F459089

General Info

Members Datasets Scaffolds Average Seq Length
524 335 513 286

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1014747|Ga0055536_10147472
Length 320
Sequence MASLKALKIRIGSVKSTQKITKAMKMVAAAKLRRAQEAAEAGRPYAQRLEAVVASLASKISVSESSPKLLAGTGKDQVHLLVIATSDKGLAGAFNTNIARLARRHAQELLAQGKTVKIYTIGRKGRAVLNRQFPKNIVHSIEPGDLGKLSFAXARGYADDLIARFEAGEFDVATLFYSTFKSVLAQEPTAQQIIPVAIPQAETAAVSSGAAVTYEPDEESILADLLPRNVAIQLFRAMRENAASEQGSKMTAMDNATRNAGDLIKRLNTIYNRQRRPRSRPSWWKSFRAPKRSKTVRTRKQQWQPKLPSQRPTMAAASAR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
4 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
5 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
6 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
7 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
8 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
9 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
10 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
11 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
204 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
241 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
306 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
309 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
310 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
311 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
312 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
313 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
314 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
315 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
316 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
317 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
318 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
319 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
320 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
321 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
324 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
325 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
326 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
327 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
328 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
329 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
332 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
335 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0.57
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.7
Nodule 0.76
Rhizoplane 2.67
Rhizosphere 67.75
Stem 0
Stem Tuber 0.19
Unclassified 9.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARCol0yngRDRAFT_1002397 3300000652 Bacteria 1417
2 JGI24736J21556_1000147 3300001904 Bacteria 12247
3 JGI25150J39212_1000349 3300002774 Bacteria 22660
4 JGI25153J46596_10014916 3300003215 Bacteria 3198
5 Ga0055542_1000040 3300003762 Bacteria 214035
6 Ga0055542_1000609 3300003762 Bacteria 30543
7 Ga0055542_1005454 3300003762 Bacteria 2875
8 Ga0055529_1000037 3300003763 Bacteria 237307
9 Ga0055526_1002525 3300003771 Bacteria 12297
10 Ga0055537_1003425 3300003773 Bacteria 4882
11 Ga0055537_1007393 3300003773 Bacteria 2653
12 Ga0055537_1013825 3300003773 Bacteria 1495
13 Ga0055524_1000209 3300003775 Bacteria 62993
14 Ga0055524_1011023 3300003775 Bacteria 3558
15 Ga0055536_1014747 3300003781 Bacteria 2718
16 Ga0055528_1002220 3300003790 Bacteria 10590
17 Ga0055540_1001501 3300003792 Bacteria 13868
18 Ga0055531_10016667 3300003794 Bacteria 3154
19 Ga0065165_1008513 3300005262 Bacteria 4779
20 Ga0065165_1017252 3300005262 Bacteria 2667
21 Ga0065165_1022328 3300005262 Bacteria 2172
22 Ga0070658_10006404 3300005327 Bacteria 9539
23 Ga0070658_10204652 3300005327 Bacteria 1666
24 Ga0070658_10278111 3300005327 Bacteria 1424
25 Ga0070683_100132035 3300005329 Bacteria 2364
26 Ga0070670_100034317 3300005331 Bacteria 4366
27 Ga0070677_10130476 3300005333 Bacteria 1147
28 Ga0070666_10185827 3300005335 Bacteria 1459
29 Ga0070666_10186202 3300005335 Bacteria 1458
30 Ga0070682_100126065 3300005337 Bacteria 1726
31 Ga0070660_100234038 3300005339 Bacteria 1495
32 Ga0070691_10012537 3300005341 Bacteria 3881
33 Ga0070661_100000933 3300005344 Bacteria 20889
34 Ga0070661_100095000 3300005344 Bacteria 2210
35 Ga0070661_100216530 3300005344 Bacteria 1467
36 Ga0070668_100000123 3300005347 Bacteria 48192
37 Ga0070668_100000479 3300005347 Bacteria 26526
38 Ga0070669_100068932 3300005353 Bacteria 2612
39 Ga0070669_100242406 3300005353 Bacteria 1433
40 Ga0070675_100176998 3300005354 Bacteria 1842
41 Ga0070671_100124028 3300005355 Bacteria 2174
42 Ga0070674_100063196 3300005356 Bacteria 2590
43 Ga0070688_100167200 3300005365 Bacteria 1515
44 Ga0070659_100080749 3300005366 Bacteria 2596
45 Ga0070659_100260581 3300005366 Bacteria 1438
46 Ga0070667_100000024 3300005367 Bacteria 191216
47 Ga0070709_10151827 3300005434 Bacteria 1601
48 Ga0070709_10347685 3300005434 Bacteria 1095
49 Ga0070713_100000121 3300005436 Bacteria 50650
50 Ga0070711_100033560 3300005439 Bacteria 3418
51 Ga0070663_100255079 3300005455 Bacteria 1389
52 Ga0070678_100012561 3300005456 Bacteria 5272
53 Ga0070681_10104601 3300005458 Bacteria 2773
54 Ga0070681_10223985 3300005458 Bacteria 1796
55 Ga0070699_100154609 3300005518 Bacteria 2029
56 Ga0070679_100000019 3300005530 Bacteria 127108
57 Ga0068853_100005255 3300005539 Bacteria 10138
58 Ga0068853_100324676 3300005539 Bacteria 1427
59 Ga0070695_100136548 3300005545 Bacteria 1696
60 Ga0070704_100292766 3300005549 Bacteria 1353
61 Ga0068855_100067127 3300005563 Bacteria 4180
62 Ga0068855_100372792 3300005563 Bacteria 1568
63 Ga0070664_100227872 3300005564 Bacteria 1669
64 Ga0068857_100004014 3300005577 Bacteria 12392
65 Ga0068856_100000497 3300005614 Bacteria 43608
66 Ga0068856_100001104 3300005614 Bacteria 28526
67 Ga0068859_100001286 3300005617 Bacteria 25622
68 Ga0068859_100095238 3300005617 Bacteria 3030
69 Ga0068859_100097479 3300005617 Bacteria 2994
70 Ga0068861_100000046 3300005719 Bacteria 56414
71 Ga0068863_100000020 3300005841 Bacteria 198519
72 Ga0068863_100000082 3300005841 Bacteria 105688
73 Ga0068863_100037980 3300005841 Bacteria 4583
74 Ga0068860_100000938 3300005843 Bacteria 32302
75 Ga0068860_100020798 3300005843 Bacteria 6357
76 Ga0068860_100340126 3300005843 Bacteria 1475
77 Ga0068862_100000236 3300005844 Bacteria 61275
78 Ga0068862_100006902 3300005844 Bacteria 9417
79 Ga0068862_100082933 3300005844 Bacteria 2783
80 Ga0081455_10096438 3300005937 Bacteria 2385
81 Ga0081538_10006545 3300005981 Bacteria 10232
82 Ga0081539_10028290 3300005985 Bacteria 3527
83 Ga0081539_10030495 3300005985 Bacteria 3345
84 Ga0075363_100053180 3300006048 Bacteria 2163
85 Ga0075364_10046119 3300006051 Bacteria 2838
86 Ga0070712_100001870 3300006175 Bacteria 12848
87 Ga0075366_10053062 3300006195 Bacteria 2408
88 Ga0075370_10038326 3300006353 Bacteria 2697
89 Ga0075431_100053550 3300006847 Bacteria 4160
90 Ga0075434_100023686 3300006871 Bacteria 5988
91 Ga0075436_100000720 3300006914 Bacteria 21898
92 Ga0097620_100001286 3300006931 Bacteria 25622
93 Ga0097620_100095232 3300006931 Bacteria 3030
94 Ga0097620_100097478 3300006931 Bacteria 2994
95 Ga0079104_1016760 3300006946 Bacteria 2130
96 Ga0075435_100085091 3300007076 Bacteria 2603
97 Ga0105240_10008009 3300009093 Bacteria 15218
98 Ga0105240_10041127 3300009093 Bacteria 5903
99 Ga0105245_10332201 3300009098 Bacteria 1501
100 Ga0105243_10001261 3300009148 Bacteria 22743
101 Ga0105243_10405953 3300009148 Bacteria 1267
102 Ga0105241_10142009 3300009174 Bacteria 1956
103 Ga0105241_10290044 3300009174 Bacteria 1401
104 Ga0105242_10076982 3300009176 Bacteria 2782
