F459089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 524 | 335 | 513 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300003781|Ga0055536_1014747|Ga0055536_10147472 |
| Length | 320 |
| Sequence | MASLKALKIRIGSVKSTQKITKAMKMVAAAKLRRAQEAAEAGRPYAQRLEAVVASLASKISVSESSPKLLAGTGKDQVHLLVIATSDKGLAGAFNTNIARLARRHAQELLAQGKTVKIYTIGRKGRAVLNRQFPKNIVHSIEPGDLGKLSFAXARGYADDLIARFEAGEFDVATLFYSTFKSVLAQEPTAQQIIPVAIPQAETAAVSSGAAVTYEPDEESILADLLPRNVAIQLFRAMRENAASEQGSKMTAMDNATRNAGDLIKRLNTIYNRQRRPRSRPSWWKSFRAPKRSKTVRTRKQQWQPKLPSQRPTMAAASAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 3 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 4 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 5 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 6 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 7 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 8 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 9 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 10 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 11 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 12 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 99 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 103 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 204 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 263 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 309 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 310 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 312 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 313 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 314 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 315 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 316 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 318 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 319 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 320 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 321 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 322 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 324 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 325 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 332 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 335 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.33 |
| Metatranscriptomes | 0.57 |
| Isolates | 2.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.7 |
| Nodule | 0.76 |
| Rhizoplane | 2.67 |
| Rhizosphere | 67.75 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 9.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARCol0yngRDRAFT_1002397 | 3300000652 | Bacteria | 1417 |
| 2 | JGI24736J21556_1000147 | 3300001904 | Bacteria | 12247 |
| 3 | JGI25150J39212_1000349 | 3300002774 | Bacteria | 22660 |
| 4 | JGI25153J46596_10014916 | 3300003215 | Bacteria | 3198 |
| 5 | Ga0055542_1000040 | 3300003762 | Bacteria | 214035 |
| 6 | Ga0055542_1000609 | 3300003762 | Bacteria | 30543 |
| 7 | Ga0055542_1005454 | 3300003762 | Bacteria | 2875 |
| 8 | Ga0055529_1000037 | 3300003763 | Bacteria | 237307 |
| 9 | Ga0055526_1002525 | 3300003771 | Bacteria | 12297 |
| 10 | Ga0055537_1003425 | 3300003773 | Bacteria | 4882 |
| 11 | Ga0055537_1007393 | 3300003773 | Bacteria | 2653 |
| 12 | Ga0055537_1013825 | 3300003773 | Bacteria | 1495 |
| 13 | Ga0055524_1000209 | 3300003775 | Bacteria | 62993 |
| 14 | Ga0055524_1011023 | 3300003775 | Bacteria | 3558 |
| 15 | Ga0055536_1014747 | 3300003781 | Bacteria | 2718 |
| 16 | Ga0055528_1002220 | 3300003790 | Bacteria | 10590 |
| 17 | Ga0055540_1001501 | 3300003792 | Bacteria | 13868 |
| 18 | Ga0055531_10016667 | 3300003794 | Bacteria | 3154 |
| 19 | Ga0065165_1008513 | 3300005262 | Bacteria | 4779 |
| 20 | Ga0065165_1017252 | 3300005262 | Bacteria | 2667 |
| 21 | Ga0065165_1022328 | 3300005262 | Bacteria | 2172 |
| 22 | Ga0070658_10006404 | 3300005327 | Bacteria | 9539 |
| 23 | Ga0070658_10204652 | 3300005327 | Bacteria | 1666 |
| 24 | Ga0070658_10278111 | 3300005327 | Bacteria | 1424 |
| 25 | Ga0070683_100132035 | 3300005329 | Bacteria | 2364 |
| 26 | Ga0070670_100034317 | 3300005331 | Bacteria | 4366 |
| 27 | Ga0070677_10130476 | 3300005333 | Bacteria | 1147 |
| 28 | Ga0070666_10185827 | 3300005335 | Bacteria | 1459 |
| 29 | Ga0070666_10186202 | 3300005335 | Bacteria | 1458 |
| 30 | Ga0070682_100126065 | 3300005337 | Bacteria | 1726 |
| 31 | Ga0070660_100234038 | 3300005339 | Bacteria | 1495 |
| 32 | Ga0070691_10012537 | 3300005341 | Bacteria | 3881 |
| 33 | Ga0070661_100000933 | 3300005344 | Bacteria | 20889 |
| 34 | Ga0070661_100095000 | 3300005344 | Bacteria | 2210 |
| 35 | Ga0070661_100216530 | 3300005344 | Bacteria | 1467 |
| 36 | Ga0070668_100000123 | 3300005347 | Bacteria | 48192 |
| 37 | Ga0070668_100000479 | 3300005347 | Bacteria | 26526 |
| 38 | Ga0070669_100068932 | 3300005353 | Bacteria | 2612 |
| 39 | Ga0070669_100242406 | 3300005353 | Bacteria | 1433 |
| 40 | Ga0070675_100176998 | 3300005354 | Bacteria | 1842 |
| 41 | Ga0070671_100124028 | 3300005355 | Bacteria | 2174 |
| 42 | Ga0070674_100063196 | 3300005356 | Bacteria | 2590 |
| 43 | Ga0070688_100167200 | 3300005365 | Bacteria | 1515 |
| 44 | Ga0070659_100080749 | 3300005366 | Bacteria | 2596 |
| 45 | Ga0070659_100260581 | 3300005366 | Bacteria | 1438 |
| 46 | Ga0070667_100000024 | 3300005367 | Bacteria | 191216 |
| 47 | Ga0070709_10151827 | 3300005434 | Bacteria | 1601 |
| 48 | Ga0070709_10347685 | 3300005434 | Bacteria | 1095 |
| 49 | Ga0070713_100000121 | 3300005436 | Bacteria | 50650 |
| 50 | Ga0070711_100033560 | 3300005439 | Bacteria | 3418 |
| 51 | Ga0070663_100255079 | 3300005455 | Bacteria | 1389 |
| 52 | Ga0070678_100012561 | 3300005456 | Bacteria | 5272 |
| 53 | Ga0070681_10104601 | 3300005458 | Bacteria | 2773 |
| 54 | Ga0070681_10223985 | 3300005458 | Bacteria | 1796 |
| 55 | Ga0070699_100154609 | 3300005518 | Bacteria | 2029 |
| 56 | Ga0070679_100000019 | 3300005530 | Bacteria | 127108 |
| 57 | Ga0068853_100005255 | 3300005539 | Bacteria | 10138 |
| 58 | Ga0068853_100324676 | 3300005539 | Bacteria | 1427 |
| 59 | Ga0070695_100136548 | 3300005545 | Bacteria | 1696 |
| 60 | Ga0070704_100292766 | 3300005549 | Bacteria | 1353 |
| 61 | Ga0068855_100067127 | 3300005563 | Bacteria | 4180 |
| 62 | Ga0068855_100372792 | 3300005563 | Bacteria | 1568 |
| 63 | Ga0070664_100227872 | 3300005564 | Bacteria | 1669 |
| 64 | Ga0068857_100004014 | 3300005577 | Bacteria | 12392 |
| 65 | Ga0068856_100000497 | 3300005614 | Bacteria | 43608 |
| 66 | Ga0068856_100001104 | 3300005614 | Bacteria | 28526 |
| 67 | Ga0068859_100001286 | 3300005617 | Bacteria | 25622 |
| 68 | Ga0068859_100095238 | 3300005617 | Bacteria | 3030 |
| 69 | Ga0068859_100097479 | 3300005617 | Bacteria | 2994 |
| 70 | Ga0068861_100000046 | 3300005719 | Bacteria | 56414 |
| 71 | Ga0068863_100000020 | 3300005841 | Bacteria | 198519 |
| 72 | Ga0068863_100000082 | 3300005841 | Bacteria | 105688 |
| 73 | Ga0068863_100037980 | 3300005841 | Bacteria | 4583 |
| 74 | Ga0068860_100000938 | 3300005843 | Bacteria | 32302 |
| 75 | Ga0068860_100020798 | 3300005843 | Bacteria | 6357 |
| 76 | Ga0068860_100340126 | 3300005843 | Bacteria | 1475 |
| 77 | Ga0068862_100000236 | 3300005844 | Bacteria | 61275 |
| 78 | Ga0068862_100006902 | 3300005844 | Bacteria | 9417 |
| 79 | Ga0068862_100082933 | 3300005844 | Bacteria | 2783 |
| 80 | Ga0081455_10096438 | 3300005937 | Bacteria | 2385 |
| 81 | Ga0081538_10006545 | 3300005981 | Bacteria | 10232 |
| 82 | Ga0081539_10028290 | 3300005985 | Bacteria | 3527 |
| 83 | Ga0081539_10030495 | 3300005985 | Bacteria | 3345 |
| 84 | Ga0075363_100053180 | 3300006048 | Bacteria | 2163 |
| 85 | Ga0075364_10046119 | 3300006051 | Bacteria | 2838 |
| 86 | Ga0070712_100001870 | 3300006175 | Bacteria | 12848 |
| 87 | Ga0075366_10053062 | 3300006195 | Bacteria | 2408 |
| 88 | Ga0075370_10038326 | 3300006353 | Bacteria | 2697 |
| 89 | Ga0075431_100053550 | 3300006847 | Bacteria | 4160 |
| 90 | Ga0075434_100023686 | 3300006871 | Bacteria | 5988 |
| 91 | Ga0075436_100000720 | 3300006914 | Bacteria | 21898 |
| 92 | Ga0097620_100001286 | 3300006931 | Bacteria | 25622 |
| 93 | Ga0097620_100095232 | 3300006931 | Bacteria | 3030 |
| 94 | Ga0097620_100097478 | 3300006931 | Bacteria | 2994 |
| 95 | Ga0079104_1016760 | 3300006946 | Bacteria | 2130 |
| 96 | Ga0075435_100085091 | 3300007076 | Bacteria | 2603 |
| 97 | Ga0105240_10008009 | 3300009093 | Bacteria | 15218 |
| 98 | Ga0105240_10041127 | 3300009093 | Bacteria | 5903 |
| 99 | Ga0105245_10332201 | 3300009098 | Bacteria | 1501 |
| 100 | Ga0105243_10001261 | 3300009148 | Bacteria | 22743 |
| 101 | Ga0105243_10405953 | 3300009148 | Bacteria | 1267 |
| 102 | Ga0105241_10142009 | 3300009174 | Bacteria | 1956 |
| 103 | Ga0105241_10290044 | 3300009174 | Bacteria | 1401 |
| 104 | Ga0105242_10076982 | 3300009176 | Bacteria | 2782 |
| 105 | Ga0105242_10104991 | 3300009176 | Bacteria | 2399 |
| 106 | Ga0105248_10006088 | 3300009177 | Bacteria | 13234 |
| 107 | Ga0105237_10006681 | 3300009545 | Bacteria | 12750 |
| 108 | Ga0105237_10107412 | 3300009545 | Bacteria | 2783 |
| 109 | Ga0105237_10226951 | 3300009545 | Bacteria | 1868 |
| 110 | Ga0105238_10009161 | 3300009551 | Bacteria | 9910 |
