737
AF-A0A6I7LUL0-F1-model_v4 Cold shock protein CspB (Modular protein) 0.984 4 66 GO:0003676

Map