105 Ga0105242_10104991 3300009176 Bacteria 2399
106 Ga0105248_10006088 3300009177 Bacteria 13234
107 Ga0105237_10006681 3300009545 Bacteria 12750
108 Ga0105237_10107412 3300009545 Bacteria 2783
109 Ga0105237_10226951 3300009545 Bacteria 1868
110 Ga0105238_10009161 3300009551 Bacteria 9910
111 Ga0105238_10061150 3300009551 Bacteria 3770
112 Ga0105238_10251117 3300009551 Bacteria 1747
113 Ga0105238_10283925 3300009551 Bacteria 1637
114 Ga0105249_10000244 3300009553 Bacteria 60263
115 Ga0105249_10174218 3300009553 Bacteria 2088
116 Ga0105249_10203480 3300009553 Bacteria 1939
117 Ga0105249_10260745 3300009553 Bacteria 1722
118 Ga0105249_10554028 3300009553 Bacteria 1201
119 Ga0105239_10489347 3300010375 Bacteria 1398
120 Ga0105239_10512436 3300010375 Bacteria 1364
121 Ga0105246_10180109 3300011119 Bacteria 1626
122 Ga0157373_10080111 3300013100 Bacteria 2303
123 Ga0157371_10000747 3300013102 Bacteria 37686
124 Ga0157370_10029166 3300013104 Bacteria 5420
125 Ga0157370_10033946 3300013104 Bacteria 4971
126 Ga0157369_10003048 3300013105 Bacteria 19997
127 Ga0157369_10097410 3300013105 Bacteria 3138
128 Ga0157374_10516300 3300013296 Bacteria 1200
129 Ga0157378_10093529 3300013297 Bacteria 2737
130 Ga0163162_10311615 3300013306 Bacteria 1706
131 Ga0157372_10415613 3300013307 Bacteria 1567
132 Ga0163163_10174107 3300014325 Bacteria 2199
133 Ga0157377_10112319 3300014745 Bacteria 1639
134 Ga0157379_10009377 3300014968 Bacteria 8529
135 Ga0157379_10266459 3300014968 Bacteria 1557
136 Ga0183363_1002 3300015690 Bacteria 425040
137 Ga0206353_10967427 3300020082 Bacteria 2793
138 Ga0213873_10000007 3300021358 Bacteria 309961
139 Ga0213876_10000005 3300021384 Bacteria 727326
140 Ga0213876_10077103 3300021384 Bacteria 1760
141 Ga0213875_10002026 3300021388 Bacteria 12482
142 Ga0209563_100105 3300025230 Bacteria 147936
143 Ga0209563_101798 3300025230 Bacteria 5327
144 Ga0207425_1000094 3300025245 Bacteria 85629
145 Ga0207425_1004731 3300025245 Bacteria 4010
146 Ga0209646_1014936 3300025246 Bacteria 1164
147 Ga0209677_103597 3300025253 Bacteria 4915
148 Ga0209148_1000011 3300025254 Bacteria 1196503
149 Ga0209148_1000238 3300025254 Bacteria 87836
150 Ga0209129_1005757 3300025258 Bacteria 4249
151 Ga0209233_1017719 3300025261 Bacteria 1933
152 Ga0209565_1000011 3300025263 Bacteria 637062
153 Ga0209565_1000149 3300025263 Bacteria 96195
154 Ga0209565_1000386 3300025263 Bacteria 37364
155 Ga0209455_1000006 3300025272 Bacteria 1196503
156 Ga0209673_1000902 3300025273 Bacteria 37959
157 Ga0209673_1006361 3300025273 Bacteria 5716
158 Ga0209675_1004628 3300025291 Bacteria 6048
159 Ga0209675_1006535 3300025291 Bacteria 4653
160 Ga0209676_1017478 3300025292 Bacteria 2537
161 Ga0209025_1000727 3300025294 Bacteria 55857
162 Ga0209564_1001341 3300025295 Bacteria 26209
163 Ga0209758_1000002 3300025297 Bacteria 1400310
164 Ga0209758_1000023 3300025297 Bacteria 612453
165 Ga0209758_1000108 3300025297 Bacteria 216541
166 Ga0209758_1016139 3300025297 Bacteria 3810
167 Ga0209050_1000342 3300025298 Bacteria 92644
168 Ga0209050_1010036 3300025298 Bacteria 4732
169 Ga0209050_1010379 3300025298 Bacteria 4599
170 Ga0209256_1000016 3300025299 Bacteria 599092
171 Ga0209256_1009780 3300025299 Bacteria 4134
172 Ga0209051_1000226 3300025303 Bacteria 94990
173 Ga0209257_1000112 3300025304 Bacteria 234058
174 Ga0209257_1001798 3300025304 Bacteria 23555
175 Ga0209257_1009856 3300025304 Bacteria 4991
176 Ga0209257_1011330 3300025304 Bacteria 4312
177 Ga0207656_10005244 3300025321 Bacteria 4566
178 Ga0207682_10057987 3300025893 Bacteria 1615
179 Ga0207682_10127503 3300025893 Bacteria 1134
180 Ga0207680_10001557 3300025903 Bacteria 10806
181 Ga0207699_10000517 3300025906 Bacteria 19151
182 Ga0207645_10121881 3300025907 Bacteria 1693
183 Ga0207705_10000076 3300025909 Bacteria 122975
184 Ga0207705_10000319 3300025909 Bacteria 43949
185 Ga0207654_10002561 3300025911 Bacteria 9226
186 Ga0207707_10048443 3300025912 Bacteria 3701
187 Ga0207707_10076984 3300025912 Bacteria 2911
188 Ga0207695_10053961 3300025913 Bacteria 4201
189 Ga0207695_10064201 3300025913 Bacteria 3782
190 Ga0207695_10084164 3300025913 Bacteria 3212
191 Ga0207671_10019101 3300025914 Bacteria 5249
192 Ga0207671_10023877 3300025914 Bacteria 4606
193 Ga0207671_10042102 3300025914 Bacteria 3381
194 Ga0207693_10002910 3300025915 Bacteria 14823
195 Ga0207693_10006853 3300025915 Bacteria 9407
196 Ga0207663_10026639 3300025916 Bacteria 3359
197 Ga0207660_10022300 3300025917 Bacteria 4266
198 Ga0207657_10014944 3300025919 Bacteria 7544
199 Ga0207657_10019727 3300025919 Bacteria 6392
200 Ga0207657_10022464 3300025919 Bacteria 5900
201 Ga0207657_10194415 3300025919 Bacteria 1635
202 Ga0207649_10000220 3300025920 Bacteria 46886
203 Ga0207649_10000986 3300025920 Bacteria 17615
204 Ga0207652_10000004 3300025921 Bacteria 436303
205 Ga0207652_10164725 3300025921 Bacteria 1988
206 Ga0207681_10019658 3300025923 Bacteria 4271
207 Ga0207681_10131888 3300025923 Bacteria 1849
208 Ga0207694_10013789 3300025924 Bacteria 6093
209 Ga0207694_10080383 3300025924 Bacteria 2558
210 Ga0207694_10169538 3300025924 Bacteria 1767
211 Ga0207650_10096664 3300025925 Bacteria 2266
212 Ga0207659_10177354 3300025926 Bacteria 1685
213 Ga0207700_10000972 3300025928 Bacteria 16548
214 Ga0207644_10000025 3300025931 Bacteria 152401
215 Ga0207690_10002620 3300025932 Bacteria 10835
216 Ga0207706_10153778 3300025933 Bacteria 2023
217 Ga0207686_10088543 3300025934 Bacteria 2038
218 Ga0207709_10000039 3300025935 Bacteria 260127
219 Ga0207669_10001720 3300025937 Bacteria 9284
220 Ga0207669_10208516 3300025937 Bacteria 1424
221 Ga0207665_10021654 3300025939 Bacteria 4228
222 Ga0207711_10001387 3300025941 Bacteria 22798
223 Ga0207667_10000006 3300025949 Bacteria 679876
224 Ga0207667_10003097 3300025949 Bacteria 20583
225 Ga0207667_10009399 3300025949 Bacteria 11521
226 Ga0207712_10000149 3300025961 Bacteria 72521
227 Ga0207712_10050590 3300025961 Bacteria 2902
228 Ga0207712_10226873 3300025961 Bacteria 1497
229 Ga0207668_10000085 3300025972 Bacteria 70401
230 Ga0207668_10037414 3300025972 Bacteria 3247
231 Ga0207640_10000413 3300025981 Bacteria 26988
232 Ga0207658_10000022 3300025986 Bacteria 191235
233 Ga0207658_10228821 3300025986 Bacteria 1568
234 Ga0207639_10003109 3300026041 Bacteria 11160
235 Ga0207639_10150567 3300026041 Bacteria 1948
236 Ga0207639_10448921 3300026041 Bacteria 1170
237 Ga0207702_10000182 3300026078 Bacteria 75732
238 Ga0207702_10001450 3300026078 Bacteria 23586
239 Ga0207702_10058805 3300026078 Bacteria 3272
240 Ga0207702_10076340 3300026078 Bacteria 2896
241 Ga0207702_10266123 3300026078 Bacteria 1616
242 Ga0207702_10343908 3300026078 Bacteria 1425
243 Ga0207641_10000001 3300026088 Bacteria 1180841
244 Ga0207641_10000139 3300026088 Bacteria 105740
245 Ga0207641_10022466 3300026088 Bacteria 5192
246 Ga0207674_10000003 3300026116 Bacteria 241674
247 Ga0207674_10099388 3300026116 Bacteria 2892
248 Ga0207675_100000122 3300026118 Bacteria 63834
249 Ga0207675_100141489 3300026118 Bacteria 2286
250 Ga0207698_10130092 3300026142 Bacteria 2149
251 Ga0209974_10014028 3300027876 Bacteria 2670
252 Ga0268266_10000002 3300028379 Bacteria 3059047
253 Ga0268266_10188781 3300028379 Bacteria 1880
254 Ga0268265_10001866 3300028380 Bacteria 16787
255 Ga0268265_10005820 3300028380 Bacteria 8407
256 Ga0268265_10443654 3300028380 Bacteria 1210
257 Ga0268264_10000910 3300028381 Bacteria 31062
258 Ga0268264_10009537 3300028381 Bacteria 8041
259 Ga0307517_10051484 3300028786 Bacteria 4155
260 Ga0265325_10043397 3300031241 Bacteria 2346
261 Ga0265340_10026611 3300031247 Bacteria 2922