| 111 | Ga0105238_10061150 | 3300009551 | Bacteria | 3770 |
| 112 | Ga0105238_10251117 | 3300009551 | Bacteria | 1747 |
| 113 | Ga0105238_10283925 | 3300009551 | Bacteria | 1637 |
| 114 | Ga0105249_10000244 | 3300009553 | Bacteria | 60263 |
| 115 | Ga0105249_10174218 | 3300009553 | Bacteria | 2088 |
| 116 | Ga0105249_10203480 | 3300009553 | Bacteria | 1939 |
| 117 | Ga0105249_10260745 | 3300009553 | Bacteria | 1722 |
| 118 | Ga0105249_10554028 | 3300009553 | Bacteria | 1201 |
| 119 | Ga0105239_10489347 | 3300010375 | Bacteria | 1398 |
| 120 | Ga0105239_10512436 | 3300010375 | Bacteria | 1364 |
| 121 | Ga0105246_10180109 | 3300011119 | Bacteria | 1626 |
| 122 | Ga0157373_10080111 | 3300013100 | Bacteria | 2303 |
| 123 | Ga0157371_10000747 | 3300013102 | Bacteria | 37686 |
| 124 | Ga0157370_10029166 | 3300013104 | Bacteria | 5420 |
| 125 | Ga0157370_10033946 | 3300013104 | Bacteria | 4971 |
| 126 | Ga0157369_10003048 | 3300013105 | Bacteria | 19997 |
| 127 | Ga0157369_10097410 | 3300013105 | Bacteria | 3138 |
| 128 | Ga0157374_10516300 | 3300013296 | Bacteria | 1200 |
| 129 | Ga0157378_10093529 | 3300013297 | Bacteria | 2737 |
| 130 | Ga0163162_10311615 | 3300013306 | Bacteria | 1706 |
| 131 | Ga0157372_10415613 | 3300013307 | Bacteria | 1567 |
| 132 | Ga0163163_10174107 | 3300014325 | Bacteria | 2199 |
| 133 | Ga0157377_10112319 | 3300014745 | Bacteria | 1639 |
| 134 | Ga0157379_10009377 | 3300014968 | Bacteria | 8529 |
| 135 | Ga0157379_10266459 | 3300014968 | Bacteria | 1557 |
| 136 | Ga0183363_1002 | 3300015690 | Bacteria | 425040 |
| 137 | Ga0206353_10967427 | 3300020082 | Bacteria | 2793 |
| 138 | Ga0213873_10000007 | 3300021358 | Bacteria | 309961 |
| 139 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 140 | Ga0213876_10077103 | 3300021384 | Bacteria | 1760 |
| 141 | Ga0213875_10002026 | 3300021388 | Bacteria | 12482 |
| 142 | Ga0209563_100105 | 3300025230 | Bacteria | 147936 |
| 143 | Ga0209563_101798 | 3300025230 | Bacteria | 5327 |
| 144 | Ga0207425_1000094 | 3300025245 | Bacteria | 85629 |
| 145 | Ga0207425_1004731 | 3300025245 | Bacteria | 4010 |
| 146 | Ga0209646_1014936 | 3300025246 | Bacteria | 1164 |
| 147 | Ga0209677_103597 | 3300025253 | Bacteria | 4915 |
| 148 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 149 | Ga0209148_1000238 | 3300025254 | Bacteria | 87836 |
| 150 | Ga0209129_1005757 | 3300025258 | Bacteria | 4249 |
| 151 | Ga0209233_1017719 | 3300025261 | Bacteria | 1933 |
| 152 | Ga0209565_1000011 | 3300025263 | Bacteria | 637062 |
| 153 | Ga0209565_1000149 | 3300025263 | Bacteria | 96195 |
| 154 | Ga0209565_1000386 | 3300025263 | Bacteria | 37364 |
| 155 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 156 | Ga0209673_1000902 | 3300025273 | Bacteria | 37959 |
| 157 | Ga0209673_1006361 | 3300025273 | Bacteria | 5716 |
| 158 | Ga0209675_1004628 | 3300025291 | Bacteria | 6048 |
| 159 | Ga0209675_1006535 | 3300025291 | Bacteria | 4653 |
| 160 | Ga0209676_1017478 | 3300025292 | Bacteria | 2537 |
| 161 | Ga0209025_1000727 | 3300025294 | Bacteria | 55857 |
| 162 | Ga0209564_1001341 | 3300025295 | Bacteria | 26209 |
| 163 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 164 | Ga0209758_1000023 | 3300025297 | Bacteria | 612453 |
| 165 | Ga0209758_1000108 | 3300025297 | Bacteria | 216541 |
| 166 | Ga0209758_1016139 | 3300025297 | Bacteria | 3810 |
| 167 | Ga0209050_1000342 | 3300025298 | Bacteria | 92644 |
| 168 | Ga0209050_1010036 | 3300025298 | Bacteria | 4732 |
| 169 | Ga0209050_1010379 | 3300025298 | Bacteria | 4599 |
| 170 | Ga0209256_1000016 | 3300025299 | Bacteria | 599092 |
| 171 | Ga0209256_1009780 | 3300025299 | Bacteria | 4134 |
| 172 | Ga0209051_1000226 | 3300025303 | Bacteria | 94990 |
| 173 | Ga0209257_1000112 | 3300025304 | Bacteria | 234058 |
| 174 | Ga0209257_1001798 | 3300025304 | Bacteria | 23555 |
| 175 | Ga0209257_1009856 | 3300025304 | Bacteria | 4991 |
| 176 | Ga0209257_1011330 | 3300025304 | Bacteria | 4312 |
| 177 | Ga0207656_10005244 | 3300025321 | Bacteria | 4566 |
| 178 | Ga0207682_10057987 | 3300025893 | Bacteria | 1615 |
| 179 | Ga0207682_10127503 | 3300025893 | Bacteria | 1134 |
| 180 | Ga0207680_10001557 | 3300025903 | Bacteria | 10806 |
| 181 | Ga0207699_10000517 | 3300025906 | Bacteria | 19151 |
| 182 | Ga0207645_10121881 | 3300025907 | Bacteria | 1693 |
| 183 | Ga0207705_10000076 | 3300025909 | Bacteria | 122975 |
| 184 | Ga0207705_10000319 | 3300025909 | Bacteria | 43949 |
| 185 | Ga0207654_10002561 | 3300025911 | Bacteria | 9226 |
| 186 | Ga0207707_10048443 | 3300025912 | Bacteria | 3701 |
| 187 | Ga0207707_10076984 | 3300025912 | Bacteria | 2911 |
| 188 | Ga0207695_10053961 | 3300025913 | Bacteria | 4201 |
| 189 | Ga0207695_10064201 | 3300025913 | Bacteria | 3782 |
| 190 | Ga0207695_10084164 | 3300025913 | Bacteria | 3212 |
| 191 | Ga0207671_10019101 | 3300025914 | Bacteria | 5249 |
| 192 | Ga0207671_10023877 | 3300025914 | Bacteria | 4606 |
| 193 | Ga0207671_10042102 | 3300025914 | Bacteria | 3381 |
| 194 | Ga0207693_10002910 | 3300025915 | Bacteria | 14823 |
| 195 | Ga0207693_10006853 | 3300025915 | Bacteria | 9407 |
| 196 | Ga0207663_10026639 | 3300025916 | Bacteria | 3359 |
| 197 | Ga0207660_10022300 | 3300025917 | Bacteria | 4266 |
| 198 | Ga0207657_10014944 | 3300025919 | Bacteria | 7544 |
| 199 | Ga0207657_10019727 | 3300025919 | Bacteria | 6392 |
| 200 | Ga0207657_10022464 | 3300025919 | Bacteria | 5900 |
| 201 | Ga0207657_10194415 | 3300025919 | Bacteria | 1635 |
| 202 | Ga0207649_10000220 | 3300025920 | Bacteria | 46886 |
| 203 | Ga0207649_10000986 | 3300025920 | Bacteria | 17615 |
| 204 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 205 | Ga0207652_10164725 | 3300025921 | Bacteria | 1988 |
| 206 | Ga0207681_10019658 | 3300025923 | Bacteria | 4271 |
| 207 | Ga0207681_10131888 | 3300025923 | Bacteria | 1849 |
| 208 | Ga0207694_10013789 | 3300025924 | Bacteria | 6093 |
| 209 | Ga0207694_10080383 | 3300025924 | Bacteria | 2558 |
| 210 | Ga0207694_10169538 | 3300025924 | Bacteria | 1767 |
| 211 | Ga0207650_10096664 | 3300025925 | Bacteria | 2266 |
| 212 | Ga0207659_10177354 | 3300025926 | Bacteria | 1685 |
| 213 | Ga0207700_10000972 | 3300025928 | Bacteria | 16548 |
| 214 | Ga0207644_10000025 | 3300025931 | Bacteria | 152401 |
| 215 | Ga0207690_10002620 | 3300025932 | Bacteria | 10835 |
| 216 | Ga0207706_10153778 | 3300025933 | Bacteria | 2023 |
| 217 | Ga0207686_10088543 | 3300025934 | Bacteria | 2038 |
| 218 | Ga0207709_10000039 | 3300025935 | Bacteria | 260127 |
| 219 | Ga0207669_10001720 | 3300025937 | Bacteria | 9284 |
| 220 | Ga0207669_10208516 | 3300025937 | Bacteria | 1424 |
| 221 | Ga0207665_10021654 | 3300025939 | Bacteria | 4228 |
| 222 | Ga0207711_10001387 | 3300025941 | Bacteria | 22798 |
| 223 | Ga0207667_10000006 | 3300025949 | Bacteria | 679876 |
| 224 | Ga0207667_10003097 | 3300025949 | Bacteria | 20583 |
| 225 | Ga0207667_10009399 | 3300025949 | Bacteria | 11521 |
| 226 | Ga0207712_10000149 | 3300025961 | Bacteria | 72521 |
| 227 | Ga0207712_10050590 | 3300025961 | Bacteria | 2902 |
| 228 | Ga0207712_10226873 | 3300025961 | Bacteria | 1497 |
| 229 | Ga0207668_10000085 | 3300025972 | Bacteria | 70401 |
| 230 | Ga0207668_10037414 | 3300025972 | Bacteria | 3247 |
| 231 | Ga0207640_10000413 | 3300025981 | Bacteria | 26988 |
| 232 | Ga0207658_10000022 | 3300025986 | Bacteria | 191235 |
| 233 | Ga0207658_10228821 | 3300025986 | Bacteria | 1568 |
| 234 | Ga0207639_10003109 | 3300026041 | Bacteria | 11160 |
| 235 | Ga0207639_10150567 | 3300026041 | Bacteria | 1948 |
| 236 | Ga0207639_10448921 | 3300026041 | Bacteria | 1170 |
| 237 | Ga0207702_10000182 | 3300026078 | Bacteria | 75732 |
| 238 | Ga0207702_10001450 | 3300026078 | Bacteria | 23586 |
| 239 | Ga0207702_10058805 | 3300026078 | Bacteria | 3272 |
| 240 | Ga0207702_10076340 | 3300026078 | Bacteria | 2896 |
| 241 | Ga0207702_10266123 | 3300026078 | Bacteria | 1616 |
| 242 | Ga0207702_10343908 | 3300026078 | Bacteria | 1425 |
| 243 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 244 | Ga0207641_10000139 | 3300026088 | Bacteria | 105740 |
| 245 | Ga0207641_10022466 | 3300026088 | Bacteria | 5192 |
| 246 | Ga0207674_10000003 | 3300026116 | Bacteria | 241674 |
| 247 | Ga0207674_10099388 | 3300026116 | Bacteria | 2892 |
| 248 | Ga0207675_100000122 | 3300026118 | Bacteria | 63834 |
| 249 | Ga0207675_100141489 | 3300026118 | Bacteria | 2286 |
| 250 | Ga0207698_10130092 | 3300026142 | Bacteria | 2149 |
| 251 | Ga0209974_10014028 | 3300027876 | Bacteria | 2670 |
| 252 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 253 | Ga0268266_10188781 | 3300028379 | Bacteria | 1880 |
| 254 | Ga0268265_10001866 | 3300028380 | Bacteria | 16787 |
| 255 | Ga0268265_10005820 | 3300028380 | Bacteria | 8407 |
| 256 | Ga0268265_10443654 | 3300028380 | Bacteria | 1210 |
| 257 | Ga0268264_10000910 | 3300028381 | Bacteria | 31062 |
| 258 | Ga0268264_10009537 | 3300028381 | Bacteria | 8041 |
| 259 | Ga0307517_10051484 | 3300028786 | Bacteria | 4155 |
| 260 | Ga0265325_10043397 | 3300031241 | Bacteria | 2346 |
| 261 | Ga0265340_10026611 | 3300031247 | Bacteria | 2922 |
| 262 | Ga0265340_10065942 | 3300031247 | Bacteria | 1723 |
| 263 | Ga0265339_10116732 | 3300031249 | Bacteria | 1376 |
| 264 | Ga0307513_10011050 | 3300031456 | Bacteria | 11260 |
| 265 | Ga0307408_100300628 | 3300031548 | Bacteria | 1344 |
| 266 | Ga0307408_100350870 | 3300031548 | Bacteria | 1252 |
| 267 | Ga0307408_100397567 | 3300031548 | Bacteria | 1182 |
| 268 | Ga0265313_10051589 | 3300031595 | Bacteria | 1968 |
| 269 | Ga0265313_10082963 | 3300031595 | Bacteria | 1452 |
| 270 | Ga0265314_10189594 | 3300031711 | Bacteria | 1225 |
| 271 | Ga0265342_10040124 | 3300031712 | Bacteria | 2840 |
| 272 | Ga0307405_10084921 | 3300031731 | Bacteria | 2079 |
| 273 | Ga0307410_10257052 | 3300031852 | Bacteria | 1360 |
| 274 | Ga0307410_10260920 | 3300031852 | Bacteria | 1351 |
| 275 | Ga0307410_10363074 | 3300031852 | Bacteria | 1160 |
| 276 | Ga0307406_10386076 | 3300031901 | Bacteria | 1105 |
| 277 | Ga0307412_10204884 | 3300031911 | Bacteria | 1501 |
| 278 | Ga0307416_100249772 | 3300032002 | Bacteria | 1725 |
| 279 | Ga0307416_100290420 | 3300032002 | Bacteria | 1618 |
| 280 | Ga0307411_10168733 | 3300032005 | Bacteria | 1648 |
| 281 | Ga0307411_10179724 | 3300032005 | Bacteria | 1604 |
| 282 | Ga0307411_10543514 | 3300032005 | Bacteria | 990 |
| 283 | Ga0307415_100227181 | 3300032126 | Bacteria | 1500 |
| 284 | Ga0316593_10012562 | 3300032168 | Bacteria | 2488 |
| 285 | Ga0307510_10032156 | 3300033180 | Bacteria | 5915 |
| 286 | Ga0373946_0154957 | 3300035171 | Bacteria | 1072 |
| 287 | Ga0373924_0129500 | 3300035410 | Bacteria | 1098 |
| 288 | Ga0373931_0087396 | 3300035691 | Bacteria | 1731 |
| 289 | Ga0373935_0032086 | 3300035692 | Bacteria | 3263 |
| 290 | Ga0373935_0131151 | 3300035692 | Bacteria | 1684 |
| 291 | Ga0373927_0118392 | 3300035695 | Bacteria | 1728 |
| 292 | Ga0373933_0032856 | 3300035724 | Bacteria | 3016 |
| 293 | Ga0373947_0143436 | 3300035725 | Bacteria | 1534 |
| 294 | Ga0373925_0095947 | 3300037068 | Bacteria | 2272 |
| 295 | Ga0373925_0129870 | 3300037068 | Bacteria | 1964 |
| 296 | Ga0395900_0001580 | 3300037418 | Bacteria | 26952 |
| 297 | Ga0395900_0370977 | 3300037418 | Bacteria | 1401 |
| 298 | Ga0395905_0000538 | 3300037471 | Bacteria | 51665 |
| 299 | Ga0436364_0333182 | 3300037853 | Bacteria | 2544 |
| 300 | Ga0436364_1265123 | 3300037853 | Bacteria | 88807 |
| 301 | Ga0395901_0001664 | 3300038443 | Bacteria | 22942 |
| 302 | Ga0400483_031499 | 3300039062 | Bacteria | 2030 |
| 303 | Ga0400483_119336 | 3300039062 | Bacteria | 3471 |
| 304 | Ga0400483_170323 | 3300039062 | Bacteria | 2427 |
| 305 | Ga0400483_201528 | 3300039062 | Bacteria | 1332 |
| 306 | Ga0400483_204155 | 3300039062 | Bacteria | 3571 |
| 307 | Ga0400483_252307 | 3300039062 | Bacteria | 1952 |
| 308 | Ga0400483_282374 | 3300039062 | Bacteria | 3368 |
| 309 | Ga0436365_0477684 | 3300039437 | Bacteria | 1613 |
| 310 | Ga0436365_1257511 | 3300039437 | Bacteria | 4106 |
| 311 | Ga0436365_1739626 | 3300039437 | Bacteria | 1932 |
| 312 | Ga0436363_0656603 | 3300039450 | Bacteria | 1026 |
| 313 | Ga0436363_1509974 | 3300039450 | Bacteria | 1039 |
| 314 | Ga0436362_0451893 | 3300039453 | Bacteria | 163419 |
| 315 | Ga0451802_1305520 | 3300041460 | Bacteria | 1564 |
| 316 | Ga0451806_696590 | 3300041462 | Bacteria | 2064 |
| 317 | Ga0451807_2598915 | 3300041486 | Bacteria | 1773 |
| 318 | Ga0451839_0640379 | 3300041496 | Bacteria | 1191 |
| 319 | Ga0439433_0037298 | 3300041999 | Bacteria | 1125 |
| 320 | Ga0466966_0014386 | 3300044684 | Bacteria | 5238 |
| 321 | Ga0466968_0126260 | 3300044735 | Bacteria | 1161 |
| 322 | Ga0466967_0098402 | 3300045976 | Bacteria | 2671 |
| 323 | Ga0495627_017065 | 3300046453 | Bacteria | 2475 |
| 324 | Ga0495603_0178135 | 3300046455 | Bacteria | 1230 |
| 325 | Ga0495629_0185012 | 3300046459 | Bacteria | 1443 |
| 326 | Ga0495638_0000880 | 3300046460 | Bacteria | 30953 |
| 327 | Ga0495638_0107971 | 3300046460 | Bacteria | 1656 |
| 328 | Ga0495650_0009791 | 3300046471 | Bacteria | 5417 |
| 329 | Ga0495650_0016554 | 3300046471 | Bacteria | 3731 |
| 330 | Ga0495584_0074913 | 3300046491 | Bacteria | 1701 |
| 331 | Ga0495583_0017427 | 3300046506 | Bacteria | 3813 |
| 332 | Ga0495583_0044038 | 3300046506 | Bacteria | 2074 |
| 333 | Ga0495583_0150050 | 3300046506 | Bacteria | 966 |
| 334 | Ga0495606_0010652 | 3300046507 | Bacteria | 7603 |
| 335 | Ga0495618_0038799 | 3300046514 | Bacteria | 2994 |
| 336 | Ga0495630_0182949 | 3300046517 | Bacteria | 1598 |
| 337 | Ga0495631_0017612 | 3300046518 | Bacteria | 3376 |
| 338 | Ga0495637_0020860 | 3300046520 | Bacteria | 3008 |
| 339 | Ga0495643_0010747 | 3300046522 | Bacteria | 5622 |
| 340 | Ga0495643_0068761 | 3300046522 | Bacteria | 1863 |
| 341 | Ga0495648_0000189 | 3300046524 | Bacteria | 70824 |
| 342 | Ga0495663_0027967 | 3300046525 | Bacteria | 1657 |
| 343 | Ga0495663_0100391 | 3300046525 | Bacteria | 952 |
| 344 | Ga0495652_0024549 | 3300046529 | Bacteria | 5335 |
| 345 | Ga0495586_0046653 | 3300046535 | Bacteria | 2336 |
| 346 | Ga0495587_0050347 | 3300046536 | Bacteria | 2464 |
| 347 | Ga0495597_0035459 | 3300046542 | Bacteria | 2250 |
| 348 | Ga0495633_0000547 | 3300046558 | Bacteria | 37231 |
| 349 | Ga0495668_0000181 | 3300046616 | Bacteria | 94147 |
| 350 | Ga0495634_0110315 | 3300046642 | Bacteria | 1769 |
| 351 | Ga0495625_0000069 | 3300046660 | Bacteria | 168800 |
| 352 | Ga0495625_0000312 | 3300046660 | Bacteria | 74208 |
| 353 | Ga0495625_0020815 | 3300046660 | Bacteria | 5058 |
| 354 | Ga0495661_0064542 | 3300046665 | Bacteria | 2160 |
| 355 | Ga0495661_0126449 | 3300046665 | Bacteria | 1406 |
| 356 | Ga0495657_0037118 | 3300046675 | Bacteria | 3361 |
| 357 | Ga0495599_0095460 | 3300046678 | Bacteria | 1855 |
| 358 | Ga0495669_0000179 | 3300046684 | Bacteria | 39746 |
| 359 | Ga0495670_0000037 | 3300046691 | Bacteria | 77395 |
| 360 | Ga0495670_0004999 | 3300046691 | Bacteria | 6519 |
| 361 | Ga0495649_0116620 | 3300046694 | Bacteria | 1413 |
| 362 | Ga0495600_0010218 | 3300046809 | Bacteria | 5818 |
| 363 | Ga0495660_0029133 | 3300046810 | Bacteria | 3117 |
| 364 | Ga0495604_0017212 | 3300047317 | Bacteria | 5783 |
| 365 | Ga0495683_0039227 | 3300047323 | Bacteria | 2394 |
| 366 | Ga0495687_001524 | 3300047443 | Bacteria | 21144 |
| 367 | Ga0495687_019736 | 3300047443 | Bacteria | 3298 |
| 368 | Ga0495687_096452 | 3300047443 | Bacteria | 1119 |
| 369 | Ga0495681_0031838 | 3300047470 | Bacteria | 2662 |
| 370 | Ga0495684_0163614 | 3300047471 | Bacteria | 1659 |
| 371 | Ga0495686_0000733 | 3300047472 | Bacteria | 43762 |
| 372 | Ga0495686_0086989 | 3300047472 | Bacteria | 1901 |
| 373 | Ga0495602_0180704 | 3300048088 | Bacteria | 1627 |
| 374 | Ga0495602_0318774 | 3300048088 | Bacteria | 1132 |
| 375 | Ga0495615_0001828 | 3300048090 | Bacteria | 3261 |
| 376 | Ga0496101_0144474 | 3300048904 | Bacteria | 1816 |
| 377 | Ga0496102_0020799 | 3300048905 | Bacteria | 5799 |
| 378 | Ga0496103_0009250 | 3300048906 | Bacteria | 5838 |
| 379 | Ga0496104_0020854 | 3300048907 | Bacteria | 6010 |
| 380 | Ga0496105_0016339 | 3300048908 | Bacteria | 5924 |
| 381 | Ga0496110_0059344 | 3300048913 | Bacteria | 3372 |
| 382 | Ga0496111_0211076 | 3300048914 | Bacteria | 1442 |
| 383 | Ga0496114_0254748 | 3300048917 | Bacteria | 1544 |
| 384 | Ga0496115_0023531 | 3300048918 | Bacteria | 4780 |
| 385 | Ga0496115_0122170 | 3300048918 | Bacteria | 2143 |
| 386 | Ga0496115_0134511 | 3300048918 | Bacteria | 2038 |
| 387 | Ga0496116_0050896 | 3300048919 | Bacteria | 2756 |
| 388 | Ga0496117_0017135 | 3300048920 | Bacteria | 6064 |
| 389 | Ga0496118_0002303 | 3300048921 | Bacteria | 25934 |
| 390 | Ga0496118_0138372 | 3300048921 | Bacteria | 1549 |
| 391 | Ga0496119_0000709 | 3300048922 | Bacteria | 44727 |
| 392 | Ga0496119_0006343 | 3300048922 | Bacteria | 11005 |
| 393 | Ga0496119_0099574 | 3300048922 | Bacteria | 1634 |
| 394 | Ga0496120_0066963 | 3300048923 | Bacteria | 1985 |
| 395 | Ga0496121_0028100 | 3300048924 | Bacteria | 5244 |
| 396 | Ga0496121_0042369 | 3300048924 | Bacteria | 3961 |
| 397 | Ga0496122_0002977 | 3300048925 | Bacteria | 23060 |
| 398 | Ga0496122_0027958 | 3300048925 | Bacteria | 4803 |
| 399 | Ga0496122_0028769 | 3300048925 | Bacteria | 4704 |
| 400 | Ga0496122_0036712 | 3300048925 | Bacteria | 3956 |
| 401 | Ga0496123_0001738 | 3300048926 | Bacteria | 28825 |
| 402 | Ga0496123_0006131 | 3300048926 | Bacteria | 11786 |
| 403 | Ga0496123_0016942 | 3300048926 | Bacteria | 5886 |
| 404 | Ga0496123_0081756 | 3300048926 | Bacteria | 1961 |
| 405 | Ga0496123_0184192 | 3300048926 | Bacteria | 1087 |
| 406 | Ga0496124_0000041 | 3300048927 | Bacteria | 303887 |
| 407 | Ga0496124_0132316 | 3300048927 | Bacteria | 1980 |
| 408 | Ga0496124_0144999 | 3300048927 | Bacteria | 1869 |
| 409 | Ga0496125_0091644 | 3300048928 | Bacteria | 2276 |
| 410 | Ga0496125_0093451 | 3300048928 | Bacteria | 2244 |
| 411 | Ga0496125_0135487 | 3300048928 | Bacteria | 1724 |
| 412 | Ga0496126_0023311 | 3300048929 | Bacteria | 5998 |
| 413 | Ga0496126_0315944 | 3300048929 | Bacteria | 1285 |
| 414 | Ga0495682_0032610 | 3300049460 | Bacteria | 1924 |
| 415 | Ga0501031_0026677 | 3300049568 | Bacteria | 3765 |
| 416 | Ga0501033_0044178 | 3300049570 | Bacteria | 3317 |
| 417 | Ga0501034_0168221 | 3300049571 | Bacteria | 2160 |