262 Ga0265340_10065942 3300031247 Bacteria 1723
263 Ga0265339_10116732 3300031249 Bacteria 1376
264 Ga0307513_10011050 3300031456 Bacteria 11260
265 Ga0307408_100300628 3300031548 Bacteria 1344
266 Ga0307408_100350870 3300031548 Bacteria 1252
267 Ga0307408_100397567 3300031548 Bacteria 1182
268 Ga0265313_10051589 3300031595 Bacteria 1968
269 Ga0265313_10082963 3300031595 Bacteria 1452
270 Ga0265314_10189594 3300031711 Bacteria 1225
271 Ga0265342_10040124 3300031712 Bacteria 2840
272 Ga0307405_10084921 3300031731 Bacteria 2079
273 Ga0307410_10257052 3300031852 Bacteria 1360
274 Ga0307410_10260920 3300031852 Bacteria 1351
275 Ga0307410_10363074 3300031852 Bacteria 1160
276 Ga0307406_10386076 3300031901 Bacteria 1105
277 Ga0307412_10204884 3300031911 Bacteria 1501
278 Ga0307416_100249772 3300032002 Bacteria 1725
279 Ga0307416_100290420 3300032002 Bacteria 1618
280 Ga0307411_10168733 3300032005 Bacteria 1648
281 Ga0307411_10179724 3300032005 Bacteria 1604
282 Ga0307411_10543514 3300032005 Bacteria 990
283 Ga0307415_100227181 3300032126 Bacteria 1500
284 Ga0316593_10012562 3300032168 Bacteria 2488
285 Ga0307510_10032156 3300033180 Bacteria 5915
286 Ga0373946_0154957 3300035171 Bacteria 1072
287 Ga0373924_0129500 3300035410 Bacteria 1098
288 Ga0373931_0087396 3300035691 Bacteria 1731
289 Ga0373935_0032086 3300035692 Bacteria 3263
290 Ga0373935_0131151 3300035692 Bacteria 1684
291 Ga0373927_0118392 3300035695 Bacteria 1728
292 Ga0373933_0032856 3300035724 Bacteria 3016
293 Ga0373947_0143436 3300035725 Bacteria 1534
294 Ga0373925_0095947 3300037068 Bacteria 2272
295 Ga0373925_0129870 3300037068 Bacteria 1964
296 Ga0395900_0001580 3300037418 Bacteria 26952
297 Ga0395900_0370977 3300037418 Bacteria 1401
298 Ga0395905_0000538 3300037471 Bacteria 51665
299 Ga0436364_0333182 3300037853 Bacteria 2544
300 Ga0436364_1265123 3300037853 Bacteria 88807
301 Ga0395901_0001664 3300038443 Bacteria 22942
302 Ga0400483_031499 3300039062 Bacteria 2030
303 Ga0400483_119336 3300039062 Bacteria 3471
304 Ga0400483_170323 3300039062 Bacteria 2427
305 Ga0400483_201528 3300039062 Bacteria 1332
306 Ga0400483_204155 3300039062 Bacteria 3571
307 Ga0400483_252307 3300039062 Bacteria 1952
308 Ga0400483_282374 3300039062 Bacteria 3368
309 Ga0436365_0477684 3300039437 Bacteria 1613
310 Ga0436365_1257511 3300039437 Bacteria 4106
311 Ga0436365_1739626 3300039437 Bacteria 1932
312 Ga0436363_0656603 3300039450 Bacteria 1026
313 Ga0436363_1509974 3300039450 Bacteria 1039
314 Ga0436362_0451893 3300039453 Bacteria 163419
315 Ga0451802_1305520 3300041460 Bacteria 1564
316 Ga0451806_696590 3300041462 Bacteria 2064
317 Ga0451807_2598915 3300041486 Bacteria 1773
318 Ga0451839_0640379 3300041496 Bacteria 1191
319 Ga0439433_0037298 3300041999 Bacteria 1125
320 Ga0466966_0014386 3300044684 Bacteria 5238
321 Ga0466968_0126260 3300044735 Bacteria 1161
322 Ga0466967_0098402 3300045976 Bacteria 2671
323 Ga0495627_017065 3300046453 Bacteria 2475
324 Ga0495603_0178135 3300046455 Bacteria 1230
325 Ga0495629_0185012 3300046459 Bacteria 1443
326 Ga0495638_0000880 3300046460 Bacteria 30953
327 Ga0495638_0107971 3300046460 Bacteria 1656
328 Ga0495650_0009791 3300046471 Bacteria 5417
329 Ga0495650_0016554 3300046471 Bacteria 3731
330 Ga0495584_0074913 3300046491 Bacteria 1701
331 Ga0495583_0017427 3300046506 Bacteria 3813
332 Ga0495583_0044038 3300046506 Bacteria 2074
333 Ga0495583_0150050 3300046506 Bacteria 966
334 Ga0495606_0010652 3300046507 Bacteria 7603
335 Ga0495618_0038799 3300046514 Bacteria 2994
336 Ga0495630_0182949 3300046517 Bacteria 1598
337 Ga0495631_0017612 3300046518 Bacteria 3376
338 Ga0495637_0020860 3300046520 Bacteria 3008
339 Ga0495643_0010747 3300046522 Bacteria 5622
340 Ga0495643_0068761 3300046522 Bacteria 1863
341 Ga0495648_0000189 3300046524 Bacteria 70824
342 Ga0495663_0027967 3300046525 Bacteria 1657
343 Ga0495663_0100391 3300046525 Bacteria 952
344 Ga0495652_0024549 3300046529 Bacteria 5335
345 Ga0495586_0046653 3300046535 Bacteria 2336
346 Ga0495587_0050347 3300046536 Bacteria 2464
347 Ga0495597_0035459 3300046542 Bacteria 2250
348 Ga0495633_0000547 3300046558 Bacteria 37231
349 Ga0495668_0000181 3300046616 Bacteria 94147
350 Ga0495634_0110315 3300046642 Bacteria 1769
351 Ga0495625_0000069 3300046660 Bacteria 168800
352 Ga0495625_0000312 3300046660 Bacteria 74208
353 Ga0495625_0020815 3300046660 Bacteria 5058
354 Ga0495661_0064542 3300046665 Bacteria 2160
355 Ga0495661_0126449 3300046665 Bacteria 1406
356 Ga0495657_0037118 3300046675 Bacteria 3361
357 Ga0495599_0095460 3300046678 Bacteria 1855
358 Ga0495669_0000179 3300046684 Bacteria 39746
359 Ga0495670_0000037 3300046691 Bacteria 77395
360 Ga0495670_0004999 3300046691 Bacteria 6519
361 Ga0495649_0116620 3300046694 Bacteria 1413
362 Ga0495600_0010218 3300046809 Bacteria 5818
363 Ga0495660_0029133 3300046810 Bacteria 3117
364 Ga0495604_0017212 3300047317 Bacteria 5783
365 Ga0495683_0039227 3300047323 Bacteria 2394
366 Ga0495687_001524 3300047443 Bacteria 21144
367 Ga0495687_019736 3300047443 Bacteria 3298
368 Ga0495687_096452 3300047443 Bacteria 1119
369 Ga0495681_0031838 3300047470 Bacteria 2662
370 Ga0495684_0163614 3300047471 Bacteria 1659
371 Ga0495686_0000733 3300047472 Bacteria 43762
372 Ga0495686_0086989 3300047472 Bacteria 1901
373 Ga0495602_0180704 3300048088 Bacteria 1627
374 Ga0495602_0318774 3300048088 Bacteria 1132
375 Ga0495615_0001828 3300048090 Bacteria 3261
376 Ga0496101_0144474 3300048904 Bacteria 1816
377 Ga0496102_0020799 3300048905 Bacteria 5799
378 Ga0496103_0009250 3300048906 Bacteria 5838
379 Ga0496104_0020854 3300048907 Bacteria 6010
380 Ga0496105_0016339 3300048908 Bacteria 5924
381 Ga0496110_0059344 3300048913 Bacteria 3372
382 Ga0496111_0211076 3300048914 Bacteria 1442
383 Ga0496114_0254748 3300048917 Bacteria 1544
384 Ga0496115_0023531 3300048918 Bacteria 4780
385 Ga0496115_0122170 3300048918 Bacteria 2143
386 Ga0496115_0134511 3300048918 Bacteria 2038
387 Ga0496116_0050896 3300048919 Bacteria 2756
388 Ga0496117_0017135 3300048920 Bacteria 6064
389 Ga0496118_0002303 3300048921 Bacteria 25934
390 Ga0496118_0138372 3300048921 Bacteria 1549
391 Ga0496119_0000709 3300048922 Bacteria 44727
392 Ga0496119_0006343 3300048922 Bacteria 11005
393 Ga0496119_0099574 3300048922 Bacteria 1634
394 Ga0496120_0066963 3300048923 Bacteria 1985
395 Ga0496121_0028100 3300048924 Bacteria 5244
396 Ga0496121_0042369 3300048924 Bacteria 3961
397 Ga0496122_0002977 3300048925 Bacteria 23060
398 Ga0496122_0027958 3300048925 Bacteria 4803
399 Ga0496122_0028769 3300048925 Bacteria 4704
400 Ga0496122_0036712 3300048925 Bacteria 3956
401 Ga0496123_0001738 3300048926 Bacteria 28825
402 Ga0496123_0006131 3300048926 Bacteria 11786
403 Ga0496123_0016942 3300048926 Bacteria 5886
404 Ga0496123_0081756 3300048926 Bacteria 1961
405 Ga0496123_0184192 3300048926 Bacteria 1087
406 Ga0496124_0000041 3300048927 Bacteria 303887
407 Ga0496124_0132316 3300048927 Bacteria 1980
408 Ga0496124_0144999 3300048927 Bacteria 1869
409 Ga0496125_0091644 3300048928 Bacteria 2276
410 Ga0496125_0093451 3300048928 Bacteria 2244
411 Ga0496125_0135487 3300048928 Bacteria 1724
412 Ga0496126_0023311 3300048929 Bacteria 5998
413 Ga0496126_0315944 3300048929 Bacteria 1285
414 Ga0495682_0032610 3300049460 Bacteria 1924
415 Ga0501031_0026677 3300049568 Bacteria 3765
416 Ga0501033_0044178 3300049570 Bacteria 3317
417 Ga0501034_0168221 3300049571 Bacteria 2160
418 Ga0501034_0228932 3300049571 Bacteria 1808
419 Ga0501034_0275716 3300049571 Bacteria 1622
420 Ga0501034_0287800 3300049571 Bacteria 1582
421 Ga0501034_0308712 3300049571 Bacteria 1517
422 Ga0501036_0018011 3300049572 Bacteria 5913