| 418 | Ga0501034_0228932 | 3300049571 | Bacteria | 1808 |
| 419 | Ga0501034_0275716 | 3300049571 | Bacteria | 1622 |
| 420 | Ga0501034_0287800 | 3300049571 | Bacteria | 1582 |
| 421 | Ga0501034_0308712 | 3300049571 | Bacteria | 1517 |
| 422 | Ga0501036_0018011 | 3300049572 | Bacteria | 5913 |
| 423 | Ga0501037_0052290 | 3300049573 | Bacteria | 2988 |
| 424 | Ga0501038_0000045 | 3300049574 | Bacteria | 106662 |
| 425 | Ga0501038_0115359 | 3300049574 | Bacteria | 2220 |
| 426 | Ga0501038_0488468 | 3300049574 | Bacteria | 943 |
| 427 | Ga0501039_0002298 | 3300049575 | Bacteria | 14183 |
| 428 | Ga0501040_0041762 | 3300049576 | Bacteria | 3124 |
| 429 | Ga0501040_0387449 | 3300049576 | Bacteria | 1003 |
| 430 | Ga0501041_0025595 | 3300049577 | Bacteria | 3546 |
| 431 | Ga0501042_0042874 | 3300049578 | Bacteria | 3221 |
| 432 | Ga0501043_0083200 | 3300049579 | Bacteria | 2516 |
| 433 | Ga0501046_0009232 | 3300049580 | Bacteria | 8538 |
| 434 | Ga0501047_0187626 | 3300049581 | Bacteria | 1932 |
| 435 | Ga0501047_0220089 | 3300049581 | Bacteria | 1755 |
| 436 | Ga0501047_0732207 | 3300049581 | Bacteria | 805 |
| 437 | Ga0501048_0012542 | 3300049582 | Bacteria | 6306 |
| 438 | Ga0501068_0020446 | 3300049584 | Bacteria | 3857 |
| 439 | Ga0501069_0161715 | 3300049585 | Bacteria | 1289 |
| 440 | Ga0501070_0086584 | 3300049586 | Bacteria | 2594 |
| 441 | Ga0501070_0401927 | 3300049586 | Bacteria | 1108 |
| 442 | Ga0501071_0003945 | 3300049587 | Bacteria | 9358 |
| 443 | Ga0501072_0012326 | 3300049588 | Bacteria | 6533 |
| 444 | Ga0501073_0068029 | 3300049589 | Bacteria | 2483 |
| 445 | Ga0501073_0116432 | 3300049589 | Bacteria | 1852 |
| 446 | Ga0501073_0118126 | 3300049589 | Bacteria | 1838 |
| 447 | Ga0501075_0033152 | 3300049591 | Bacteria | 3841 |
| 448 | Ga0501075_0150364 | 3300049591 | Bacteria | 1775 |
| 449 | Ga0501077_0004830 | 3300049593 | Bacteria | 8189 |
| 450 | Ga0501249_000467 | 3300049679 | Bacteria | 10062 |
| 451 | Ga0501079_0011483 | 3300049741 | Bacteria | 6760 |
| 452 | Ga0501080_0015858 | 3300049742 | Bacteria | 6951 |
| 453 | Ga0501080_0154983 | 3300049742 | Bacteria | 2116 |
| 454 | Ga0501081_0080531 | 3300049743 | Bacteria | 2279 |
| 455 | Ga0501083_0002667 | 3300049744 | Bacteria | 12290 |
| 456 | Ga0501083_0067310 | 3300049744 | Bacteria | 2385 |
| 457 | Ga0501241_013007 | 3300049758 | Bacteria | 1511 |
| 458 | Ga0501035_0091932 | 3300049822 | Bacteria | 2670 |
| 459 | Ga0501035_0127867 | 3300049822 | Bacteria | 2217 |
| 460 | Ga0501044_0113591 | 3300049823 | Bacteria | 2715 |
| 461 | Ga0501044_0377706 | 3300049823 | Bacteria | 1333 |
| 462 | Ga0501045_0005934 | 3300049824 | Bacteria | 8447 |
| 463 | nmdc:mga00v17_10584_c1 | 3300050491 | Bacteria | 5042 |
| 464 | nmdc:mga0k408_22257_c2 | 3300050493 | Bacteria | 2545 |
| 465 | nmdc:mga0k408_85039_c1 | 3300050493 | Bacteria | 1856 |
| 466 | nmdc:mga07m45_64995_c1 | 3300050496 | Bacteria | 2071 |
| 467 | nmdc:mga0qj67_103718_c1 | 3300050509 | Bacteria | 2294 |
| 468 | nmdc:mga0n895_61594_c1 | 3300050512 | Bacteria | 3705 |
| 469 | nmdc:mga08x19_65610_c1 | 3300050514 | Bacteria | 2358 |
| 470 | nmdc:mga08x19_89_c1 | 3300050514 | Bacteria | 82051 |
| 471 | nmdc:mga0sz30_43297_c1 | 3300050516 | Bacteria | 1895 |
| 472 | Ga0500610_0000436 | 3300053079 | Bacteria | 12880 |
| 473 | Ga0495619_0151904 | 3300053085 | Bacteria | 1597 |
| 474 | Ga0500643_000112 | 3300053087 | Bacteria | 84793 |
| 475 | Ga0500643_003022 | 3300053087 | Bacteria | 8318 |
| 476 | Ga0500643_014901 | 3300053087 | Bacteria | 2683 |
| 477 | Ga0500643_018918 | 3300053087 | Bacteria | 2277 |
| 478 | Ga0500566_0018190 | 3300053094 | Bacteria | 4128 |
| 479 | Ga0500566_0022608 | 3300053094 | Bacteria | 3694 |
| 480 | Ga0500566_0073865 | 3300053094 | Bacteria | 1910 |
| 481 | Ga0500556_0000077 | 3300053104 | Bacteria | 94403 |
| 482 | Ga0500556_0004003 | 3300053104 | Bacteria | 4248 |
| 483 | Ga0500592_003045 | 3300053116 | Bacteria | 2681 |
| 484 | Ga0500595_017878 | 3300053119 | Bacteria | 2605 |
| 485 | Ga0500595_027337 | 3300053119 | Bacteria | 1954 |
| 486 | Ga0500618_015818 | 3300053125 | Bacteria | 1899 |
| 487 | Ga0500621_087436 | 3300053126 | Bacteria | 1243 |
| 488 | Ga0500642_0014330 | 3300053130 | Bacteria | 2946 |
| 489 | Ga0500658_0007887 | 3300053134 | Bacteria | 3934 |
| 490 | Ga0500559_0022633 | 3300053136 | Bacteria | 2665 |
| 491 | Ga0500559_0064670 | 3300053136 | Bacteria | 1637 |
| 492 | Ga0500568_0059284 | 3300053139 | Bacteria | 1485 |
| 493 | Ga0500573_0007085 | 3300053140 | Bacteria | 6099 |
| 494 | Ga0500577_0055348 | 3300053142 | Bacteria | 1506 |
| 495 | Ga0500590_028920 | 3300053148 | Bacteria | 2875 |
| 496 | Ga0500616_0006367 | 3300053153 | Bacteria | 7746 |
| 497 | Ga0500616_0045815 | 3300053153 | Bacteria | 2328 |
| 498 | Ga0500622_0003668 | 3300053156 | Bacteria | 10088 |
| 499 | Ga0500624_000100 | 3300053157 | Bacteria | 41296 |
| 500 | Ga0500627_0050590 | 3300053158 | Bacteria | 1810 |
| 501 | Ga0500636_0006048 | 3300053177 | Bacteria | 6943 |
| 502 | Ga0500636_0064566 | 3300053177 | Bacteria | 2132 |
| 503 | Ga0500645_000132 | 3300053730 | Bacteria | 58716 |
| 504 | Ga0500645_008234 | 3300053730 | Bacteria | 3575 |
| 505 | Ga0500645_014763 | 3300053730 | Bacteria | 2485 |
| 506 | Ga0500596_007330 | 3300053735 | Bacteria | 1812 |
| 507 | Ga0500599_000339 | 3300053736 | Bacteria | 4628 |
| 508 | Ga0501084_0020696 | 3300054114 | Bacteria | 5487 |
| 509 | Ga0500661_004776 | 3300055283 | Bacteria | 2531 |
| 510 | Ga0587068_011041 | 3300059641 | Bacteria | 1356 |
| 511 | Ga0501082_0010226 | 3300060353 | Bacteria | 8078 |
| 512 | Ga0501082_0149490 | 3300060353 | Bacteria | 2028 |
| 513 | Ga0530510_0006210 | 3300061734 | Bacteria | 8306 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046517 | Ga0495630_0182949 | Ga0495630_0182949_834_1568 | 234 |
| 2 | 3300049581 | Ga0501047_0732207 | Ga0501047_0732207_58_795 | 243 |
| 3 | 3300048088 | Ga0495602_0180704 | Ga0495602_0180704_803_1612 | 250 |
| 4 | 3300053085 | Ga0495619_0151904 | Ga0495619_0151904_772_1581 | 250 |
| 5 | 3300028379 | Ga0268266_10188781 | Ga0268266_101887812 | 253 |
| 6 | 3300048921 | Ga0496118_0138372 | Ga0496118_0138372_12_887 | 253 |
| 7 | 3300021384 | Ga0213876_10077103 | Ga0213876_100771032 | 255 |
| 8 | 3300031595 | Ga0265313_10082963 | Ga0265313_100829631 | 255 |
| 9 | 3300031711 | Ga0265314_10189594 | Ga0265314_101895942 | 255 |
| 10 | 3300039437 | Ga0436365_0477684 | Ga0436365_0477684_530_1417 | 255 |
| 11 | 3300049589 | Ga0501073_0118126 | Ga0501073_0118126_88_969 | 258 |
| 12 | 3300032005 | Ga0307411_10543514 | Ga0307411_105435141 | 259 |
| 13 | 3300044735 | Ga0466968_0126260 | Ga0466968_0126260_48_926 | 259 |
| 14 | 3300005327 | Ga0070658_10278111 | Ga0070658_102781111 | 260 |
| 15 | 3300005455 | Ga0070663_100255079 | Ga0070663_1002550791 | 260 |
| 16 | 3300005539 | Ga0068853_100324676 | Ga0068853_1003246761 | 260 |
| 17 | 3300025919 | Ga0207657_10194415 | Ga0207657_101944151 | 260 |
| 18 | 3300025937 | Ga0207669_10208516 | Ga0207669_102085162 | 260 |
| 19 | 3300031548 | Ga0307408_100350870 | Ga0307408_1003508702 | 261 |
| 20 | 3300031911 | Ga0307412_10204884 | Ga0307412_102048842 | 261 |
| 21 | 3300025230 | Ga0209563_101798 | Ga0209563_1017985 | 262 |
| 22 | 3300031247 | Ga0265340_10065942 | Ga0265340_100659422 | 262 |
| 23 | 3300033180 | Ga0307510_10032156 | Ga0307510_100321565 | 262 |
| 24 | 3300046460 | Ga0495638_0000880 | Ga0495638_0000880_1022_1897 | 262 |
| 25 | 3300048924 | Ga0496121_0042369 | Ga0496121_0042369_2364_3239 | 262 |
| 26 | 3300053087 | Ga0500643_000112 | Ga0500643_000112_25805_26680 | 262 |
| 27 | 3300053094 | Ga0500566_0018190 | Ga0500566_0018190_1637_2512 | 262 |
| 28 | 3300053104 | Ga0500556_0004003 | Ga0500556_0004003_567_1442 | 262 |
| 29 | 3300053116 | Ga0500592_003045 | Ga0500592_003045_781_1656 | 262 |
| 30 | 3300053126 | Ga0500621_087436 | Ga0500621_087436_290_1165 | 262 |
| 31 | 3300053142 | Ga0500577_0055348 | Ga0500577_0055348_404_1279 | 262 |
| 32 | 3300053156 | Ga0500622_0003668 | Ga0500622_0003668_5451_6326 | 262 |
| 33 | 3300053158 | Ga0500627_0050590 | Ga0500627_0050590_382_1257 | 262 |
| 34 | 3300053736 | Ga0500599_000339 | Ga0500599_000339_330_1205 | 262 |
| 35 | 3300047443 | Ga0495687_096452 | Ga0495687_096452_175_1050 | 263 |
| 36 | iso_pu_bacteria | 8016557553 | 8016565814 | 263 |
| 37 | 3300009545 | Ga0105237_10226951 | Ga0105237_102269512 | 264 |
| 38 | 3300009551 | Ga0105238_10251117 | Ga0105238_102511172 | 264 |
| 39 | 3300010375 | Ga0105239_10489347 | Ga0105239_104893472 | 264 |
| 40 | 3300025914 | Ga0207671_10019101 | Ga0207671_100191012 | 264 |
| 41 | 3300026041 | Ga0207639_10448921 | Ga0207639_104489212 | 264 |
| 42 | 3300048088 | Ga0495602_0318774 | Ga0495602_0318774_309_1115 | 264 |
| 43 | 3300053125 | Ga0500618_015818 | Ga0500618_015818_600_1472 | 264 |
| 44 | 3300053148 | Ga0500590_028920 | Ga0500590_028920_1311_2183 | 264 |
| 45 | 3300035171 | Ga0373946_0154957 | Ga0373946_0154957_47_925 | 265 |
| 46 | 3300035692 | Ga0373935_0032086 | Ga0373935_0032086_606_1484 | 265 |
| 47 | 3300035724 | Ga0373933_0032856 | Ga0373933_0032856_441_1319 | 265 |
| 48 | 3300046514 | Ga0495618_0038799 | Ga0495618_0038799_1172_2050 | 265 |
| 49 | 3300046529 | Ga0495652_0024549 | Ga0495652_0024549_676_1554 | 265 |
| 50 | 3300046535 | Ga0495586_0046653 | Ga0495586_0046653_894_1772 | 265 |
| 51 | 3300046536 | Ga0495587_0050347 | Ga0495587_0050347_1501_2379 | 265 |
| 52 | 3300046642 | Ga0495634_0110315 | Ga0495634_0110315_256_1134 | 265 |
| 53 | 3300046675 | Ga0495657_0037118 | Ga0495657_0037118_1788_2666 | 265 |
| 54 | 3300046678 | Ga0495599_0095460 | Ga0495599_0095460_577_1455 | 265 |
| 55 | 3300047317 | Ga0495604_0017212 | Ga0495604_0017212_451_1329 | 265 |
| 56 | 3300005335 | Ga0070666_10185827 | Ga0070666_101858272 | 266 |
| 57 | 3300005347 | Ga0070668_100000479 | Ga0070668_10000047924 | 266 |
| 58 | 3300005353 | Ga0070669_100068932 | Ga0070669_1000689323 | 266 |
| 59 | 3300005367 | Ga0070667_100000024 | Ga0070667_100000024129 | 266 |
| 60 | 3300005841 | Ga0068863_100000082 | Ga0068863_10000008253 | 266 |
| 61 | 3300025304 | Ga0209257_1011330 | Ga0209257_10113304 | 266 |
| 62 | 3300025903 | Ga0207680_10001557 | Ga0207680_100015577 | 266 |
| 63 | 3300025923 | Ga0207681_10019658 | Ga0207681_100196582 | 266 |
| 64 | 3300025972 | Ga0207668_10037414 | Ga0207668_100374141 | 266 |
| 65 | 3300025986 | Ga0207658_10000022 | Ga0207658_1000002251 | 266 |
| 66 | 3300026078 | Ga0207702_10343908 | Ga0207702_103439082 | 266 |
| 67 | 3300026088 | Ga0207641_10000139 | Ga0207641_1000013951 | 266 |
| 68 | 3300041496 | Ga0451839_0640379 | Ga0451839_0640379_93_968 | 266 |
| 69 | 3300045976 | Ga0466967_0098402 | Ga0466967_0098402_1054_1929 | 266 |
| 70 | 3300046471 | Ga0495650_0016554 | Ga0495650_0016554_1826_2698 | 266 |
| 71 | 3300050516 | nmdc:mga0sz30_43297_c1 | nmdc:mga0sz30_43297_c1_422_1297 | 266 |
| 72 | 3300005937 | Ga0081455_10096438 | Ga0081455_100964382 | 267 |
| 73 | 3300048928 | Ga0496125_0091644 | Ga0496125_0091644_380_1249 | 267 |
| 74 | 3300053087 | Ga0500643_018918 | Ga0500643_018918_565_1434 | 267 |
| 75 | 3300053157 | Ga0500624_000100 | Ga0500624_000100_30932_31801 | 267 |
| 76 | 3300053177 | Ga0500636_0006048 | Ga0500636_0006048_1024_1893 | 267 |
| 77 | 3300010375 | Ga0105239_10512436 | Ga0105239_105124362 | 268 |
| 78 | 3300048929 | Ga0496126_0315944 | Ga0496126_0315944_218_1090 | 269 |
| 79 | 3300048090 | Ga0495615_0001828 | Ga0495615_0001828_1227_2102 | 270 |
| 80 | 3300048925 | Ga0496122_0027958 | Ga0496122_0027958_791_1666 | 270 |
| 81 | 3300048926 | Ga0496123_0006131 | Ga0496123_0006131_6659_7534 | 270 |
| 82 | 3300048927 | Ga0496124_0132316 | Ga0496124_0132316_536_1411 | 270 |
| 83 | 3300005341 | Ga0070691_10012537 | Ga0070691_100125374 | 272 |
| 84 | 3300005434 | Ga0070709_10151827 | Ga0070709_101518271 | 272 |
| 85 | 3300005436 | Ga0070713_100000121 | Ga0070713_10000012144 | 272 |
| 86 | 3300005518 | Ga0070699_100154609 | Ga0070699_1001546092 | 272 |
| 87 | 3300005539 | Ga0068853_100005255 | Ga0068853_1000052556 | 272 |
| 88 | 3300005545 | Ga0070695_100136548 | Ga0070695_1001365482 | 272 |
| 89 | 3300005563 | Ga0068855_100067127 | Ga0068855_1000671274 | 272 |
| 90 | 3300005577 | Ga0068857_100004014 | Ga0068857_10000401411 | 272 |
| 91 | 3300005614 | Ga0068856_100000497 | Ga0068856_10000049716 | 272 |
| 92 | 3300005614 | Ga0068856_100001104 | Ga0068856_10000110431 | 272 |
| 93 | 3300006175 | Ga0070712_100001870 | Ga0070712_1000018704 | 272 |
| 94 | 3300006871 | Ga0075434_100023686 | Ga0075434_1000236864 | 272 |
| 95 | 3300006914 | Ga0075436_100000720 | Ga0075436_10000072016 | 272 |
| 96 | 3300007076 | Ga0075435_100085091 | Ga0075435_1000850912 | 272 |
| 97 | 3300009093 | Ga0105240_10008009 | Ga0105240_1000800913 | 272 |
| 98 | 3300009098 | Ga0105245_10332201 | Ga0105245_103322011 | 272 |
| 99 | 3300009174 | Ga0105241_10142009 | Ga0105241_101420092 | 272 |
| 100 | 3300009545 | Ga0105237_10006681 | Ga0105237_100066812 | 272 |
| 101 | 3300009551 | Ga0105238_10009161 | Ga0105238_1000916112 | 272 |
| 102 | 3300013100 | Ga0157373_10080111 | Ga0157373_100801112 | 272 |
| 103 | 3300013104 | Ga0157370_10033946 | Ga0157370_100339466 | 272 |
| 104 | 3300013105 | Ga0157369_10003048 | Ga0157369_100030482 | 272 |
| 105 | 3300013307 | Ga0157372_10415613 | Ga0157372_104156131 | 272 |
| 106 | 3300014325 | Ga0163163_10174107 | Ga0163163_101741072 | 272 |
| 107 | 3300014968 | Ga0157379_10266459 | Ga0157379_102664592 | 272 |
| 108 | 3300025906 | Ga0207699_10000517 | Ga0207699_100005171 | 272 |
| 109 | 3300025913 | Ga0207695_10064201 | Ga0207695_100642012 | 272 |
| 110 | 3300025914 | Ga0207671_10023877 | Ga0207671_100238775 | 272 |
| 111 | 3300025915 | Ga0207693_10002910 | Ga0207693_1000291015 | 272 |
| 112 | 3300025924 | Ga0207694_10013789 | Ga0207694_100137892 | 272 |
| 113 | 3300025928 | Ga0207700_10000972 | Ga0207700_1000097211 | 272 |
| 114 | 3300025939 | Ga0207665_10021654 | Ga0207665_100216543 | 272 |
| 115 | 3300025949 | Ga0207667_10003097 | Ga0207667_1000309712 | 272 |
| 116 | 3300026078 | Ga0207702_10000182 | Ga0207702_100001828 | 272 |
| 117 | 3300026078 | Ga0207702_10001450 | Ga0207702_1000145023 | 272 |
| 118 | 3300026116 | Ga0207674_10000003 | Ga0207674_1000000386 | 272 |
| 119 | 3300035691 | Ga0373931_0087396 | Ga0373931_0087396_78_953 | 272 |
| 120 | 3300035692 | Ga0373935_0131151 | Ga0373935_0131151_191_1066 | 272 |
| 121 | 3300050512 | nmdc:mga0n895_61594_c1 | nmdc:mga0n895_61594_c1_471_1346 | 272 |
| 122 | 3300050514 | nmdc:mga08x19_65610_c1 | nmdc:mga08x19_65610_c1_655_1530 | 272 |
| 123 | 3300050514 | nmdc:mga08x19_89_c1 | nmdc:mga08x19_89_c1_70413_71288 | 272 |
| 124 | 3300049571 | Ga0501034_0275716 | Ga0501034_0275716_626_1522 | 273 |
| 125 | 3300053087 | Ga0500643_003022 | Ga0500643_003022_944_1816 | 273 |
| 126 | 3300053136 | Ga0500559_0022633 | Ga0500559_0022633_598_1470 | 273 |
| 127 | 3300055283 | Ga0500661_004776 | Ga0500661_004776_686_1558 | 273 |
| 128 | 3300005458 | Ga0070681_10223985 | Ga0070681_102239852 | 274 |
| 129 | 3300005530 | Ga0070679_100000019 | Ga0070679_10000001925 | 274 |
| 130 | 3300025912 | Ga0207707_10048443 | Ga0207707_100484434 | 274 |
| 131 | 3300025917 | Ga0207660_10022300 | Ga0207660_100223002 | 274 |
| 132 | 3300025921 | Ga0207652_10000004 | Ga0207652_10000004384 | 274 |
| 133 | 3300039062 | Ga0400483_170323 | Ga0400483_170323_840_1715 | 275 |
| 134 | 3300049571 | Ga0501034_0168221 | Ga0501034_0168221_912_1790 | 276 |
| 135 | 3300021358 | Ga0213873_10000007 | Ga0213873_10000007138 | 277 |
| 136 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005174 | 277 |
| 137 | 3300039437 | Ga0436365_1257511 | Ga0436365_1257511_2214_3101 | 277 |
| 138 | 3300039450 | Ga0436363_1509974 | Ga0436363_1509974_51_938 | 277 |
| 139 | 3300039453 | Ga0436362_0451893 | Ga0436362_0451893_129127_130014 | 277 |
| 140 | 3300048904 | Ga0496101_0144474 | Ga0496101_0144474_306_1190 | 277 |
| 141 | 3300049574 | Ga0501038_0000045 | Ga0501038_0000045_40259_41224 | 278 |
| 142 | 3300031247 | Ga0265340_10026611 | Ga0265340_100266112 | 279 |
| 143 | 3300031249 | Ga0265339_10116732 | Ga0265339_101167322 | 279 |
| 144 | 3300031712 | Ga0265342_10040124 | Ga0265342_100401242 | 279 |
| 145 | 3300025298 | Ga0209050_1010036 | Ga0209050_10100364 | 280 |
| 146 | 3300025304 | Ga0209257_1000112 | Ga0209257_1000112221 | 280 |
| 147 | 3300031852 | Ga0307410_10363074 | Ga0307410_103630742 | 280 |
| 148 | 3300032002 | Ga0307416_100290420 | Ga0307416_1002904202 | 280 |
| 149 | 3300032005 | Ga0307411_10168733 | Ga0307411_101687332 | 280 |
| 150 | 3300031241 | Ga0265325_10043397 | Ga0265325_100433972 | 282 |
| 151 | 3300039062 | Ga0400483_201528 | Ga0400483_201528_194_1078 | 282 |
| 152 | 3300046660 | Ga0495625_0000069 | Ga0495625_0000069_1106_1963 | 282 |
| 153 | 3300048918 | Ga0496115_0023531 | Ga0496115_0023531_2152_3009 | 282 |
| 154 | 3300048922 | Ga0496119_0006343 | Ga0496119_0006343_1722_2606 | 282 |
| 155 | 3300009553 | Ga0105249_10260745 | Ga0105249_102607451 | 284 |
| 156 | 3300035410 | Ga0373924_0129500 | Ga0373924_0129500_154_1023 | 284 |
| 157 | 3300035725 | Ga0373947_0143436 | Ga0373947_0143436_457_1326 | 284 |
| 158 | 3300047471 | Ga0495684_0163614 | Ga0495684_0163614_229_1098 | 284 |
| 159 | 3300053094 | Ga0500566_0073865 | Ga0500566_0073865_272_1132 | 284 |
| 160 | iso_pu_bacteria | 2510917020 | 2511125468 | 284 |
| 161 | iso_pu_bacteria | 2919679072 | 2919681939 | 284 |
| 162 | iso_pu_bacteria | 2935769743 | 2935774274 | 285 |
| 163 | 3300046460 | Ga0495638_0107971 | Ga0495638_0107971_138_1007 | 286 |
| 164 | 3300046691 | Ga0495670_0000037 | Ga0495670_0000037_7803_8693 | 286 |
| 165 | iso_pu_bacteria | 2508501128 | 2509152192 | 286 |
| 166 | iso_pu_bacteria | 2818991438 | 2819553029 | 286 |
| 167 | iso_pu_bacteria | 2885429604 | 2885430251 | 286 |
| 168 | 3300009148 | Ga0105243_10405953 | Ga0105243_104059532 | 287 |
| 169 | 3300053730 | Ga0500645_008234 | Ga0500645_008234_1750_2625 | 287 |
| 170 | iso_pu_bacteria | 2919450847 | 2919452702 | 287 |
| 171 | 3300003773 | Ga0055537_1007393 | Ga0055537_10073932 | 288 |
| 172 | 3300003775 | Ga0055524_1011023 | Ga0055524_10110233 | 288 |
| 173 | 3300003790 | Ga0055528_1002220 | Ga0055528_10022202 | 288 |
| 174 | 3300006195 | Ga0075366_10053062 | Ga0075366_100530622 | 288 |
| 175 | 3300025263 | Ga0209565_1000149 | Ga0209565_100014942 | 288 |