423 Ga0501037_0052290 3300049573 Bacteria 2988
424 Ga0501038_0000045 3300049574 Bacteria 106662
425 Ga0501038_0115359 3300049574 Bacteria 2220
426 Ga0501038_0488468 3300049574 Bacteria 943
427 Ga0501039_0002298 3300049575 Bacteria 14183
428 Ga0501040_0041762 3300049576 Bacteria 3124
429 Ga0501040_0387449 3300049576 Bacteria 1003
430 Ga0501041_0025595 3300049577 Bacteria 3546
431 Ga0501042_0042874 3300049578 Bacteria 3221
432 Ga0501043_0083200 3300049579 Bacteria 2516
433 Ga0501046_0009232 3300049580 Bacteria 8538
434 Ga0501047_0187626 3300049581 Bacteria 1932
435 Ga0501047_0220089 3300049581 Bacteria 1755
436 Ga0501047_0732207 3300049581 Bacteria 805
437 Ga0501048_0012542 3300049582 Bacteria 6306
438 Ga0501068_0020446 3300049584 Bacteria 3857
439 Ga0501069_0161715 3300049585 Bacteria 1289
440 Ga0501070_0086584 3300049586 Bacteria 2594
441 Ga0501070_0401927 3300049586 Bacteria 1108
442 Ga0501071_0003945 3300049587 Bacteria 9358
443 Ga0501072_0012326 3300049588 Bacteria 6533
444 Ga0501073_0068029 3300049589 Bacteria 2483
445 Ga0501073_0116432 3300049589 Bacteria 1852
446 Ga0501073_0118126 3300049589 Bacteria 1838
447 Ga0501075_0033152 3300049591 Bacteria 3841
448 Ga0501075_0150364 3300049591 Bacteria 1775
449 Ga0501077_0004830 3300049593 Bacteria 8189
450 Ga0501249_000467 3300049679 Bacteria 10062
451 Ga0501079_0011483 3300049741 Bacteria 6760
452 Ga0501080_0015858 3300049742 Bacteria 6951
453 Ga0501080_0154983 3300049742 Bacteria 2116
454 Ga0501081_0080531 3300049743 Bacteria 2279
455 Ga0501083_0002667 3300049744 Bacteria 12290
456 Ga0501083_0067310 3300049744 Bacteria 2385
457 Ga0501241_013007 3300049758 Bacteria 1511
458 Ga0501035_0091932 3300049822 Bacteria 2670
459 Ga0501035_0127867 3300049822 Bacteria 2217
460 Ga0501044_0113591 3300049823 Bacteria 2715
461 Ga0501044_0377706 3300049823 Bacteria 1333
462 Ga0501045_0005934 3300049824 Bacteria 8447
463 nmdc:mga00v17_10584_c1 3300050491 Bacteria 5042
464 nmdc:mga0k408_22257_c2 3300050493 Bacteria 2545
465 nmdc:mga0k408_85039_c1 3300050493 Bacteria 1856
466 nmdc:mga07m45_64995_c1 3300050496 Bacteria 2071
467 nmdc:mga0qj67_103718_c1 3300050509 Bacteria 2294
468 nmdc:mga0n895_61594_c1 3300050512 Bacteria 3705
469 nmdc:mga08x19_65610_c1 3300050514 Bacteria 2358
470 nmdc:mga08x19_89_c1 3300050514 Bacteria 82051
471 nmdc:mga0sz30_43297_c1 3300050516 Bacteria 1895
472 Ga0500610_0000436 3300053079 Bacteria 12880
473 Ga0495619_0151904 3300053085 Bacteria 1597
474 Ga0500643_000112 3300053087 Bacteria 84793
475 Ga0500643_003022 3300053087 Bacteria 8318
476 Ga0500643_014901 3300053087 Bacteria 2683
477 Ga0500643_018918 3300053087 Bacteria 2277
478 Ga0500566_0018190 3300053094 Bacteria 4128
479 Ga0500566_0022608 3300053094 Bacteria 3694
480 Ga0500566_0073865 3300053094 Bacteria 1910
481 Ga0500556_0000077 3300053104 Bacteria 94403
482 Ga0500556_0004003 3300053104 Bacteria 4248
483 Ga0500592_003045 3300053116 Bacteria 2681
484 Ga0500595_017878 3300053119 Bacteria 2605
485 Ga0500595_027337 3300053119 Bacteria 1954
486 Ga0500618_015818 3300053125 Bacteria 1899
487 Ga0500621_087436 3300053126 Bacteria 1243
488 Ga0500642_0014330 3300053130 Bacteria 2946
489 Ga0500658_0007887 3300053134 Bacteria 3934
490 Ga0500559_0022633 3300053136 Bacteria 2665
491 Ga0500559_0064670 3300053136 Bacteria 1637
492 Ga0500568_0059284 3300053139 Bacteria 1485
493 Ga0500573_0007085 3300053140 Bacteria 6099
494 Ga0500577_0055348 3300053142 Bacteria 1506
495 Ga0500590_028920 3300053148 Bacteria 2875
496 Ga0500616_0006367 3300053153 Bacteria 7746
497 Ga0500616_0045815 3300053153 Bacteria 2328
498 Ga0500622_0003668 3300053156 Bacteria 10088
499 Ga0500624_000100 3300053157 Bacteria 41296
500 Ga0500627_0050590 3300053158 Bacteria 1810
501 Ga0500636_0006048 3300053177 Bacteria 6943
502 Ga0500636_0064566 3300053177 Bacteria 2132
503 Ga0500645_000132 3300053730 Bacteria 58716
504 Ga0500645_008234 3300053730 Bacteria 3575
505 Ga0500645_014763 3300053730 Bacteria 2485
506 Ga0500596_007330 3300053735 Bacteria 1812
507 Ga0500599_000339 3300053736 Bacteria 4628
508 Ga0501084_0020696 3300054114 Bacteria 5487
509 Ga0500661_004776 3300055283 Bacteria 2531
510 Ga0587068_011041 3300059641 Bacteria 1356
511 Ga0501082_0010226 3300060353 Bacteria 8078
512 Ga0501082_0149490 3300060353 Bacteria 2028
513 Ga0530510_0006210 3300061734 Bacteria 8306

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_0182949 Ga0495630_0182949_834_1568 234
2 3300049581 Ga0501047_0732207 Ga0501047_0732207_58_795 243
3 3300048088 Ga0495602_0180704 Ga0495602_0180704_803_1612 250
4 3300053085 Ga0495619_0151904 Ga0495619_0151904_772_1581 250
5 3300028379 Ga0268266_10188781 Ga0268266_101887812 253
6 3300048921 Ga0496118_0138372 Ga0496118_0138372_12_887 253
7 3300021384 Ga0213876_10077103 Ga0213876_100771032 255
8 3300031595 Ga0265313_10082963 Ga0265313_100829631 255
9 3300031711 Ga0265314_10189594 Ga0265314_101895942 255
10 3300039437 Ga0436365_0477684 Ga0436365_0477684_530_1417 255
11 3300049589 Ga0501073_0118126 Ga0501073_0118126_88_969 258
12 3300032005 Ga0307411_10543514 Ga0307411_105435141 259
13 3300044735 Ga0466968_0126260 Ga0466968_0126260_48_926 259
14 3300005327 Ga0070658_10278111 Ga0070658_102781111 260
15 3300005455 Ga0070663_100255079 Ga0070663_1002550791 260
16 3300005539 Ga0068853_100324676 Ga0068853_1003246761 260
17 3300025919 Ga0207657_10194415 Ga0207657_101944151 260
18 3300025937 Ga0207669_10208516 Ga0207669_102085162 260
19 3300031548 Ga0307408_100350870 Ga0307408_1003508702 261
20 3300031911 Ga0307412_10204884 Ga0307412_102048842 261
21 3300025230 Ga0209563_101798 Ga0209563_1017985 262
22 3300031247 Ga0265340_10065942 Ga0265340_100659422 262
23 3300033180 Ga0307510_10032156 Ga0307510_100321565 262
24 3300046460 Ga0495638_0000880 Ga0495638_0000880_1022_1897 262
25 3300048924 Ga0496121_0042369 Ga0496121_0042369_2364_3239 262
26 3300053087 Ga0500643_000112 Ga0500643_000112_25805_26680 262
27 3300053094 Ga0500566_0018190 Ga0500566_0018190_1637_2512 262
28 3300053104 Ga0500556_0004003 Ga0500556_0004003_567_1442 262
29 3300053116 Ga0500592_003045 Ga0500592_003045_781_1656 262
30 3300053126 Ga0500621_087436 Ga0500621_087436_290_1165 262
31 3300053142 Ga0500577_0055348 Ga0500577_0055348_404_1279 262
32 3300053156 Ga0500622_0003668 Ga0500622_0003668_5451_6326 262
33 3300053158 Ga0500627_0050590 Ga0500627_0050590_382_1257 262
34 3300053736 Ga0500599_000339 Ga0500599_000339_330_1205 262
35 3300047443 Ga0495687_096452 Ga0495687_096452_175_1050 263
36 iso_pu_bacteria 8016557553 8016565814 263
37 3300009545 Ga0105237_10226951 Ga0105237_102269512 264
38 3300009551 Ga0105238_10251117 Ga0105238_102511172 264
39 3300010375 Ga0105239_10489347 Ga0105239_104893472 264
40 3300025914 Ga0207671_10019101 Ga0207671_100191012 264
41 3300026041 Ga0207639_10448921 Ga0207639_104489212 264
42 3300048088 Ga0495602_0318774 Ga0495602_0318774_309_1115 264
43 3300053125 Ga0500618_015818 Ga0500618_015818_600_1472 264
44 3300053148 Ga0500590_028920 Ga0500590_028920_1311_2183 264
45 3300035171 Ga0373946_0154957 Ga0373946_0154957_47_925 265
46 3300035692 Ga0373935_0032086 Ga0373935_0032086_606_1484 265
47 3300035724 Ga0373933_0032856 Ga0373933_0032856_441_1319 265
48 3300046514 Ga0495618_0038799 Ga0495618_0038799_1172_2050 265
49 3300046529 Ga0495652_0024549 Ga0495652_0024549_676_1554 265
50 3300046535 Ga0495586_0046653 Ga0495586_0046653_894_1772 265
51 3300046536 Ga0495587_0050347 Ga0495587_0050347_1501_2379 265
52 3300046642 Ga0495634_0110315 Ga0495634_0110315_256_1134 265
53 3300046675 Ga0495657_0037118 Ga0495657_0037118_1788_2666 265
54 3300046678 Ga0495599_0095460 Ga0495599_0095460_577_1455 265
55 3300047317 Ga0495604_0017212 Ga0495604_0017212_451_1329 265
56 3300005335 Ga0070666_10185827 Ga0070666_101858272 266
57 3300005347 Ga0070668_100000479 Ga0070668_10000047924 266
58 3300005353 Ga0070669_100068932 Ga0070669_1000689323 266
59 3300005367 Ga0070667_100000024 Ga0070667_100000024129 266
60 3300005841 Ga0068863_100000082 Ga0068863_10000008253 266
61 3300025304 Ga0209257_1011330 Ga0209257_10113304 266
62 3300025903 Ga0207680_10001557 Ga0207680_100015577 266
63 3300025923 Ga0207681_10019658 Ga0207681_100196582 266
64 3300025972 Ga0207668_10037414 Ga0207668_100374141 266
65 3300025986 Ga0207658_10000022 Ga0207658_1000002251 266
66 3300026078 Ga0207702_10343908 Ga0207702_103439082 266
67 3300026088 Ga0207641_10000139 Ga0207641_1000013951 266
68 3300041496 Ga0451839_0640379 Ga0451839_0640379_93_968 266
69 3300045976 Ga0466967_0098402 Ga0466967_0098402_1054_1929 266
70 3300046471 Ga0495650_0016554 Ga0495650_0016554_1826_2698 266
71 3300050516 nmdc:mga0sz30_43297_c1 nmdc:mga0sz30_43297_c1_422_1297 266
72 3300005937 Ga0081455_10096438 Ga0081455_100964382 267
73 3300048928 Ga0496125_0091644 Ga0496125_0091644_380_1249 267
74 3300053087 Ga0500643_018918 Ga0500643_018918_565_1434 267
75 3300053157 Ga0500624_000100 Ga0500624_000100_30932_31801 267
76 3300053177 Ga0500636_0006048 Ga0500636_0006048_1024_1893 267
77 3300010375 Ga0105239_10512436 Ga0105239_105124362 268
78 3300048929 Ga0496126_0315944 Ga0496126_0315944_218_1090 269
79 3300048090 Ga0495615_0001828 Ga0495615_0001828_1227_2102 270
80 3300048925 Ga0496122_0027958 Ga0496122_0027958_791_1666 270
81 3300048926 Ga0496123_0006131 Ga0496123_0006131_6659_7534 270
82 3300048927 Ga0496124_0132316 Ga0496124_0132316_536_1411 270
83 3300005341 Ga0070691_10012537 Ga0070691_100125374 272
84 3300005434 Ga0070709_10151827 Ga0070709_101518271 272
85 3300005436 Ga0070713_100000121 Ga0070713_10000012144 272
86 3300005518 Ga0070699_100154609 Ga0070699_1001546092 272
87 3300005539 Ga0068853_100005255 Ga0068853_1000052556 272
88 3300005545 Ga0070695_100136548 Ga0070695_1001365482 272
89 3300005563 Ga0068855_100067127 Ga0068855_1000671274 272
90 3300005577 Ga0068857_100004014 Ga0068857_10000401411 272
91 3300005614 Ga0068856_100000497 Ga0068856_10000049716 272
92 3300005614 Ga0068856_100001104 Ga0068856_10000110431 272
93 3300006175 Ga0070712_100001870 Ga0070712_1000018704 272
94 3300006871 Ga0075434_100023686 Ga0075434_1000236864 272
95 3300006914 Ga0075436_100000720 Ga0075436_10000072016 272
96 3300007076 Ga0075435_100085091 Ga0075435_1000850912 272
97 3300009093 Ga0105240_10008009 Ga0105240_1000800913 272
98 3300009098 Ga0105245_10332201 Ga0105245_103322011 272
99 3300009174 Ga0105241_10142009 Ga0105241_101420092 272
100 3300009545 Ga0105237_10006681 Ga0105237_100066812 272
101 3300009551 Ga0105238_10009161 Ga0105238_1000916112 272
102 3300013100 Ga0157373_10080111 Ga0157373_100801112 272
103 3300013104 Ga0157370_10033946 Ga0157370_100339466 272
104 3300013105 Ga0157369_10003048 Ga0157369_100030482 272
105 3300013307 Ga0157372_10415613 Ga0157372_104156131 272
106 3300014325 Ga0163163_10174107 Ga0163163_101741072 272
107 3300014968 Ga0157379_10266459 Ga0157379_102664592 272
108 3300025906 Ga0207699_10000517 Ga0207699_100005171 272
109 3300025913 Ga0207695_10064201 Ga0207695_100642012 272
110 3300025914 Ga0207671_10023877 Ga0207671_100238775 272
111 3300025915 Ga0207693_10002910 Ga0207693_1000291015 272
112 3300025924 Ga0207694_10013789 Ga0207694_100137892 272
113 3300025928 Ga0207700_10000972 Ga0207700_1000097211 272
114 3300025939 Ga0207665_10021654 Ga0207665_100216543 272
115 3300025949 Ga0207667_10003097 Ga0207667_1000309712 272
116 3300026078 Ga0207702_10000182 Ga0207702_100001828 272
117 3300026078 Ga0207702_10001450 Ga0207702_1000145023 272
118 3300026116 Ga0207674_10000003 Ga0207674_1000000386 272
119 3300035691 Ga0373931_0087396 Ga0373931_0087396_78_953 272
120 3300035692 Ga0373935_0131151 Ga0373935_0131151_191_1066 272
121 3300050512 nmdc:mga0n895_61594_c1 nmdc:mga0n895_61594_c1_471_1346 272
122 3300050514 nmdc:mga08x19_65610_c1 nmdc:mga08x19_65610_c1_655_1530 272
123 3300050514 nmdc:mga08x19_89_c1 nmdc:mga08x19_89_c1_70413_71288 272
124 3300049571 Ga0501034_0275716 Ga0501034_0275716_626_1522 273
125 3300053087 Ga0500643_003022 Ga0500643_003022_944_1816 273
126 3300053136 Ga0500559_0022633 Ga0500559_0022633_598_1470 273
127 3300055283 Ga0500661_004776 Ga0500661_004776_686_1558 273
128 3300005458 Ga0070681_10223985 Ga0070681_102239852 274
129 3300005530 Ga0070679_100000019 Ga0070679_10000001925 274
130 3300025912 Ga0207707_10048443 Ga0207707_100484434 274
131 3300025917 Ga0207660_10022300 Ga0207660_100223002 274
132 3300025921 Ga0207652_10000004 Ga0207652_10000004384 274
133 3300039062 Ga0400483_170323 Ga0400483_170323_840_1715 275
134 3300049571 Ga0501034_0168221 Ga0501034_0168221_912_1790 276
135 3300021358 Ga0213873_10000007 Ga0213873_10000007138 277
136 3300021384 Ga0213876_10000005 Ga0213876_10000005174 277
137 3300039437 Ga0436365_1257511 Ga0436365_1257511_2214_3101 277
138 3300039450 Ga0436363_1509974 Ga0436363_1509974_51_938 277
139 3300039453 Ga0436362_0451893 Ga0436362_0451893_129127_130014 277
140 3300048904 Ga0496101_0144474 Ga0496101_0144474_306_1190 277
141 3300049574 Ga0501038_0000045 Ga0501038_0000045_40259_41224 278
142 3300031247 Ga0265340_10026611 Ga0265340_100266112 279
143 3300031249 Ga0265339_10116732 Ga0265339_101167322 279
144 3300031712 Ga0265342_10040124 Ga0265342_100401242 279
145 3300025298 Ga0209050_1010036 Ga0209050_10100364 280
146 3300025304 Ga0209257_1000112 Ga0209257_1000112221 280
147 3300031852 Ga0307410_10363074 Ga0307410_103630742 280
148 3300032002 Ga0307416_100290420 Ga0307416_1002904202 280
149 3300032005 Ga0307411_10168733 Ga0307411_101687332 280
150 3300031241 Ga0265325_10043397 Ga0265325_100433972 282
151 3300039062 Ga0400483_201528 Ga0400483_201528_194_1078 282
152 3300046660 Ga0495625_0000069 Ga0495625_0000069_1106_1963 282
153 3300048918 Ga0496115_0023531 Ga0496115_0023531_2152_3009 282
154 3300048922 Ga0496119_0006343 Ga0496119_0006343_1722_2606 282
155 3300009553 Ga0105249_10260745 Ga0105249_102607451 284
156 3300035410 Ga0373924_0129500 Ga0373924_0129500_154_1023 284
157 3300035725 Ga0373947_0143436 Ga0373947_0143436_457_1326 284
158 3300047471 Ga0495684_0163614 Ga0495684_0163614_229_1098 284
159 3300053094 Ga0500566_0073865 Ga0500566_0073865_272_1132 284
160 iso_pu_bacteria 2510917020 2511125468 284
161 iso_pu_bacteria 2919679072 2919681939 284
162 iso_pu_bacteria 2935769743 2935774274 285
163 3300046460 Ga0495638_0107971 Ga0495638_0107971_138_1007 286
164 3300046691 Ga0495670_0000037 Ga0495670_0000037_7803_8693 286
165 iso_pu_bacteria 2508501128 2509152192 286
166 iso_pu_bacteria 2818991438 2819553029 286
167 iso_pu_bacteria 2885429604 2885430251 286
168 3300009148 Ga0105243_10405953 Ga0105243_104059532 287
169 3300053730 Ga0500645_008234 Ga0500645_008234_1750_2625 287
170 iso_pu_bacteria 2919450847 2919452702 287
171 3300003773 Ga0055537_1007393 Ga0055537_10073932 288
172 3300003775 Ga0055524_1011023 Ga0055524_10110233 288
173 3300003790 Ga0055528_1002220 Ga0055528_10022202 288
174 3300006195 Ga0075366_10053062 Ga0075366_100530622 288
175 3300025263 Ga0209565_1000149 Ga0209565_100014942 288
176 3300025273 Ga0209673_1006361 Ga0209673_10063618 288
177 3300025291 Ga0209675_1006535 Ga0209675_10065356 288
178 3300025299 Ga0209256_1009780 Ga0209256_10097803 288
179 3300032168 Ga0316593_10012562 Ga0316593_100125622 288
180 3300039437 Ga0436365_1739626 Ga0436365_1739626_388_1260 288
181 3300049823 Ga0501044_0377706 Ga0501044_0377706_94_963 288