| 176 | 3300025273 | Ga0209673_1006361 | Ga0209673_10063618 | 288 |
| 177 | 3300025291 | Ga0209675_1006535 | Ga0209675_10065356 | 288 |
| 178 | 3300025299 | Ga0209256_1009780 | Ga0209256_10097803 | 288 |
| 179 | 3300032168 | Ga0316593_10012562 | Ga0316593_100125622 | 288 |
| 180 | 3300039437 | Ga0436365_1739626 | Ga0436365_1739626_388_1260 | 288 |
| 181 | 3300049823 | Ga0501044_0377706 | Ga0501044_0377706_94_963 | 288 |
| 182 | 3300050493 | nmdc:mga0k408_22257_c2 | nmdc:mga0k408_22257_c2_860_1735 | 288 |
| 183 | iso_pu_bacteria | 2840878972 | 2840880322 | 288 |
| 184 | iso_pu_bacteria | 2885427238 | 2885428637 | 288 |
| 185 | 3300005434 | Ga0070709_10347685 | Ga0070709_103476851 | 289 |
| 186 | 3300005439 | Ga0070711_100033560 | Ga0070711_1000335603 | 289 |
| 187 | 3300005549 | Ga0070704_100292766 | Ga0070704_1002927662 | 289 |
| 188 | 3300005617 | Ga0068859_100097479 | Ga0068859_1000974794 | 289 |
| 189 | 3300005843 | Ga0068860_100020798 | Ga0068860_1000207987 | 289 |
| 190 | 3300005844 | Ga0068862_100006902 | Ga0068862_1000069024 | 289 |
| 191 | 3300006931 | Ga0097620_100097478 | Ga0097620_1000974784 | 289 |
| 192 | 3300009176 | Ga0105242_10076982 | Ga0105242_100769822 | 289 |
| 193 | 3300009176 | Ga0105242_10104991 | Ga0105242_101049913 | 289 |
| 194 | 3300009551 | Ga0105238_10283925 | Ga0105238_102839253 | 289 |
| 195 | 3300009553 | Ga0105249_10174218 | Ga0105249_101742184 | 289 |
| 196 | 3300014968 | Ga0157379_10009377 | Ga0157379_100093775 | 289 |
| 197 | 3300025261 | Ga0209233_1017719 | Ga0209233_10177192 | 289 |
| 198 | 3300025915 | Ga0207693_10006853 | Ga0207693_1000685310 | 289 |
| 199 | 3300025916 | Ga0207663_10026639 | Ga0207663_100266392 | 289 |
| 200 | 3300025934 | Ga0207686_10088543 | Ga0207686_100885433 | 289 |
| 201 | 3300025961 | Ga0207712_10226873 | Ga0207712_102268732 | 289 |
| 202 | 3300028380 | Ga0268265_10005820 | Ga0268265_100058203 | 289 |
| 203 | 3300028380 | Ga0268265_10443654 | Ga0268265_104436542 | 289 |
| 204 | 3300028381 | Ga0268264_10009537 | Ga0268264_100095375 | 289 |
| 205 | 3300035695 | Ga0373927_0118392 | Ga0373927_0118392_526_1401 | 289 |
| 206 | 3300037068 | Ga0373925_0095947 | Ga0373925_0095947_1123_1998 | 289 |
| 207 | 3300037068 | Ga0373925_0129870 | Ga0373925_0129870_1067_1942 | 289 |
| 208 | 3300039062 | Ga0400483_031499 | Ga0400483_031499_570_1439 | 289 |
| 209 | 3300039062 | Ga0400483_119336 | Ga0400483_119336_265_1137 | 289 |
| 210 | 3300039062 | Ga0400483_204155 | Ga0400483_204155_474_1346 | 289 |
| 211 | 3300039062 | Ga0400483_252307 | Ga0400483_252307_108_980 | 289 |
| 212 | 3300039062 | Ga0400483_282374 | Ga0400483_282374_548_1417 | 289 |
| 213 | 3300047472 | Ga0495686_0000733 | Ga0495686_0000733_14266_15144 | 289 |
| 214 | 3300049742 | Ga0501080_0015858 | Ga0501080_0015858_4790_5668 | 289 |
| 215 | 3300049744 | Ga0501083_0002667 | Ga0501083_0002667_7092_7970 | 289 |
| 216 | 3300053119 | Ga0500595_027337 | Ga0500595_027337_695_1576 | 289 |
| 217 | 3300053140 | Ga0500573_0007085 | Ga0500573_0007085_4003_4881 | 289 |
| 218 | 3300060353 | Ga0501082_0149490 | Ga0501082_0149490_40_918 | 289 |
| 219 | 3300003762 | Ga0055542_1000040 | Ga0055542_1000040204 | 290 |
| 220 | 3300003762 | Ga0055542_1000609 | Ga0055542_100060911 | 290 |
| 221 | 3300003763 | Ga0055529_1000037 | Ga0055529_100003717 | 290 |
| 222 | 3300005329 | Ga0070683_100132035 | Ga0070683_1001320353 | 290 |
| 223 | 3300005333 | Ga0070677_10130476 | Ga0070677_101304761 | 290 |
| 224 | 3300005335 | Ga0070666_10186202 | Ga0070666_101862022 | 290 |
| 225 | 3300005354 | Ga0070675_100176998 | Ga0070675_1001769982 | 290 |
| 226 | 3300005356 | Ga0070674_100063196 | Ga0070674_1000631962 | 290 |
| 227 | 3300005366 | Ga0070659_100260581 | Ga0070659_1002605812 | 290 |
| 228 | 3300005456 | Ga0070678_100012561 | Ga0070678_1000125615 | 290 |
| 229 | 3300005564 | Ga0070664_100227872 | Ga0070664_1002278722 | 290 |
| 230 | 3300005617 | Ga0068859_100001286 | Ga0068859_10000128615 | 290 |
| 231 | 3300005719 | Ga0068861_100000046 | Ga0068861_10000004621 | 290 |
| 232 | 3300005841 | Ga0068863_100037980 | Ga0068863_1000379805 | 290 |
| 233 | 3300005843 | Ga0068860_100000938 | Ga0068860_10000093819 | 290 |
| 234 | 3300005844 | Ga0068862_100000236 | Ga0068862_10000023613 | 290 |
| 235 | 3300006353 | Ga0075370_10038326 | Ga0075370_100383263 | 290 |
| 236 | 3300006931 | Ga0097620_100001286 | Ga0097620_10000128615 | 290 |
| 237 | 3300009148 | Ga0105243_10001261 | Ga0105243_100012612 | 290 |
| 238 | 3300009174 | Ga0105241_10290044 | Ga0105241_102900442 | 290 |
| 239 | 3300009177 | Ga0105248_10006088 | Ga0105248_1000608814 | 290 |
| 240 | 3300009553 | Ga0105249_10000244 | Ga0105249_1000024414 | 290 |
| 241 | 3300009553 | Ga0105249_10554028 | Ga0105249_105540282 | 290 |
| 242 | 3300011119 | Ga0105246_10180109 | Ga0105246_101801092 | 290 |
| 243 | 3300013102 | Ga0157371_10000747 | Ga0157371_100007472 | 290 |
| 244 | 3300013296 | Ga0157374_10516300 | Ga0157374_105163001 | 290 |
| 245 | 3300013297 | Ga0157378_10093529 | Ga0157378_100935292 | 290 |
| 246 | 3300014745 | Ga0157377_10112319 | Ga0157377_101123192 | 290 |
| 247 | 3300025230 | Ga0209563_100105 | Ga0209563_10010599 | 290 |
| 248 | 3300025246 | Ga0209646_1014936 | Ga0209646_10149362 | 290 |
| 249 | 3300025253 | Ga0209677_103597 | Ga0209677_1035972 | 290 |
| 250 | 3300025254 | Ga0209148_1000011 | Ga0209148_10000111102 | 290 |
| 251 | 3300025272 | Ga0209455_1000006 | Ga0209455_100000690 | 290 |
| 252 | 3300025297 | Ga0209758_1000023 | Ga0209758_1000023493 | 290 |
| 253 | 3300025321 | Ga0207656_10005244 | Ga0207656_100052444 | 290 |
| 254 | 3300025893 | Ga0207682_10127503 | Ga0207682_101275031 | 290 |
| 255 | 3300025907 | Ga0207645_10121881 | Ga0207645_101218812 | 290 |
| 256 | 3300025909 | Ga0207705_10000319 | Ga0207705_1000031942 | 290 |
| 257 | 3300025911 | Ga0207654_10002561 | Ga0207654_100025618 | 290 |
| 258 | 3300025913 | Ga0207695_10053961 | Ga0207695_100539613 | 290 |
| 259 | 3300025914 | Ga0207671_10042102 | Ga0207671_100421022 | 290 |
| 260 | 3300025919 | Ga0207657_10022464 | Ga0207657_100224642 | 290 |
| 261 | 3300025920 | Ga0207649_10000986 | Ga0207649_1000098616 | 290 |
| 262 | 3300025924 | Ga0207694_10080383 | Ga0207694_100803832 | 290 |
| 263 | 3300025926 | Ga0207659_10177354 | Ga0207659_101773542 | 290 |
| 264 | 3300025932 | Ga0207690_10002620 | Ga0207690_1000262010 | 290 |
| 265 | 3300025933 | Ga0207706_10153778 | Ga0207706_101537782 | 290 |
| 266 | 3300025935 | Ga0207709_10000039 | Ga0207709_1000003991 | 290 |
| 267 | 3300025937 | Ga0207669_10001720 | Ga0207669_100017202 | 290 |
| 268 | 3300025941 | Ga0207711_10001387 | Ga0207711_1000138714 | 290 |
| 269 | 3300025949 | Ga0207667_10000006 | Ga0207667_10000006550 | 290 |
| 270 | 3300025961 | Ga0207712_10000149 | Ga0207712_1000014955 | 290 |
| 271 | 3300025981 | Ga0207640_10000413 | Ga0207640_100004137 | 290 |
| 272 | 3300025986 | Ga0207658_10228821 | Ga0207658_102288213 | 290 |
| 273 | 3300026041 | Ga0207639_10003109 | Ga0207639_1000310912 | 290 |
| 274 | 3300026078 | Ga0207702_10058805 | Ga0207702_100588052 | 290 |
| 275 | 3300026088 | Ga0207641_10022466 | Ga0207641_100224663 | 290 |
| 276 | 3300026118 | Ga0207675_100000122 | Ga0207675_10000012221 | 290 |
| 277 | 3300026142 | Ga0207698_10130092 | Ga0207698_101300922 | 290 |
| 278 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021089 | 290 |
| 279 | 3300028380 | Ga0268265_10001866 | Ga0268265_100018663 | 290 |
| 280 | 3300028381 | Ga0268264_10000910 | Ga0268264_100009103 | 290 |
| 281 | 3300031456 | Ga0307513_10011050 | Ga0307513_100110503 | 290 |
| 282 | 3300046455 | Ga0495603_0178135 | Ga0495603_0178135_326_1204 | 290 |
| 283 | 3300046459 | Ga0495629_0185012 | Ga0495629_0185012_111_992 | 290 |
| 284 | 3300046471 | Ga0495650_0009791 | Ga0495650_0009791_3276_4157 | 290 |
| 285 | 3300046491 | Ga0495584_0074913 | Ga0495584_0074913_467_1348 | 290 |
| 286 | 3300046506 | Ga0495583_0017427 | Ga0495583_0017427_1686_2567 | 290 |
| 287 | 3300046506 | Ga0495583_0044038 | Ga0495583_0044038_1153_2034 | 290 |
| 288 | 3300046506 | Ga0495583_0150050 | Ga0495583_0150050_59_940 | 290 |
| 289 | 3300046507 | Ga0495606_0010652 | Ga0495606_0010652_774_1655 | 290 |
| 290 | 3300046518 | Ga0495631_0017612 | Ga0495631_0017612_2310_3191 | 290 |
| 291 | 3300046520 | Ga0495637_0020860 | Ga0495637_0020860_367_1248 | 290 |
| 292 | 3300046522 | Ga0495643_0010747 | Ga0495643_0010747_1028_1909 | 290 |
| 293 | 3300046522 | Ga0495643_0068761 | Ga0495643_0068761_65_946 | 290 |
| 294 | 3300046524 | Ga0495648_0000189 | Ga0495648_0000189_61286_62167 | 290 |
| 295 | 3300046525 | Ga0495663_0027967 | Ga0495663_0027967_168_1049 | 290 |
| 296 | 3300046542 | Ga0495597_0035459 | Ga0495597_0035459_25_906 | 290 |
| 297 | 3300046558 | Ga0495633_0000547 | Ga0495633_0000547_35810_36691 | 290 |
| 298 | 3300046616 | Ga0495668_0000181 | Ga0495668_0000181_60709_61590 | 290 |
| 299 | 3300046660 | Ga0495625_0000312 | Ga0495625_0000312_34386_35267 | 290 |
| 300 | 3300046660 | Ga0495625_0020815 | Ga0495625_0020815_4160_5041 | 290 |
| 301 | 3300046665 | Ga0495661_0126449 | Ga0495661_0126449_190_1071 | 290 |
| 302 | 3300046684 | Ga0495669_0000179 | Ga0495669_0000179_35136_36017 | 290 |