182 3300050493 nmdc:mga0k408_22257_c2 nmdc:mga0k408_22257_c2_860_1735 288
183 iso_pu_bacteria 2840878972 2840880322 288
184 iso_pu_bacteria 2885427238 2885428637 288
185 3300005434 Ga0070709_10347685 Ga0070709_103476851 289
186 3300005439 Ga0070711_100033560 Ga0070711_1000335603 289
187 3300005549 Ga0070704_100292766 Ga0070704_1002927662 289
188 3300005617 Ga0068859_100097479 Ga0068859_1000974794 289
189 3300005843 Ga0068860_100020798 Ga0068860_1000207987 289
190 3300005844 Ga0068862_100006902 Ga0068862_1000069024 289
191 3300006931 Ga0097620_100097478 Ga0097620_1000974784 289
192 3300009176 Ga0105242_10076982 Ga0105242_100769822 289
193 3300009176 Ga0105242_10104991 Ga0105242_101049913 289
194 3300009551 Ga0105238_10283925 Ga0105238_102839253 289
195 3300009553 Ga0105249_10174218 Ga0105249_101742184 289
196 3300014968 Ga0157379_10009377 Ga0157379_100093775 289
197 3300025261 Ga0209233_1017719 Ga0209233_10177192 289
198 3300025915 Ga0207693_10006853 Ga0207693_1000685310 289
199 3300025916 Ga0207663_10026639 Ga0207663_100266392 289
200 3300025934 Ga0207686_10088543 Ga0207686_100885433 289
201 3300025961 Ga0207712_10226873 Ga0207712_102268732 289
202 3300028380 Ga0268265_10005820 Ga0268265_100058203 289
203 3300028380 Ga0268265_10443654 Ga0268265_104436542 289
204 3300028381 Ga0268264_10009537 Ga0268264_100095375 289
205 3300035695 Ga0373927_0118392 Ga0373927_0118392_526_1401 289
206 3300037068 Ga0373925_0095947 Ga0373925_0095947_1123_1998 289
207 3300037068 Ga0373925_0129870 Ga0373925_0129870_1067_1942 289
208 3300039062 Ga0400483_031499 Ga0400483_031499_570_1439 289
209 3300039062 Ga0400483_119336 Ga0400483_119336_265_1137 289
210 3300039062 Ga0400483_204155 Ga0400483_204155_474_1346 289
211 3300039062 Ga0400483_252307 Ga0400483_252307_108_980 289
212 3300039062 Ga0400483_282374 Ga0400483_282374_548_1417 289
213 3300047472 Ga0495686_0000733 Ga0495686_0000733_14266_15144 289
214 3300049742 Ga0501080_0015858 Ga0501080_0015858_4790_5668 289
215 3300049744 Ga0501083_0002667 Ga0501083_0002667_7092_7970 289
216 3300053119 Ga0500595_027337 Ga0500595_027337_695_1576 289
217 3300053140 Ga0500573_0007085 Ga0500573_0007085_4003_4881 289
218 3300060353 Ga0501082_0149490 Ga0501082_0149490_40_918 289
219 3300003762 Ga0055542_1000040 Ga0055542_1000040204 290
220 3300003762 Ga0055542_1000609 Ga0055542_100060911 290
221 3300003763 Ga0055529_1000037 Ga0055529_100003717 290
222 3300005329 Ga0070683_100132035 Ga0070683_1001320353 290
223 3300005333 Ga0070677_10130476 Ga0070677_101304761 290
224 3300005335 Ga0070666_10186202 Ga0070666_101862022 290
225 3300005354 Ga0070675_100176998 Ga0070675_1001769982 290
226 3300005356 Ga0070674_100063196 Ga0070674_1000631962 290
227 3300005366 Ga0070659_100260581 Ga0070659_1002605812 290
228 3300005456 Ga0070678_100012561 Ga0070678_1000125615 290
229 3300005564 Ga0070664_100227872 Ga0070664_1002278722 290
230 3300005617 Ga0068859_100001286 Ga0068859_10000128615 290
231 3300005719 Ga0068861_100000046 Ga0068861_10000004621 290
232 3300005841 Ga0068863_100037980 Ga0068863_1000379805 290
233 3300005843 Ga0068860_100000938 Ga0068860_10000093819 290
234 3300005844 Ga0068862_100000236 Ga0068862_10000023613 290
235 3300006353 Ga0075370_10038326 Ga0075370_100383263 290
236 3300006931 Ga0097620_100001286 Ga0097620_10000128615 290
237 3300009148 Ga0105243_10001261 Ga0105243_100012612 290
238 3300009174 Ga0105241_10290044 Ga0105241_102900442 290
239 3300009177 Ga0105248_10006088 Ga0105248_1000608814 290
240 3300009553 Ga0105249_10000244 Ga0105249_1000024414 290
241 3300009553 Ga0105249_10554028 Ga0105249_105540282 290
242 3300011119 Ga0105246_10180109 Ga0105246_101801092 290
243 3300013102 Ga0157371_10000747 Ga0157371_100007472 290
244 3300013296 Ga0157374_10516300 Ga0157374_105163001 290
245 3300013297 Ga0157378_10093529 Ga0157378_100935292 290
246 3300014745 Ga0157377_10112319 Ga0157377_101123192 290
247 3300025230 Ga0209563_100105 Ga0209563_10010599 290
248 3300025246 Ga0209646_1014936 Ga0209646_10149362 290
249 3300025253 Ga0209677_103597 Ga0209677_1035972 290
250 3300025254 Ga0209148_1000011 Ga0209148_10000111102 290
251 3300025272 Ga0209455_1000006 Ga0209455_100000690 290
252 3300025297 Ga0209758_1000023 Ga0209758_1000023493 290
253 3300025321 Ga0207656_10005244 Ga0207656_100052444 290
254 3300025893 Ga0207682_10127503 Ga0207682_101275031 290
255 3300025907 Ga0207645_10121881 Ga0207645_101218812 290
256 3300025909 Ga0207705_10000319 Ga0207705_1000031942 290
257 3300025911 Ga0207654_10002561 Ga0207654_100025618 290
258 3300025913 Ga0207695_10053961 Ga0207695_100539613 290
259 3300025914 Ga0207671_10042102 Ga0207671_100421022 290
260 3300025919 Ga0207657_10022464 Ga0207657_100224642 290
261 3300025920 Ga0207649_10000986 Ga0207649_1000098616 290
262 3300025924 Ga0207694_10080383 Ga0207694_100803832 290
263 3300025926 Ga0207659_10177354 Ga0207659_101773542 290
264 3300025932 Ga0207690_10002620 Ga0207690_1000262010 290
265 3300025933 Ga0207706_10153778 Ga0207706_101537782 290
266 3300025935 Ga0207709_10000039 Ga0207709_1000003991 290
267 3300025937 Ga0207669_10001720 Ga0207669_100017202 290
268 3300025941 Ga0207711_10001387 Ga0207711_1000138714 290
269 3300025949 Ga0207667_10000006 Ga0207667_10000006550 290
270 3300025961 Ga0207712_10000149 Ga0207712_1000014955 290
271 3300025981 Ga0207640_10000413 Ga0207640_100004137 290
272 3300025986 Ga0207658_10228821 Ga0207658_102288213 290
273 3300026041 Ga0207639_10003109 Ga0207639_1000310912 290
274 3300026078 Ga0207702_10058805 Ga0207702_100588052 290
275 3300026088 Ga0207641_10022466 Ga0207641_100224663 290
276 3300026118 Ga0207675_100000122 Ga0207675_10000012221 290
277 3300026142 Ga0207698_10130092 Ga0207698_101300922 290
278 3300028379 Ga0268266_10000002 Ga0268266_100000021089 290
279 3300028380 Ga0268265_10001866 Ga0268265_100018663 290
280 3300028381 Ga0268264_10000910 Ga0268264_100009103 290
281 3300031456 Ga0307513_10011050 Ga0307513_100110503 290
282 3300046455 Ga0495603_0178135 Ga0495603_0178135_326_1204 290
283 3300046459 Ga0495629_0185012 Ga0495629_0185012_111_992 290
284 3300046471 Ga0495650_0009791 Ga0495650_0009791_3276_4157 290
285 3300046491 Ga0495584_0074913 Ga0495584_0074913_467_1348 290
286 3300046506 Ga0495583_0017427 Ga0495583_0017427_1686_2567 290
287 3300046506 Ga0495583_0044038 Ga0495583_0044038_1153_2034 290
288 3300046506 Ga0495583_0150050 Ga0495583_0150050_59_940 290
289 3300046507 Ga0495606_0010652 Ga0495606_0010652_774_1655 290
290 3300046518 Ga0495631_0017612 Ga0495631_0017612_2310_3191 290
291 3300046520 Ga0495637_0020860 Ga0495637_0020860_367_1248 290
292 3300046522 Ga0495643_0010747 Ga0495643_0010747_1028_1909 290
293 3300046522 Ga0495643_0068761 Ga0495643_0068761_65_946 290
294 3300046524 Ga0495648_0000189 Ga0495648_0000189_61286_62167 290
295 3300046525 Ga0495663_0027967 Ga0495663_0027967_168_1049 290
296 3300046542 Ga0495597_0035459 Ga0495597_0035459_25_906 290
297 3300046558 Ga0495633_0000547 Ga0495633_0000547_35810_36691 290
298 3300046616 Ga0495668_0000181 Ga0495668_0000181_60709_61590 290
299 3300046660 Ga0495625_0000312 Ga0495625_0000312_34386_35267 290
300 3300046660 Ga0495625_0020815 Ga0495625_0020815_4160_5041 290
301 3300046665 Ga0495661_0126449 Ga0495661_0126449_190_1071 290
302 3300046684 Ga0495669_0000179 Ga0495669_0000179_35136_36017 290
303 3300046691 Ga0495670_0004999 Ga0495670_0004999_3963_4844 290
304 3300046694 Ga0495649_0116620 Ga0495649_0116620_340_1221 290
305 3300046809 Ga0495600_0010218 Ga0495600_0010218_1219_2103 290
306 3300046810 Ga0495660_0029133 Ga0495660_0029133_758_1639 290
307 3300047323 Ga0495683_0039227 Ga0495683_0039227_447_1328 290
308 3300047443 Ga0495687_001524 Ga0495687_001524_18951_19832 290
309 3300047443 Ga0495687_019736 Ga0495687_019736_1220_2101 290
310 3300047470 Ga0495681_0031838 Ga0495681_0031838_1346_2227 290
311 3300048905 Ga0496102_0020799 Ga0496102_0020799_3937_4818 290
312 3300048906 Ga0496103_0009250 Ga0496103_0009250_3889_4770 290
313 3300048907 Ga0496104_0020854 Ga0496104_0020854_3916_4797 290
314 3300048908 Ga0496105_0016339 Ga0496105_0016339_3981_4862 290
315 3300048913 Ga0496110_0059344 Ga0496110_0059344_1305_2186 290
316 3300048917 Ga0496114_0254748 Ga0496114_0254748_641_1522 290
317 3300048918 Ga0496115_0122170 Ga0496115_0122170_1180_2061 290
318 3300048919 Ga0496116_0050896 Ga0496116_0050896_920_1801 290
319 3300048920 Ga0496117_0017135 Ga0496117_0017135_3985_4866 290
320 3300048921 Ga0496118_0002303 Ga0496118_0002303_23876_24757 290
321 3300048922 Ga0496119_0099574 Ga0496119_0099574_31_912 290
322 3300048923 Ga0496120_0066963 Ga0496120_0066963_23_904 290
323 3300048925 Ga0496122_0028769 Ga0496122_0028769_38_919 290
324 3300048926 Ga0496123_0081756 Ga0496123_0081756_1053_1934 290
325 3300048927 Ga0496124_0000041 Ga0496124_0000041_197159_198040 290
326 3300048928 Ga0496125_0093451 Ga0496125_0093451_490_1371 290
327 3300048929 Ga0496126_0023311 Ga0496126_0023311_1271_2152 290
328 3300049460 Ga0495682_0032610 Ga0495682_0032610_545_1426 290
329 3300049574 Ga0501038_0488468 Ga0501038_0488468_26_904 290
330 3300050493 nmdc:mga0k408_85039_c1 nmdc:mga0k408_85039_c1_163_1044 290
331 3300050496 nmdc:mga07m45_64995_c1 nmdc:mga07m45_64995_c1_306_1193 290
332 3300053079 Ga0500610_0000436 Ga0500610_0000436_54_935 290
333 3300053119 Ga0500595_017878 Ga0500595_017878_532_1413 290
334 3300053130 Ga0500642_0014330 Ga0500642_0014330_863_1744 290
335 3300053177 Ga0500636_0064566 Ga0500636_0064566_187_1068 290
336 3300053730 Ga0500645_000132 Ga0500645_000132_26542_27423 290
337 3300053735 Ga0500596_007330 Ga0500596_007330_324_1205 290
338 3300003762 Ga0055542_1005454 Ga0055542_10054542 291
339 3300005327 Ga0070658_10204652 Ga0070658_102046522 291
340 3300005344 Ga0070661_100216530 Ga0070661_1002165302 291
341 3300005563 Ga0068855_100372792 Ga0068855_1003727921 291
342 3300005981 Ga0081538_10006545 Ga0081538_100065457 291
343 3300006048 Ga0075363_100053180 Ga0075363_1000531802 291
344 3300006051 Ga0075364_10046119 Ga0075364_100461192 291
345 3300009545 Ga0105237_10107412 Ga0105237_101074122 291
346 3300015690 Ga0183363_1002 Ga0183363_1002295 291
347 3300021388 Ga0213875_10002026 Ga0213875_100020263 291
348 3300025254 Ga0209148_1000238 Ga0209148_10002382 291
349 3300025909 Ga0207705_10000076 Ga0207705_1000007619 291
350 3300025923 Ga0207681_10131888 Ga0207681_101318882 291
351 3300026116 Ga0207674_10099388 Ga0207674_100993882 291
352 3300028786 Ga0307517_10051484 Ga0307517_100514842 291
353 3300031595 Ga0265313_10051589 Ga0265313_100515892 291
354 3300037418 Ga0395900_0370977 Ga0395900_0370977_402_1313 291
355 3300037853 Ga0436364_0333182 Ga0436364_0333182_1040_1921 291
356 3300037853 Ga0436364_1265123 Ga0436364_1265123_76113_76994 291
357 3300039450 Ga0436363_0656603 Ga0436363_0656603_49_936 291
358 3300041460 Ga0451802_1305520 Ga0451802_1305520_85_966 291
359 3300041462 Ga0451806_696590 Ga0451806_696590_683_1564 291
360 3300041486 Ga0451807_2598915 Ga0451807_2598915_413_1294 291
361 3300048914 Ga0496111_0211076 Ga0496111_0211076_528_1409 291
362 3300048922 Ga0496119_0000709 Ga0496119_0000709_32889_33770 291
363 3300048925 Ga0496122_0002977 Ga0496122_0002977_20252_21133 291
364 3300048925 Ga0496122_0036712 Ga0496122_0036712_856_1737 291
365 3300048926 Ga0496123_0001738 Ga0496123_0001738_23313_24194 291
366 3300048926 Ga0496123_0016942 Ga0496123_0016942_1124_2005 291
367 3300048927 Ga0496124_0144999 Ga0496124_0144999_866_1747 291
368 3300049568 Ga0501031_0026677 Ga0501031_0026677_2738_3619 291
369 3300049571 Ga0501034_0228932 Ga0501034_0228932_156_1037 291
370 3300049571 Ga0501034_0287800 Ga0501034_0287800_542_1423 291
371 3300049572 Ga0501036_0018011 Ga0501036_0018011_3078_3959 291
372 3300049574 Ga0501038_0115359 Ga0501038_0115359_1328_2209 291
373 3300049575 Ga0501039_0002298 Ga0501039_0002298_4227_5108 291
374 3300049576 Ga0501040_0041762 Ga0501040_0041762_1154_2035 291
375 3300049576 Ga0501040_0387449 Ga0501040_0387449_84_965 291
376 3300049577 Ga0501041_0025595 Ga0501041_0025595_2315_3196 291
377 3300049578 Ga0501042_0042874 Ga0501042_0042874_2326_3207 291
378 3300049579 Ga0501043_0083200 Ga0501043_0083200_770_1651 291
379 3300049580 Ga0501046_0009232 Ga0501046_0009232_6978_7859 291
380 3300049581 Ga0501047_0220089 Ga0501047_0220089_332_1213 291
381 3300049582 Ga0501048_0012542 Ga0501048_0012542_1127_2008 291
382 3300049584 Ga0501068_0020446 Ga0501068_0020446_2417_3298 291
383 3300049585 Ga0501069_0161715 Ga0501069_0161715_18_899 291
384 3300049586 Ga0501070_0086584 Ga0501070_0086584_879_1760 291
385 3300049587 Ga0501071_0003945 Ga0501071_0003945_2217_3098 291
386 3300049588 Ga0501072_0012326 Ga0501072_0012326_3484_4365 291
387 3300049589 Ga0501073_0068029 Ga0501073_0068029_551_1432 291
388 3300049589 Ga0501073_0116432 Ga0501073_0116432_405_1286 291
389 3300049591 Ga0501075_0033152 Ga0501075_0033152_2642_3523 291
390 3300049591 Ga0501075_0150364 Ga0501075_0150364_107_988 291
391 3300049593 Ga0501077_0004830 Ga0501077_0004830_6741_7622 291
392 3300049679 Ga0501249_000467 Ga0501249_000467_8327_9208 291
393 3300049741 Ga0501079_0011483 Ga0501079_0011483_3565_4446 291
394 3300049742 Ga0501080_0154983 Ga0501080_0154983_499_1380 291
395 3300049743 Ga0501081_0080531 Ga0501081_0080531_752_1633 291
396 3300049744 Ga0501083_0067310 Ga0501083_0067310_881_1762 291
397 3300049822 Ga0501035_0127867 Ga0501035_0127867_317_1198 291
398 3300049824 Ga0501045_0005934 Ga0501045_0005934_5230_6111 291
399 3300050491 nmdc:mga00v17_10584_c1 nmdc:mga00v17_10584_c1_3220_4107 291
400 3300053104 Ga0500556_0000077 Ga0500556_0000077_23419_24300 291
401 3300053136 Ga0500559_0064670 Ga0500559_0064670_323_1207 291
402 3300053153 Ga0500616_0006367 Ga0500616_0006367_5261_6142 291
403 3300053153 Ga0500616_0045815 Ga0500616_0045815_630_1511 291
404 3300053730 Ga0500645_014763 Ga0500645_014763_729_1610 291
405 3300054114 Ga0501084_0020696 Ga0501084_0020696_3569_4450 291
406 3300060353 Ga0501082_0010226 Ga0501082_0010226_4348_5229 291
407 3300061734 Ga0530510_0006210 Ga0530510_0006210_5289_6170 291
408 3300002774 JGI25150J39212_1000349 JGI25150J39212_100034923 292
409 3300003781 Ga0055536_1014747 Ga0055536_10147472 292
410 3300003792 Ga0055540_1001501 Ga0055540_10015019 292
411 3300005262 Ga0065165_1017252 Ga0065165_10172522 292
412 3300005327 Ga0070658_10006404 Ga0070658_100064046 292
413 3300005331 Ga0070670_100034317 Ga0070670_1000343173 292
414 3300005337 Ga0070682_100126065 Ga0070682_1001260652 292
415 3300005339 Ga0070660_100234038 Ga0070660_1002340382 292
416 3300005344 Ga0070661_100000933 Ga0070661_10000093317 292
417 3300005344 Ga0070661_100095000 Ga0070661_1000950002 292
418 3300005347 Ga0070668_100000123 Ga0070668_10000012325 292
419 3300005355 Ga0070671_100124028 Ga0070671_1001240282 292
420 3300005365 Ga0070688_100167200 Ga0070688_1001672002 292
421 3300005366 Ga0070659_100080749 Ga0070659_1000807492 292
422 3300005458 Ga0070681_10104601 Ga0070681_101046012 292
423 3300005617 Ga0068859_100095238 Ga0068859_1000952382 292
424 3300005841 Ga0068863_100000020 Ga0068863_10000002027 292
425 3300005843 Ga0068860_100340126 Ga0068860_1003401262 292
426 3300005844 Ga0068862_100082933 Ga0068862_1000829332 292
427 3300005985 Ga0081539_10028290 Ga0081539_100282902 292