| 303 | 3300046691 | Ga0495670_0004999 | Ga0495670_0004999_3963_4844 | 290 |
| 304 | 3300046694 | Ga0495649_0116620 | Ga0495649_0116620_340_1221 | 290 |
| 305 | 3300046809 | Ga0495600_0010218 | Ga0495600_0010218_1219_2103 | 290 |
| 306 | 3300046810 | Ga0495660_0029133 | Ga0495660_0029133_758_1639 | 290 |
| 307 | 3300047323 | Ga0495683_0039227 | Ga0495683_0039227_447_1328 | 290 |
| 308 | 3300047443 | Ga0495687_001524 | Ga0495687_001524_18951_19832 | 290 |
| 309 | 3300047443 | Ga0495687_019736 | Ga0495687_019736_1220_2101 | 290 |
| 310 | 3300047470 | Ga0495681_0031838 | Ga0495681_0031838_1346_2227 | 290 |
| 311 | 3300048905 | Ga0496102_0020799 | Ga0496102_0020799_3937_4818 | 290 |
| 312 | 3300048906 | Ga0496103_0009250 | Ga0496103_0009250_3889_4770 | 290 |
| 313 | 3300048907 | Ga0496104_0020854 | Ga0496104_0020854_3916_4797 | 290 |
| 314 | 3300048908 | Ga0496105_0016339 | Ga0496105_0016339_3981_4862 | 290 |
| 315 | 3300048913 | Ga0496110_0059344 | Ga0496110_0059344_1305_2186 | 290 |
| 316 | 3300048917 | Ga0496114_0254748 | Ga0496114_0254748_641_1522 | 290 |
| 317 | 3300048918 | Ga0496115_0122170 | Ga0496115_0122170_1180_2061 | 290 |
| 318 | 3300048919 | Ga0496116_0050896 | Ga0496116_0050896_920_1801 | 290 |
| 319 | 3300048920 | Ga0496117_0017135 | Ga0496117_0017135_3985_4866 | 290 |
| 320 | 3300048921 | Ga0496118_0002303 | Ga0496118_0002303_23876_24757 | 290 |
| 321 | 3300048922 | Ga0496119_0099574 | Ga0496119_0099574_31_912 | 290 |
| 322 | 3300048923 | Ga0496120_0066963 | Ga0496120_0066963_23_904 | 290 |
| 323 | 3300048925 | Ga0496122_0028769 | Ga0496122_0028769_38_919 | 290 |
| 324 | 3300048926 | Ga0496123_0081756 | Ga0496123_0081756_1053_1934 | 290 |
| 325 | 3300048927 | Ga0496124_0000041 | Ga0496124_0000041_197159_198040 | 290 |
| 326 | 3300048928 | Ga0496125_0093451 | Ga0496125_0093451_490_1371 | 290 |
| 327 | 3300048929 | Ga0496126_0023311 | Ga0496126_0023311_1271_2152 | 290 |
| 328 | 3300049460 | Ga0495682_0032610 | Ga0495682_0032610_545_1426 | 290 |
| 329 | 3300049574 | Ga0501038_0488468 | Ga0501038_0488468_26_904 | 290 |
| 330 | 3300050493 | nmdc:mga0k408_85039_c1 | nmdc:mga0k408_85039_c1_163_1044 | 290 |
| 331 | 3300050496 | nmdc:mga07m45_64995_c1 | nmdc:mga07m45_64995_c1_306_1193 | 290 |
| 332 | 3300053079 | Ga0500610_0000436 | Ga0500610_0000436_54_935 | 290 |
| 333 | 3300053119 | Ga0500595_017878 | Ga0500595_017878_532_1413 | 290 |
| 334 | 3300053130 | Ga0500642_0014330 | Ga0500642_0014330_863_1744 | 290 |
| 335 | 3300053177 | Ga0500636_0064566 | Ga0500636_0064566_187_1068 | 290 |
| 336 | 3300053730 | Ga0500645_000132 | Ga0500645_000132_26542_27423 | 290 |
| 337 | 3300053735 | Ga0500596_007330 | Ga0500596_007330_324_1205 | 290 |
| 338 | 3300003762 | Ga0055542_1005454 | Ga0055542_10054542 | 291 |
| 339 | 3300005327 | Ga0070658_10204652 | Ga0070658_102046522 | 291 |
| 340 | 3300005344 | Ga0070661_100216530 | Ga0070661_1002165302 | 291 |
| 341 | 3300005563 | Ga0068855_100372792 | Ga0068855_1003727921 | 291 |
| 342 | 3300005981 | Ga0081538_10006545 | Ga0081538_100065457 | 291 |
| 343 | 3300006048 | Ga0075363_100053180 | Ga0075363_1000531802 | 291 |
| 344 | 3300006051 | Ga0075364_10046119 | Ga0075364_100461192 | 291 |
| 345 | 3300009545 | Ga0105237_10107412 | Ga0105237_101074122 | 291 |
| 346 | 3300015690 | Ga0183363_1002 | Ga0183363_1002295 | 291 |
| 347 | 3300021388 | Ga0213875_10002026 | Ga0213875_100020263 | 291 |
| 348 | 3300025254 | Ga0209148_1000238 | Ga0209148_10002382 | 291 |
| 349 | 3300025909 | Ga0207705_10000076 | Ga0207705_1000007619 | 291 |
| 350 | 3300025923 | Ga0207681_10131888 | Ga0207681_101318882 | 291 |
| 351 | 3300026116 | Ga0207674_10099388 | Ga0207674_100993882 | 291 |
| 352 | 3300028786 | Ga0307517_10051484 | Ga0307517_100514842 | 291 |
| 353 | 3300031595 | Ga0265313_10051589 | Ga0265313_100515892 | 291 |
| 354 | 3300037418 | Ga0395900_0370977 | Ga0395900_0370977_402_1313 | 291 |
| 355 | 3300037853 | Ga0436364_0333182 | Ga0436364_0333182_1040_1921 | 291 |
| 356 | 3300037853 | Ga0436364_1265123 | Ga0436364_1265123_76113_76994 | 291 |
| 357 | 3300039450 | Ga0436363_0656603 | Ga0436363_0656603_49_936 | 291 |
| 358 | 3300041460 | Ga0451802_1305520 | Ga0451802_1305520_85_966 | 291 |
| 359 | 3300041462 | Ga0451806_696590 | Ga0451806_696590_683_1564 | 291 |
| 360 | 3300041486 | Ga0451807_2598915 | Ga0451807_2598915_413_1294 | 291 |
| 361 | 3300048914 | Ga0496111_0211076 | Ga0496111_0211076_528_1409 | 291 |
| 362 | 3300048922 | Ga0496119_0000709 | Ga0496119_0000709_32889_33770 | 291 |
| 363 | 3300048925 | Ga0496122_0002977 | Ga0496122_0002977_20252_21133 | 291 |
| 364 | 3300048925 | Ga0496122_0036712 | Ga0496122_0036712_856_1737 | 291 |
| 365 | 3300048926 | Ga0496123_0001738 | Ga0496123_0001738_23313_24194 | 291 |
| 366 | 3300048926 | Ga0496123_0016942 | Ga0496123_0016942_1124_2005 | 291 |
| 367 | 3300048927 | Ga0496124_0144999 | Ga0496124_0144999_866_1747 | 291 |
| 368 | 3300049568 | Ga0501031_0026677 | Ga0501031_0026677_2738_3619 | 291 |
| 369 | 3300049571 | Ga0501034_0228932 | Ga0501034_0228932_156_1037 | 291 |
| 370 | 3300049571 | Ga0501034_0287800 | Ga0501034_0287800_542_1423 | 291 |
| 371 | 3300049572 | Ga0501036_0018011 | Ga0501036_0018011_3078_3959 | 291 |
| 372 | 3300049574 | Ga0501038_0115359 | Ga0501038_0115359_1328_2209 | 291 |
| 373 | 3300049575 | Ga0501039_0002298 | Ga0501039_0002298_4227_5108 | 291 |
| 374 | 3300049576 | Ga0501040_0041762 | Ga0501040_0041762_1154_2035 | 291 |
| 375 | 3300049576 | Ga0501040_0387449 | Ga0501040_0387449_84_965 | 291 |
| 376 | 3300049577 | Ga0501041_0025595 | Ga0501041_0025595_2315_3196 | 291 |
| 377 | 3300049578 | Ga0501042_0042874 | Ga0501042_0042874_2326_3207 | 291 |
| 378 | 3300049579 | Ga0501043_0083200 | Ga0501043_0083200_770_1651 | 291 |
| 379 | 3300049580 | Ga0501046_0009232 | Ga0501046_0009232_6978_7859 | 291 |
| 380 | 3300049581 | Ga0501047_0220089 | Ga0501047_0220089_332_1213 | 291 |
| 381 | 3300049582 | Ga0501048_0012542 | Ga0501048_0012542_1127_2008 | 291 |
| 382 | 3300049584 | Ga0501068_0020446 | Ga0501068_0020446_2417_3298 | 291 |
| 383 | 3300049585 | Ga0501069_0161715 | Ga0501069_0161715_18_899 | 291 |
| 384 | 3300049586 | Ga0501070_0086584 | Ga0501070_0086584_879_1760 | 291 |
| 385 | 3300049587 | Ga0501071_0003945 | Ga0501071_0003945_2217_3098 | 291 |
| 386 | 3300049588 | Ga0501072_0012326 | Ga0501072_0012326_3484_4365 | 291 |
| 387 | 3300049589 | Ga0501073_0068029 | Ga0501073_0068029_551_1432 | 291 |
| 388 | 3300049589 | Ga0501073_0116432 | Ga0501073_0116432_405_1286 | 291 |
| 389 | 3300049591 | Ga0501075_0033152 | Ga0501075_0033152_2642_3523 | 291 |
| 390 | 3300049591 | Ga0501075_0150364 | Ga0501075_0150364_107_988 | 291 |
| 391 | 3300049593 | Ga0501077_0004830 | Ga0501077_0004830_6741_7622 | 291 |
| 392 | 3300049679 | Ga0501249_000467 | Ga0501249_000467_8327_9208 | 291 |
| 393 | 3300049741 | Ga0501079_0011483 | Ga0501079_0011483_3565_4446 | 291 |
| 394 | 3300049742 | Ga0501080_0154983 | Ga0501080_0154983_499_1380 | 291 |
| 395 | 3300049743 | Ga0501081_0080531 | Ga0501081_0080531_752_1633 | 291 |
| 396 | 3300049744 | Ga0501083_0067310 | Ga0501083_0067310_881_1762 | 291 |
| 397 | 3300049822 | Ga0501035_0127867 | Ga0501035_0127867_317_1198 | 291 |
| 398 | 3300049824 | Ga0501045_0005934 | Ga0501045_0005934_5230_6111 | 291 |
| 399 | 3300050491 | nmdc:mga00v17_10584_c1 | nmdc:mga00v17_10584_c1_3220_4107 | 291 |
| 400 | 3300053104 | Ga0500556_0000077 | Ga0500556_0000077_23419_24300 | 291 |
| 401 | 3300053136 | Ga0500559_0064670 | Ga0500559_0064670_323_1207 | 291 |
| 402 | 3300053153 | Ga0500616_0006367 | Ga0500616_0006367_5261_6142 | 291 |
| 403 | 3300053153 | Ga0500616_0045815 | Ga0500616_0045815_630_1511 | 291 |
| 404 | 3300053730 | Ga0500645_014763 | Ga0500645_014763_729_1610 | 291 |
| 405 | 3300054114 | Ga0501084_0020696 | Ga0501084_0020696_3569_4450 | 291 |
| 406 | 3300060353 | Ga0501082_0010226 | Ga0501082_0010226_4348_5229 | 291 |
| 407 | 3300061734 | Ga0530510_0006210 | Ga0530510_0006210_5289_6170 | 291 |
| 408 | 3300002774 | JGI25150J39212_1000349 | JGI25150J39212_100034923 | 292 |
| 409 | 3300003781 | Ga0055536_1014747 | Ga0055536_10147472 | 292 |
| 410 | 3300003792 | Ga0055540_1001501 | Ga0055540_10015019 | 292 |
| 411 | 3300005262 | Ga0065165_1017252 | Ga0065165_10172522 | 292 |
| 412 | 3300005327 | Ga0070658_10006404 | Ga0070658_100064046 | 292 |
| 413 | 3300005331 | Ga0070670_100034317 | Ga0070670_1000343173 | 292 |
| 414 | 3300005337 | Ga0070682_100126065 | Ga0070682_1001260652 | 292 |
| 415 | 3300005339 | Ga0070660_100234038 | Ga0070660_1002340382 | 292 |
| 416 | 3300005344 | Ga0070661_100000933 | Ga0070661_10000093317 | 292 |
| 417 | 3300005344 | Ga0070661_100095000 | Ga0070661_1000950002 | 292 |
| 418 | 3300005347 | Ga0070668_100000123 | Ga0070668_10000012325 | 292 |
| 419 | 3300005355 | Ga0070671_100124028 | Ga0070671_1001240282 | 292 |
| 420 | 3300005365 | Ga0070688_100167200 | Ga0070688_1001672002 | 292 |
| 421 | 3300005366 | Ga0070659_100080749 | Ga0070659_1000807492 | 292 |
| 422 | 3300005458 | Ga0070681_10104601 | Ga0070681_101046012 | 292 |
| 423 | 3300005617 | Ga0068859_100095238 | Ga0068859_1000952382 | 292 |
| 424 | 3300005841 | Ga0068863_100000020 | Ga0068863_10000002027 | 292 |