428 3300005985 Ga0081539_10030495 Ga0081539_100304953 292
429 3300006931 Ga0097620_100095232 Ga0097620_1000952322 292
430 3300009093 Ga0105240_10041127 Ga0105240_100411272 292
431 3300009551 Ga0105238_10061150 Ga0105238_100611503 292
432 3300009553 Ga0105249_10203480 Ga0105249_102034802 292
433 3300013104 Ga0157370_10029166 Ga0157370_100291666 292
434 3300013105 Ga0157369_10097410 Ga0157369_100974102 292
435 3300013306 Ga0163162_10311615 Ga0163162_103116152 292
436 3300020082 Ga0206353_10967427 Ga0206353_109674271 292
437 3300025245 Ga0207425_1000094 Ga0207425_100009444 292
438 3300025258 Ga0209129_1005757 Ga0209129_10057572 292
439 3300025292 Ga0209676_1017478 Ga0209676_10174782 292
440 3300025294 Ga0209025_1000727 Ga0209025_100072713 292
441 3300025297 Ga0209758_1000002 Ga0209758_100000244 292
442 3300025297 Ga0209758_1000108 Ga0209758_1000108173 292
443 3300025298 Ga0209050_1000342 Ga0209050_100034246 292
444 3300025303 Ga0209051_1000226 Ga0209051_100022643 292
445 3300025304 Ga0209257_1009856 Ga0209257_10098565 292
446 3300025912 Ga0207707_10076984 Ga0207707_100769842 292
447 3300025913 Ga0207695_10084164 Ga0207695_100841642 292
448 3300025919 Ga0207657_10014944 Ga0207657_100149445 292
449 3300025919 Ga0207657_10019727 Ga0207657_100197275 292
450 3300025920 Ga0207649_10000220 Ga0207649_1000022026 292
451 3300025921 Ga0207652_10164725 Ga0207652_101647252 292
452 3300025924 Ga0207694_10169538 Ga0207694_101695382 292
453 3300025925 Ga0207650_10096664 Ga0207650_100966642 292
454 3300025931 Ga0207644_10000025 Ga0207644_100000258 292
455 3300025949 Ga0207667_10009399 Ga0207667_100093994 292
456 3300025961 Ga0207712_10050590 Ga0207712_100505902 292
457 3300025972 Ga0207668_10000085 Ga0207668_1000008519 292
458 3300026041 Ga0207639_10150567 Ga0207639_101505672 292
459 3300026078 Ga0207702_10076340 Ga0207702_100763402 292
460 3300026078 Ga0207702_10266123 Ga0207702_102661232 292
461 3300026088 Ga0207641_10000001 Ga0207641_10000001977 292
462 3300026118 Ga0207675_100141489 Ga0207675_1001414892 292
463 3300047472 Ga0495686_0086989 Ga0495686_0086989_923_1810 292
464 3300048918 Ga0496115_0134511 Ga0496115_0134511_218_1099 292
465 3300048924 Ga0496121_0028100 Ga0496121_0028100_2783_3718 292
466 3300048926 Ga0496123_0184192 Ga0496123_0184192_34_915 292
467 3300049570 Ga0501033_0044178 Ga0501033_0044178_941_1819 292
468 3300049571 Ga0501034_0308712 Ga0501034_0308712_603_1490 292
469 3300049573 Ga0501037_0052290 Ga0501037_0052290_1374_2252 292
470 3300049581 Ga0501047_0187626 Ga0501047_0187626_602_1480 292
471 3300049586 Ga0501070_0401927 Ga0501070_0401927_68_946 292
472 3300049822 Ga0501035_0091932 Ga0501035_0091932_291_1169 292
473 3300049823 Ga0501044_0113591 Ga0501044_0113591_602_1480 292
474 3300050509 nmdc:mga0qj67_103718_c1 nmdc:mga0qj67_103718_c1_415_1296 292
475 3300059641 Ga0587068_011041 Ga0587068_011041_15_899 292
476 iso_pu_bacteria 2643221622 2644128194 292
477 3300001904 JGI24736J21556_1000147 JGI24736J21556_10001472 293
478 3300003771 Ga0055526_1002525 Ga0055526_10025257 293
479 3300003773 Ga0055537_1013825 Ga0055537_10138252 293
480 3300005262 Ga0065165_1022328 Ga0065165_10223282 293
481 3300005353 Ga0070669_100242406 Ga0070669_1002424062 293
482 3300025263 Ga0209565_1000386 Ga0209565_10003863 293
483 3300025295 Ga0209564_1001341 Ga0209564_100134126 293
484 3300041999 Ga0439433_0037298 Ga0439433_0037298_195_1085 293
485 3300044684 Ga0466966_0014386 Ga0466966_0014386_1038_1922 293
486 3300048928 Ga0496125_0135487 Ga0496125_0135487_641_1528 293
487 3300006847 Ga0075431_100053550 Ga0075431_1000535502 294
488 3300025893 Ga0207682_10057987 Ga0207682_100579872 294
489 3300027876 Ga0209974_10014028 Ga0209974_100140281 294
490 3300031548 Ga0307408_100300628 Ga0307408_1003006282 294
491 3300031548 Ga0307408_100397567 Ga0307408_1003975672 294
492 3300031731 Ga0307405_10084921 Ga0307405_100849212 294
493 3300031852 Ga0307410_10257052 Ga0307410_102570521 294
494 3300031852 Ga0307410_10260920 Ga0307410_102609202 294
495 3300031901 Ga0307406_10386076 Ga0307406_103860761 294
496 3300032002 Ga0307416_100249772 Ga0307416_1002497722 294
497 3300032005 Ga0307411_10179724 Ga0307411_101797241 294
498 3300032126 Ga0307415_100227181 Ga0307415_1002271812 294
499 3300037418 Ga0395900_0001580 Ga0395900_0001580_7986_8873 294
500 3300037471 Ga0395905_0000538 Ga0395905_0000538_819_1706 294
501 3300038443 Ga0395901_0001664 Ga0395901_0001664_18673_19560 294
502 3300000652 ARCol0yngRDRAFT_1002397 ARCol0yngRDRAFT_10023972 296
503 3300003215 JGI25153J46596_10014916 JGI25153J46596_100149163 296
504 3300003773 Ga0055537_1003425 Ga0055537_10034254 296
505 3300003775 Ga0055524_1000209 Ga0055524_100020918 296
506 3300003794 Ga0055531_10016667 Ga0055531_100166673 296
507 3300005262 Ga0065165_1008513 Ga0065165_10085132 296
508 3300006946 Ga0079104_1016760 Ga0079104_10167602 296
509 3300025245 Ga0207425_1004731 Ga0207425_10047312 296
510 3300025263 Ga0209565_1000011 Ga0209565_1000011570 296
511 3300025273 Ga0209673_1000902 Ga0209673_100090210 296
512 3300025291 Ga0209675_1004628 Ga0209675_10046286 296
513 3300025297 Ga0209758_1016139 Ga0209758_10161392 296
514 3300025298 Ga0209050_1010379 Ga0209050_10103793 296
515 3300025299 Ga0209256_1000016 Ga0209256_100001630 296
516 3300025304 Ga0209257_1001798 Ga0209257_100179820 296
517 3300046453 Ga0495627_017065 Ga0495627_017065_1073_1963 296
518 3300046525 Ga0495663_0100391 Ga0495663_0100391_47_937 296
519 3300046665 Ga0495661_0064542 Ga0495661_0064542_1225_2115 296
520 3300049758 Ga0501241_013007 Ga0501241_013007_93_983 296
521 3300053087 Ga0500643_014901 Ga0500643_014901_578_1468 296
522 3300053094 Ga0500566_0022608 Ga0500566_0022608_1841_2731 296
523 3300053134 Ga0500658_0007887 Ga0500658_0007887_1620_2510 296
524 3300053139 Ga0500568_0059284 Ga0500568_0059284_324_1214 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00231

ATP-synt

ATP synthase

3

278

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tsf-assembly1.cif.gz_G the pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase 0.8971 2 296
4tsf-assembly1.cif.gz_G the pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase 0.8929 2 296
5dn6-assembly1.cif.gz_G atp synthase from paracoccus denitrificans 0.8877 3 296
5dn6-assembly1.cif.gz_G atp synthase from paracoccus denitrificans 0.8845 3 296
6foc-assembly1.cif.gz_G f1-atpase from mycobacterium smegmatis 0.8836 3 296
ID Description Score Start End Superfamily
af_I1KY89_89_218_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9092 75 197 3.40.1380.10
5dn6G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8957 28 253 3.40.1380.10
5dn6G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8826 28 253 3.40.1380.10
af_A0A1D6QQB0_1_102_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8707 77 175 3.40.1380.10
3oaaG02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8671 75 197 3.40.1380.10
ID Description Score Start End GO Terms
AF-A0A2E3C4P0-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.9391 1 296 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933
AF-A0A2E3C4P0-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.936 1 296 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933
AF-A0A355USC6-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.9356 1 296 GO:0005524
GO:0031676
GO:0045261
GO:0046933
AF-A0A258XLR0-F1-model_v4 ATP synthase F1 subunit gamma 0.9333 1 251 GO:0045261
GO:0046933
AF-A0A7C3K599-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.928 1 295 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
89.17 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map