| 425 | 3300005843 | Ga0068860_100340126 | Ga0068860_1003401262 | 292 |
| 426 | 3300005844 | Ga0068862_100082933 | Ga0068862_1000829332 | 292 |
| 427 | 3300005985 | Ga0081539_10028290 | Ga0081539_100282902 | 292 |
| 428 | 3300005985 | Ga0081539_10030495 | Ga0081539_100304953 | 292 |
| 429 | 3300006931 | Ga0097620_100095232 | Ga0097620_1000952322 | 292 |
| 430 | 3300009093 | Ga0105240_10041127 | Ga0105240_100411272 | 292 |
| 431 | 3300009551 | Ga0105238_10061150 | Ga0105238_100611503 | 292 |
| 432 | 3300009553 | Ga0105249_10203480 | Ga0105249_102034802 | 292 |
| 433 | 3300013104 | Ga0157370_10029166 | Ga0157370_100291666 | 292 |
| 434 | 3300013105 | Ga0157369_10097410 | Ga0157369_100974102 | 292 |
| 435 | 3300013306 | Ga0163162_10311615 | Ga0163162_103116152 | 292 |
| 436 | 3300020082 | Ga0206353_10967427 | Ga0206353_109674271 | 292 |
| 437 | 3300025245 | Ga0207425_1000094 | Ga0207425_100009444 | 292 |
| 438 | 3300025258 | Ga0209129_1005757 | Ga0209129_10057572 | 292 |
| 439 | 3300025292 | Ga0209676_1017478 | Ga0209676_10174782 | 292 |
| 440 | 3300025294 | Ga0209025_1000727 | Ga0209025_100072713 | 292 |
| 441 | 3300025297 | Ga0209758_1000002 | Ga0209758_100000244 | 292 |
| 442 | 3300025297 | Ga0209758_1000108 | Ga0209758_1000108173 | 292 |
| 443 | 3300025298 | Ga0209050_1000342 | Ga0209050_100034246 | 292 |
| 444 | 3300025303 | Ga0209051_1000226 | Ga0209051_100022643 | 292 |
| 445 | 3300025304 | Ga0209257_1009856 | Ga0209257_10098565 | 292 |
| 446 | 3300025912 | Ga0207707_10076984 | Ga0207707_100769842 | 292 |
| 447 | 3300025913 | Ga0207695_10084164 | Ga0207695_100841642 | 292 |
| 448 | 3300025919 | Ga0207657_10014944 | Ga0207657_100149445 | 292 |
| 449 | 3300025919 | Ga0207657_10019727 | Ga0207657_100197275 | 292 |
| 450 | 3300025920 | Ga0207649_10000220 | Ga0207649_1000022026 | 292 |
| 451 | 3300025921 | Ga0207652_10164725 | Ga0207652_101647252 | 292 |
| 452 | 3300025924 | Ga0207694_10169538 | Ga0207694_101695382 | 292 |
| 453 | 3300025925 | Ga0207650_10096664 | Ga0207650_100966642 | 292 |
| 454 | 3300025931 | Ga0207644_10000025 | Ga0207644_100000258 | 292 |
| 455 | 3300025949 | Ga0207667_10009399 | Ga0207667_100093994 | 292 |
| 456 | 3300025961 | Ga0207712_10050590 | Ga0207712_100505902 | 292 |
| 457 | 3300025972 | Ga0207668_10000085 | Ga0207668_1000008519 | 292 |
| 458 | 3300026041 | Ga0207639_10150567 | Ga0207639_101505672 | 292 |
| 459 | 3300026078 | Ga0207702_10076340 | Ga0207702_100763402 | 292 |
| 460 | 3300026078 | Ga0207702_10266123 | Ga0207702_102661232 | 292 |
| 461 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001977 | 292 |
| 462 | 3300026118 | Ga0207675_100141489 | Ga0207675_1001414892 | 292 |
| 463 | 3300047472 | Ga0495686_0086989 | Ga0495686_0086989_923_1810 | 292 |
| 464 | 3300048918 | Ga0496115_0134511 | Ga0496115_0134511_218_1099 | 292 |
| 465 | 3300048924 | Ga0496121_0028100 | Ga0496121_0028100_2783_3718 | 292 |
| 466 | 3300048926 | Ga0496123_0184192 | Ga0496123_0184192_34_915 | 292 |
| 467 | 3300049570 | Ga0501033_0044178 | Ga0501033_0044178_941_1819 | 292 |
| 468 | 3300049571 | Ga0501034_0308712 | Ga0501034_0308712_603_1490 | 292 |
| 469 | 3300049573 | Ga0501037_0052290 | Ga0501037_0052290_1374_2252 | 292 |
| 470 | 3300049581 | Ga0501047_0187626 | Ga0501047_0187626_602_1480 | 292 |
| 471 | 3300049586 | Ga0501070_0401927 | Ga0501070_0401927_68_946 | 292 |
| 472 | 3300049822 | Ga0501035_0091932 | Ga0501035_0091932_291_1169 | 292 |
| 473 | 3300049823 | Ga0501044_0113591 | Ga0501044_0113591_602_1480 | 292 |
| 474 | 3300050509 | nmdc:mga0qj67_103718_c1 | nmdc:mga0qj67_103718_c1_415_1296 | 292 |
| 475 | 3300059641 | Ga0587068_011041 | Ga0587068_011041_15_899 | 292 |
| 476 | iso_pu_bacteria | 2643221622 | 2644128194 | 292 |
| 477 | 3300001904 | JGI24736J21556_1000147 | JGI24736J21556_10001472 | 293 |
| 478 | 3300003771 | Ga0055526_1002525 | Ga0055526_10025257 | 293 |
| 479 | 3300003773 | Ga0055537_1013825 | Ga0055537_10138252 | 293 |
| 480 | 3300005262 | Ga0065165_1022328 | Ga0065165_10223282 | 293 |
| 481 | 3300005353 | Ga0070669_100242406 | Ga0070669_1002424062 | 293 |
| 482 | 3300025263 | Ga0209565_1000386 | Ga0209565_10003863 | 293 |
| 483 | 3300025295 | Ga0209564_1001341 | Ga0209564_100134126 | 293 |
| 484 | 3300041999 | Ga0439433_0037298 | Ga0439433_0037298_195_1085 | 293 |
| 485 | 3300044684 | Ga0466966_0014386 | Ga0466966_0014386_1038_1922 | 293 |
| 486 | 3300048928 | Ga0496125_0135487 | Ga0496125_0135487_641_1528 | 293 |
| 487 | 3300006847 | Ga0075431_100053550 | Ga0075431_1000535502 | 294 |
| 488 | 3300025893 | Ga0207682_10057987 | Ga0207682_100579872 | 294 |
| 489 | 3300027876 | Ga0209974_10014028 | Ga0209974_100140281 | 294 |
| 490 | 3300031548 | Ga0307408_100300628 | Ga0307408_1003006282 | 294 |
| 491 | 3300031548 | Ga0307408_100397567 | Ga0307408_1003975672 | 294 |
| 492 | 3300031731 | Ga0307405_10084921 | Ga0307405_100849212 | 294 |
| 493 | 3300031852 | Ga0307410_10257052 | Ga0307410_102570521 | 294 |
| 494 | 3300031852 | Ga0307410_10260920 | Ga0307410_102609202 | 294 |
| 495 | 3300031901 | Ga0307406_10386076 | Ga0307406_103860761 | 294 |
| 496 | 3300032002 | Ga0307416_100249772 | Ga0307416_1002497722 | 294 |
| 497 | 3300032005 | Ga0307411_10179724 | Ga0307411_101797241 | 294 |
| 498 | 3300032126 | Ga0307415_100227181 | Ga0307415_1002271812 | 294 |
| 499 | 3300037418 | Ga0395900_0001580 | Ga0395900_0001580_7986_8873 | 294 |
| 500 | 3300037471 | Ga0395905_0000538 | Ga0395905_0000538_819_1706 | 294 |
| 501 | 3300038443 | Ga0395901_0001664 | Ga0395901_0001664_18673_19560 | 294 |
| 502 | 3300000652 | ARCol0yngRDRAFT_1002397 | ARCol0yngRDRAFT_10023972 | 296 |
| 503 | 3300003215 | JGI25153J46596_10014916 | JGI25153J46596_100149163 | 296 |
| 504 | 3300003773 | Ga0055537_1003425 | Ga0055537_10034254 | 296 |
| 505 | 3300003775 | Ga0055524_1000209 | Ga0055524_100020918 | 296 |
| 506 | 3300003794 | Ga0055531_10016667 | Ga0055531_100166673 | 296 |
| 507 | 3300005262 | Ga0065165_1008513 | Ga0065165_10085132 | 296 |
| 508 | 3300006946 | Ga0079104_1016760 | Ga0079104_10167602 | 296 |
| 509 | 3300025245 | Ga0207425_1004731 | Ga0207425_10047312 | 296 |
| 510 | 3300025263 | Ga0209565_1000011 | Ga0209565_1000011570 | 296 |
| 511 | 3300025273 | Ga0209673_1000902 | Ga0209673_100090210 | 296 |
| 512 | 3300025291 | Ga0209675_1004628 | Ga0209675_10046286 | 296 |
| 513 | 3300025297 | Ga0209758_1016139 | Ga0209758_10161392 | 296 |
| 514 | 3300025298 | Ga0209050_1010379 | Ga0209050_10103793 | 296 |
| 515 | 3300025299 | Ga0209256_1000016 | Ga0209256_100001630 | 296 |
| 516 | 3300025304 | Ga0209257_1001798 | Ga0209257_100179820 | 296 |
| 517 | 3300046453 | Ga0495627_017065 | Ga0495627_017065_1073_1963 | 296 |
| 518 | 3300046525 | Ga0495663_0100391 | Ga0495663_0100391_47_937 | 296 |
| 519 | 3300046665 | Ga0495661_0064542 | Ga0495661_0064542_1225_2115 | 296 |
| 520 | 3300049758 | Ga0501241_013007 | Ga0501241_013007_93_983 | 296 |
| 521 | 3300053087 | Ga0500643_014901 | Ga0500643_014901_578_1468 | 296 |
| 522 | 3300053094 | Ga0500566_0022608 | Ga0500566_0022608_1841_2731 | 296 |
| 523 | 3300053134 | Ga0500658_0007887 | Ga0500658_0007887_1620_2510 | 296 |
| 524 | 3300053139 | Ga0500568_0059284 | Ga0500568_0059284_324_1214 | 296 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tsf-assembly1.cif.gz_G | the pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase | 0.8971 | 2 | 296 |
| 4tsf-assembly1.cif.gz_G | the pathway of binding of the intrinsically disordered mitochondrial inhibitor protein to f1-atpase | 0.8929 | 2 | 296 |
| 5dn6-assembly1.cif.gz_G | atp synthase from paracoccus denitrificans | 0.8877 | 3 | 296 |
| 5dn6-assembly1.cif.gz_G | atp synthase from paracoccus denitrificans | 0.8845 | 3 | 296 |
| 6foc-assembly1.cif.gz_G | f1-atpase from mycobacterium smegmatis | 0.8836 | 3 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1KY89_89_218_3.40.1380.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.9092 | 75 | 197 | 3.40.1380.10 |
| 5dn6G02 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.8957 | 28 | 253 | 3.40.1380.10 |
| 5dn6G02 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.8826 | 28 | 253 | 3.40.1380.10 |
| af_A0A1D6QQB0_1_102_3.40.1380.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.8707 | 77 | 175 | 3.40.1380.10 |
| 3oaaG02 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit | 0.8671 | 75 | 197 | 3.40.1380.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E3C4P0-F1-model_v4 | ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) | 0.9391 | 1 | 296 |
GO:0005524
GO:0005886 GO:0042777 GO:0045261 GO:0046933 |
| AF-A0A2E3C4P0-F1-model_v4 | ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) | 0.936 | 1 | 296 |
GO:0005524
GO:0005886 GO:0042777 GO:0045261 GO:0046933 |
| AF-A0A355USC6-F1-model_v4 | ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) | 0.9356 | 1 | 296 |
GO:0005524
GO:0031676 GO:0045261 GO:0046933 |
| AF-A0A258XLR0-F1-model_v4 | ATP synthase F1 subunit gamma | 0.9333 | 1 | 251 |
GO:0045261
GO:0046933 |
| AF-A0A7C3K599-F1-model_v4 | ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) | 0.928 | 1 | 295 |
GO:0005524
GO:0005886 GO:0042777 GO:0045261 GO:0046933 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar