F458829

General Info

Members Datasets Scaffolds Average Seq Length
522 304 508 246

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100139331|Ga0075429_1001393312
Length 273
Sequence MICVAIAAQIIQDLAREGEKDGMDVSRVAIVTGAARGIGAATARRLAADGHAVAVVDLDESACGGTVSAVTEKGGRAMAVGADVADAAAVQAAVARVVDELGPPSILVNNAGVIRDNMLFKMTDDDWDTVLGVHLRGAFLMSRAAQGHMVEQKWGRIVNLSSTSALGNRGQANYAAAKAGMQGFTKTLAIELGPFGVTVNAVAPGFIVTDMTAATAARMGIDFEALQEANAGQIPVRRVGYPEDVANMIAFFASEGAGFVSGQVIYVAGGPRA

Samples

Sample ID Description Type Environment
1 2643221575 Microbacterium sp. Root61 Isolate Unclassified
2 2671180195 Frankia sp. CcI49 Isolate Nodule
3 2773857922 Frankia sp. CcI49 Isolate Nodule
4 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
5 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
6 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
7 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
8 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
9 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
10 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
11 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
12 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
13 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
300 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
304 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 1.15
Isolates 2.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 0.38
Rhizoplane 3.83
Rhizosphere 88.7
Stem 0
Stem Tuber 0
Unclassified 4.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10005246 3300003187 Bacteria 6720
2 JGI25406J46586_10024912 3300003203 Bacteria 2333
3 JGI25405J52794_10005897 3300003911 Bacteria 2225
4 Ga0070658_10004248 3300005327 Bacteria 11713
5 Ga0070683_100021139 3300005329 Bacteria 5803
6 Ga0070666_10004157 3300005335 Bacteria 8785
7 Ga0070682_100059039 3300005337 Bacteria 2421
8 Ga0068868_100032086 3300005338 Bacteria 4038
9 Ga0070691_10045027 3300005341 Bacteria 2093
10 Ga0070687_100227428 3300005343 Bacteria 1146
11 Ga0070661_100053821 3300005344 Bacteria 2947
12 Ga0070692_10096238 3300005345 Bacteria 1617
13 Ga0070692_10256230 3300005345 Bacteria 1050
14 Ga0070668_100001747 3300005347 Bacteria 15810
15 Ga0070668_100044234 3300005347 Bacteria 3416
16 Ga0070669_100441739 3300005353 Bacteria 1071
17 Ga0070675_100166962 3300005354 Bacteria 1896
18 Ga0070671_100000498 3300005355 Bacteria 27450
19 Ga0070671_100009736 3300005355 Bacteria 7720
20 Ga0070671_100079339 3300005355 Bacteria 2744
21 Ga0070671_100193113 3300005355 Bacteria 1726
22 Ga0070674_100108175 3300005356 Bacteria 2037
23 Ga0070674_100156144 3300005356 Bacteria 1727
24 Ga0070673_100088614 3300005364 Bacteria 2524
25 Ga0070688_100555673 3300005365 Bacteria 873
26 Ga0070659_100089378 3300005366 Bacteria 2467
27 Ga0070667_100046088 3300005367 Bacteria 3667
28 Ga0070709_10000692 3300005434 Bacteria 19142
29 Ga0070709_10055439 3300005434 Bacteria 2502
30 Ga0070714_100000056 3300005435 Bacteria 103178
31 Ga0070714_100000240 3300005435 Bacteria 42888
32 Ga0070714_100006173 3300005435 Bacteria 9215
33 Ga0070714_100006400 3300005435 Bacteria 9092
34 Ga0070714_100042917 3300005435 Bacteria 3822
35 Ga0070713_100002357 3300005436 Bacteria 12319
36 Ga0070713_100040792 3300005436 Bacteria 3776
37 Ga0070713_100146165 3300005436 Bacteria 2099
38 Ga0070713_100323889 3300005436 Bacteria 1424
39 Ga0070710_10014935 3300005437 Bacteria 3919
40 Ga0070701_10010110 3300005438 Bacteria 4161
41 Ga0070711_100011838 3300005439 Bacteria 5429
42 Ga0070711_100037486 3300005439 Bacteria 3253
43 Ga0070711_100061303 3300005439 Bacteria 2618
44 Ga0070705_100123258 3300005440 Bacteria 1677
45 Ga0070708_100003569 3300005445 Bacteria 12194
46 Ga0070708_100016516 3300005445 Bacteria 6128
47 Ga0070708_100290503 3300005445 Bacteria 1539
48 Ga0070663_100099124 3300005455 Bacteria 2172
49 Ga0070706_100020589 3300005467 Bacteria 6078
50 Ga0070706_100028491 3300005467 Bacteria 5142
51 Ga0070706_100030779 3300005467 Bacteria 4947
52 Ga0070706_100078615 3300005467 Bacteria 3054
53 Ga0070706_100084553 3300005467 Bacteria 2939
54 Ga0070706_100300616 3300005467 Bacteria 1497
55 Ga0070707_100000768 3300005468 Bacteria 31657
56 Ga0070707_100008535 3300005468 Bacteria 9521
57 Ga0070707_100023962 3300005468 Bacteria 5775
58 Ga0070707_100026773 3300005468 Bacteria 5478
59 Ga0070707_100408047 3300005468 Bacteria 1319
60 Ga0070698_100018026 3300005471 Bacteria 7433
61 Ga0070698_100025637 3300005471 Bacteria 6143
62 Ga0070698_100027156 3300005471 Bacteria 5954
63 Ga0070698_100066129 3300005471 Bacteria 3639
64 Ga0070698_100152447 3300005471 Bacteria 2258
65 Ga0070699_100002936 3300005518 Bacteria 15160
66 Ga0070699_100621077 3300005518 Bacteria 986
67 Ga0070684_100038005 3300005535 Bacteria 4133
68 Ga0070684_100090504 3300005535 Bacteria 2721
69 Ga0070697_100205539 3300005536 Bacteria 1675
70 Ga0070686_100088080 3300005544 Bacteria 2071
71 Ga0070686_100093333 3300005544 Bacteria 2018
72 Ga0070693_100059385 3300005547 Bacteria 2216
73 Ga0070665_100002148 3300005548 Bacteria 22010
74 Ga0070665_100037908 3300005548 Bacteria 4845
75 Ga0070665_100606366 3300005548 Bacteria 1108
76 Ga0070704_100010873 3300005549 Bacteria 5551
77 Ga0068855_100015416 3300005563 Bacteria 9200
78 Ga0068855_100190313 3300005563 Bacteria 2315
79 Ga0068855_100463993 3300005563 Bacteria 1381
80 Ga0068857_100208775 3300005577 Bacteria 1782
81 Ga0068857_100515698 3300005577 Bacteria 1123
82 Ga0068854_100055114 3300005578 Bacteria 2861
83 Ga0068856_100107985 3300005614 Bacteria 2779
84 Ga0068852_100012469 3300005616 Bacteria 6457
85 Ga0068852_100123643 3300005616 Bacteria 2373
86 Ga0068852_100290593 3300005616 Bacteria 1579
87 Ga0068864_100416941 3300005618 Bacteria 1279
88 Ga0068864_100606710 3300005618 Bacteria 1062
89 Ga0068863_100000501 3300005841 Bacteria 39833
90 Ga0068863_100002586 3300005841 Bacteria 17944
91 Ga0068863_100013136 3300005841 Bacteria 7992
92 Ga0068863_100045567 3300005841 Bacteria 4162
93 Ga0068863_100081509 3300005841 Bacteria 3065
94 Ga0068860_100000646 3300005843 Bacteria 40734
95 Ga0068860_100019344 3300005843 Bacteria 6606
96 Ga0068860_100179803 3300005843 Bacteria 2044
97 Ga0068862_100519762 3300005844 Bacteria 1132
98 Ga0081455_10000841 3300005937 Bacteria 39520
99 Ga0081455_10004212 3300005937 Bacteria 16212
100 Ga0081540_1012301 3300005983 Bacteria 5648
101 Ga0081539_10000996 3300005985 Bacteria 52520
102 Ga0070717_10065960 3300006028 Bacteria 3010
103 Ga0070717_10082191 3300006028 Bacteria 2706
104 Ga0070717_10101017 3300006028 Bacteria 2449
105 Ga0070717_10117291 3300006028 Bacteria 2277
106 Ga0070717_10403423 3300006028 Bacteria 1228
107 Ga0075365_10002985 3300006038 Bacteria 8560
108 Ga0075363_100138467 3300006048 Bacteria 1369
109 Ga0075363_100344163 3300006048 Bacteria 870
110 Ga0070715_10004596 3300006163 Bacteria 4548
111 Ga0070715_10214984 3300006163 Bacteria 985
112 Ga0070716_100001292 3300006173 Bacteria 11058
113 Ga0070716_100023106 3300006173 Bacteria 3293
114 Ga0070716_100232869 3300006173 Bacteria 1244
115 Ga0070712_100009541 3300006175 Bacteria 6120
116 Ga0070712_100111115 3300006175 Bacteria 2045
117 Ga0070712_100135269 3300006175 Bacteria 1873
118 Ga0075369_10022497 3300006186 Bacteria 2600
119 Ga0068871_100064852 3300006358 Bacteria 2991
120 Ga0075428_100000029 3300006844 Bacteria 119687
121 Ga0075428_100299287 3300006844 Bacteria 1729
122 Ga0075428_100693334 3300006844 Bacteria 1085
123 Ga0075430_100198882 3300006846 Bacteria 1665
124 Ga0075431_100021767 3300006847 Bacteria 6555
125 Ga0075433_10228002 3300006852 Bacteria 1655
126 Ga0075434_100108686 3300006871 Bacteria 2783
127 Ga0075434_100497475 3300006871 Bacteria 1240
128 Ga0075429_100139331 3300006880 Bacteria 2123
129 Ga0075429_100486991 3300006880 Bacteria 1081
130 Ga0068865_100154016 3300006881 Bacteria 1746
131 Ga0075436_100139233 3300006914 Bacteria 1705
132 Ga0075435_100062529 3300007076 Bacteria 3021
133 Ga0099794_10010974 3300007265 Bacteria 3867
134 Ga0105240_10381120 3300009093 Bacteria 1593
135 Ga0111539_10003178 3300009094 Bacteria 21747
136 Ga0111539_10737792 3300009094 Bacteria 1146
137 Ga0114129_10002921 3300009147 Bacteria 23900
138 Ga0114129_10447563 3300009147 Bacteria 1694
139 Ga0105243_10150510 3300009148 Bacteria 1996
140 Ga0105248_10220675 3300009177 Bacteria 2134
141 Ga0105237_10045775 3300009545 Bacteria 4402
142 Ga0105238_10051740 3300009551 Bacteria 4130
143 Ga0105249_10030861 3300009553 Bacteria 4845
144 Ga0105239_10025438 3300010375 Bacteria 6518
145 Ga0105246_10049877 3300011119 Bacteria 2868
146 Ga0157371_10117612 3300013102 Bacteria 1889
147 Ga0157370_10028398 3300013104 Bacteria 5502
148 Ga0157370_10084083 3300013104 Bacteria 2992
149 Ga0157369_10027806 3300013105 Bacteria 6265
150 Ga0157369_10112916 3300013105 Bacteria 2886
151 Ga0171462_1001 3300013250 Bacteria 1135406
152 Ga0157374_10023193 3300013296 Bacteria 5545
153 Ga0157378_10027461 3300013297 Bacteria 5023
154 Ga0157372_10038158 3300013307 Bacteria 5301
155 Ga0157372_10265972 3300013307 Bacteria 1991
156 Ga0157372_10769916 3300013307 Bacteria 1119
157 Ga0157375_10020231 3300013308 Bacteria 6076
158 Ga0157375_10343118 3300013308 Bacteria 1659
159 Ga0157375_10514704 3300013308 Bacteria 1360
160 Ga0163163_10186501 3300014325 Bacteria 2122
161 Ga0157380_10061612 3300014326 Bacteria 3003
162 Ga0157379_10061103 3300014968 Bacteria 3370
163 Ga0157376_10063952 3300014969 Bacteria 3101
164 Ga0163161_10002284 3300017792 Bacteria 13748
165 Ga0206356_11293914 3300020070 Bacteria 2800
166 Ga0206350_10035209 3300020080 Bacteria 3923
167 Ga0206353_10792024 3300020082 Bacteria 6928
168 Ga0213876_10015999 3300021384 Bacteria 3968
169 Ga0224712_10091129 3300022467 Bacteria 1277
170 Ga0209025_1000130 3300025294 Bacteria 198745
171 Ga0209025_1000568 3300025294 Bacteria 67279
172 Ga0209025_1017235 3300025294 Bacteria 4188
173 Ga0207653_10014954 3300025885 Bacteria 2435
174 Ga0207692_10000307 3300025898 Bacteria 16927
175 Ga0207692_10011141 3300025898 Bacteria 3812
176 Ga0207692_10026629 3300025898 Bacteria 2714
177 Ga0207688_10001404 3300025901 Bacteria 12557
178 Ga0207680_10016053 3300025903 Bacteria 3922
179 Ga0207680_10019513 3300025903 Bacteria 3627
180 Ga0207647_10056546 3300025904 Bacteria 2407
181 Ga0207699_10000349 3300025906 Bacteria 24578
182 Ga0207699_10008551 3300025906 Bacteria 5060
183 Ga0207705_10051163 3300025909 Bacteria 2974
184 Ga0207705_10167209 3300025909 Bacteria 1654
185 Ga0207684_10014085 3300025910 Bacteria 6906
186 Ga0207684_10019854 3300025910 Bacteria 5745
187 Ga0207684_10019961 3300025910 Bacteria 5726
188 Ga0207684_10145761 3300025910 Bacteria 2036
189 Ga0207684_10161606 3300025910 Bacteria 1929
190 Ga0207684_10278634 3300025910 Bacteria 1442
191 Ga0207707_10063159 3300025912 Bacteria 3223
192 Ga0207671_10224653 3300025914 Bacteria 1472
193 Ga0207693_10004496 3300025915 Bacteria 11797
194 Ga0207693_10005968 3300025915 Bacteria 10101
195 Ga0207693_10121363 3300025915 Bacteria 2053
196 Ga0207693_10453512 3300025915 Bacteria 1002
197 Ga0207663_10001100 3300025916 Bacteria 12435
198 Ga0207663_10032854 3300025916 Bacteria 3084
199 Ga0207663_10134269 3300025916 Bacteria 1715
200 Ga0207662_10245988 3300025918 Bacteria 1172
201 Ga0207657_10008499 3300025919 Bacteria 10413
202 Ga0207649_10078319 3300025920 Bacteria 2132
203 Ga0207652_10170071 3300025921 Bacteria 1955
204 Ga0207646_10000601 3300025922 Bacteria 46850
205 Ga0207646_10026466 3300025922 Bacteria 5291
206 Ga0207694_10561021 3300025924 Bacteria 959
207 Ga0207687_10035124 3300025927 Bacteria 3409
208 Ga0207700_10011715 3300025928 Bacteria 5609
209 Ga0207700_10022387 3300025928 Bacteria 4336
210 Ga0207700_10141949 3300025928 Bacteria 1974
211 Ga0207700_10282049 3300025928 Bacteria 1429
212 Ga0207700_10444202 3300025928 Bacteria 1142
213 Ga0207664_10000074 3300025929 Bacteria 102862
214 Ga0207664_10000717 3300025929 Bacteria 22557
215 Ga0207664_10000863 3300025929 Bacteria 20523
216 Ga0207664_10017064 3300025929 Bacteria 5310
217 Ga0207664_10154511 3300025929 Bacteria 1952
218 Ga0207664_10316994 3300025929 Bacteria 1375
219 Ga0207664_10352423 3300025929 Bacteria 1303
220 Ga0207644_10001999 3300025931 Bacteria 13205
221 Ga0207644_10009373 3300025931 Bacteria 6430
222 Ga0207644_10056319 3300025931 Bacteria 2837
223 Ga0207690_10114682 3300025932 Bacteria 1946
224 Ga0207690_10187986 3300025932 Bacteria 1560
225 Ga0207669_10133320 3300025937 Bacteria 1711
226 Ga0207669_10211509 3300025937 Bacteria 1416
227 Ga0207704_10020641 3300025938 Bacteria 3490
228 Ga0207665_10000258 3300025939 Bacteria 36742
229 Ga0207665_10000803 3300025939 Bacteria 21254
230 Ga0207665_10003031 3300025939 Bacteria 11275
231 Ga0207665_10004683 3300025939 Bacteria 9091
232 Ga0207691_10067010 3300025940 Bacteria 3247
233 Ga0207689_10126330 3300025942 Bacteria 2104
234 Ga0207661_10051561 3300025944 Bacteria 3283
235 Ga0207661_10074400 3300025944 Bacteria 2784
236 Ga0207661_10321957 3300025944 Bacteria 1390
237 Ga0207667_10401799 3300025949 Bacteria 1395
238 Ga0207668_10020885 3300025972 Bacteria 4169
239 Ga0207668_10182820 3300025972 Bacteria 1655
240 Ga0207640_10144751 3300025981 Bacteria 1737
241 Ga0207658_10017027 3300025986 Bacteria 5004
242 Ga0207658_10017944 3300025986 Bacteria 4879
243 Ga0207678_10002457 3300026067 Bacteria 16829
244 Ga0207702_10323442 3300026078 Bacteria 1469
245 Ga0207641_10000904 3300026088 Bacteria 30808
246 Ga0207641_10002351 3300026088 Bacteria 17482
247 Ga0207641_10039586 3300026088 Bacteria 3943
248 Ga0207641_10135236 3300026088 Bacteria 2218
249 Ga0207641_10222893 3300026088 Bacteria 1749
250 Ga0207674_10053704 3300026116 Bacteria 4106
251 Ga0207683_10018392 3300026121 Bacteria 5962
252 Ga0207698_10002303 3300026142 Bacteria 11300
253 Ga0207698_10028472 3300026142 Bacteria 3983
254 Ga0209813_10039908 3300027866 Bacteria 1424
255 Ga0268266_10013102 3300028379 Bacteria 7150
256 Ga0268266_10050587 3300028379 Bacteria 3566
257 Ga0268266_10098360 3300028379 Bacteria 2574
258 Ga0268265_10272690 3300028380 Bacteria 1510
259 Ga0268264_10000530 3300028381 Bacteria 48308
260 Ga0268264_10016617 3300028381 Bacteria 6026
261 Ga0268264_10243663 3300028381 Bacteria 1666
262 Ga0307515_10266707 3300028794 Bacteria 1440
263 Ga0307515_10420049 3300028794 Bacteria 958
264 Ga0316182_1236056 3300030745 Bacteria 2987
265 Ga0307513_10000432 3300031456 Bacteria 60370
266 Ga0307408_100072873 3300031548 Bacteria 2544
267 Ga0307408_100180600 3300031548 Bacteria 1692
268 Ga0307408_100660579 3300031548 Bacteria 936
269 Ga0316576_10054200 3300031727 Bacteria 2924
270 Ga0316578_10025322 3300031728 Bacteria 3335
271 Ga0316578_10044218 3300031728 Bacteria 2590
272 Ga0307405_10003701 3300031731 Bacteria 7094
273 Ga0307413_10052452 3300031824 Bacteria 2463
274 Ga0307410_10018397 3300031852 Bacteria 4223
275 Ga0307406_10005073 3300031901 Bacteria 7182
276 Ga0307406_10250626 3300031901 Bacteria 1334
277 Ga0307407_10033456 3300031903 Bacteria 2805
278 Ga0307407_10489018 3300031903 Bacteria 900
279 Ga0307412_10100783 3300031911 Bacteria 2042
280 Ga0307409_100000573 3300031995 Bacteria 16007
281 Ga0307416_100000450 3300032002 Bacteria 21114
282 Ga0307416_100060510 3300032002 Bacteria 3085
283 Ga0307415_100000132 3300032126 Bacteria 32478
284 Ga0307415_100263002 3300032126 Bacteria 1409
285 Ga0316593_10080614 3300032168 Bacteria 1136
286 Ga0316592_1000418 3300033524 Bacteria 5762
287 Ga0373948_0010736 3300034817 Bacteria 1605
288 Ga0373938_0009494 3300034957 Bacteria 1764
289 Ga0373926_0000314 3300035083 Bacteria 12020
290 Ga0373934_0076820 3300035086 Bacteria 1339
291 Ga0373944_0000269 3300035089 Bacteria 11393
292 Ga0373949_0009399 3300035090 Bacteria 2143
293 Ga0373951_0112593 3300035091 Bacteria 734
294 Ga0373952_0014303 3300035092 Bacteria 1587
295 Ga0373923_0025015 3300035111 Bacteria 2362
296 Ga0373923_0062996 3300035111 Bacteria 1579
297 Ga0373923_0133937 3300035111 Bacteria 1116
298 Ga0373936_0000992 3300035113 Bacteria 10113
299 Ga0373936_0013468 3300035113 Bacteria 3120
300 Ga0373945_0003433 3300035116 Bacteria 4985
301 Ga0373953_0025836 3300035117 Bacteria 2246
302 Ga0373953_0026571 3300035117 Bacteria 2218
303 Ga0373954_0062735 3300035118 Bacteria 1756
304 Ga0373954_0242716 3300035118 Bacteria 886
305 Ga0373956_0028904 3300035119 Bacteria 2415
306 Ga0373957_0011493 3300035120 Bacteria 2956
307 Ga0373943_0005181 3300035170 Bacteria 5866
308 Ga0373946_0001018 3300035171 Bacteria 9610
309 Ga0373946_0131670 3300035171 Bacteria 1151
310 Ga0373946_0197336 3300035171 Bacteria 962
311 Ga0373955_0025082 3300035172 Bacteria 3058
312 Ga0316574_0004592 3300035398 Bacteria 7257
313 Ga0316574_0061411 3300035398 Bacteria 2360
314 Ga0373924_0015080 3300035410 Bacteria 2930
315 Ga0373924_0020237 3300035410 Bacteria 2584
316 Ga0373935_0001241 3300035692 Bacteria 14091
317 Ga0373935_0108010 3300035692 Bacteria 1843
318 Ga0373927_0002562 3300035695 Bacteria 13246
319 Ga0373933_0026878 3300035724 Bacteria 3309
320 Ga0373947_0000106 3300035725 Bacteria 41237
321 Ga0373937_0048560 3300036401 Bacteria 3885
322 Ga0373937_0077509 3300036401 Bacteria 3071
323 Ga0373937_0155421 3300036401 Bacteria 2144
324 Ga0316582_0300926 3300036647 Bacteria 1102
325 Ga0316584_0077707 3300036712 Bacteria 2486
326 Ga0316584_0125318 3300036712 Bacteria 1919
327 Ga0316584_0162603 3300036712 Bacteria 1658
328 Ga0373925_0132645 3300037068 Bacteria 1943
329 Ga0373925_0515147 3300037068 Bacteria 982
330 Ga0395900_0316139 3300037418 Bacteria 1543
331 Ga0395898_0041455 3300037466 Bacteria 4547
332 Ga0436364_0250876 3300037853 Bacteria 18187
333 Ga0436364_0822916 3300037853 Bacteria 3277
334 Ga0436364_1503097 3300037853 Bacteria 128553
335 Ga0395901_0005513 3300038443 Bacteria 12814
336 Ga0395901_0082149 3300038443 Bacteria 3366
337 Ga0436365_1913791 3300039437 Bacteria 42482
338 Ga0436363_0818886 3300039450 Bacteria 2628
339 Ga0436363_0880854 3300039450 Bacteria 2611
340 Ga0439465_0000371 3300041413 Bacteria 12872
341 Ga0451833_0831993 3300041491 Bacteria 2230
342 Ga0466969_0024302 3300044656 Bacteria 3116
343 Ga0466966_0049867 3300044684 Bacteria 2665
344 Ga0466966_0134599 3300044684 Bacteria 1512
345 Ga0466966_0151648 3300044684 Bacteria 1413
346 Ga0466966_0194011 3300044684 Bacteria 1230
347 Ga0466961_0002842 3300044693 Bacteria 10738
348 Ga0466961_0018949 3300044693 Bacteria 4429
349 Ga0466963_0016024 3300044694 Bacteria 4654
350 Ga0466963_0049710 3300044694 Bacteria 2774
351 Ga0466963_0050518 3300044694 Bacteria 2752
352 Ga0466971_0006578 3300044719 Bacteria 5051
353 Ga0466971_0104874 3300044719 Bacteria 1301
354 Ga0466971_0147341 3300044719 Bacteria 1098
355 Ga0466968_0015365 3300044735 Bacteria 3033
356 Ga0466970_0024295 3300044765 Bacteria 3168
357 Ga0466970_0136809 3300044765 Bacteria 1348
358 Ga0466957_0004732 3300044842 Bacteria 7622
359 Ga0466957_0026513 3300044842 Bacteria 3439
360 Ga0466957_0225729 3300044842 Bacteria 1238
361 Ga0466959_0081425 3300045049 Bacteria 2333
362 Ga0466959_0434970 3300045049 Bacteria 890
363 Ga0466958_0019050 3300045836 Bacteria 3991
364 Ga0466958_0082999 3300045836 Bacteria 1974
365 Ga0466958_0094209 3300045836 Bacteria 1855
366 Ga0466958_0434632 3300045836 Bacteria 849
367 Ga0466967_0096392 3300045976 Bacteria 2698
368 Ga0466967_0159057 3300045976 Bacteria 2119
369 Ga0466967_0185885 3300045976 Bacteria 1962
370 Ga0466967_0208099 3300045976 Bacteria 1855
371 Ga0466967_0384852 3300045976 Bacteria 1362
372 Ga0466967_0627178 3300045976 Bacteria 1062
373 Ga0495592_0035831 3300046454 Bacteria 3739
374 Ga0495592_0041064 3300046454 Bacteria 3468
375 Ga0495592_0312252 3300046454 Bacteria 1018
376 Ga0495603_0258340 3300046455 Bacteria 1003
377 Ga0495641_0072228 3300046461 Bacteria 1549
378 Ga0495653_0006148 3300046463 Bacteria 9846
379 Ga0495653_0054437 3300046463 Bacteria 3057
380 Ga0495653_0120550 3300046463 Bacteria 1870
381 Ga0495580_0145272 3300046472 Bacteria 1644
382 Ga0495582_0065496 3300046473 Bacteria 2007
383 Ga0495664_0000304 3300046477 Bacteria 23598
384 Ga0495584_0187193 3300046491 Bacteria 1052
385 Ga0495594_0029666 3300046499 Bacteria 2957
386 Ga0495594_0063339 3300046499 Bacteria 2049
387 Ga0495594_0290908 3300046499 Bacteria 931
388 Ga0495608_0000925 3300046511 Bacteria 20613
389 Ga0495608_0106143 3300046511 Bacteria 1808
390 Ga0495608_0189579 3300046511 Bacteria 1298
391 Ga0495608_0229088 3300046511 Bacteria 1164
392 Ga0495618_0158306 3300046514 Bacteria 1445
393 Ga0495628_0224067 3300046516 Bacteria 1411
394 Ga0495628_0387754 3300046516 Bacteria 1022
395 Ga0495630_0001904 3300046517 Bacteria 14538
396 Ga0495652_0058273 3300046529 Bacteria 3271
397 Ga0495652_0058633 3300046529 Bacteria 3259
398 Ga0495652_0111069 3300046529 Bacteria 2204
399 Ga0495665_0243817 3300046531 Bacteria 926
400 Ga0495640_0010091 3300046533 Bacteria 7321
401 Ga0495640_0017996 3300046533 Bacteria 5254
402 Ga0495587_0029901 3300046536 Bacteria 3305
403 Ga0495587_0037325 3300046536 Bacteria 2918
404 Ga0495645_0005825 3300046543 Bacteria 8503
405 Ga0495645_0097952 3300046543 Bacteria 2088
406 Ga0495645_0206185 3300046543 Bacteria 1330
407 Ga0495667_0008632 3300046559 Bacteria 6918
408 Ga0495667_0261987 3300046559 Bacteria 1099
409 Ga0495667_0515407 3300046559 Bacteria 748
410 Ga0495634_0044235 3300046642 Bacteria 3015
411 Ga0495635_0001326 3300046663 Bacteria 16482
412 Ga0495635_0128640 3300046663 Bacteria 1726
413 Ga0495657_0010315 3300046675 Bacteria 7036
414 Ga0495657_0018484 3300046675 Bacteria 5043
415 Ga0495657_0041699 3300046675 Bacteria 3139
416 Ga0495599_0072264 3300046678 Bacteria 2153
417 Ga0495599_0240289 3300046678 Bacteria 1104
418 Ga0495646_0118938 3300046680 Bacteria 1496
419 Ga0495646_0123939 3300046680 Bacteria 1460
420 Ga0495658_0305187 3300046683 Bacteria 1007
421 Ga0495613_0111288 3300046689 Bacteria 1973
422 Ga0495624_0002667 3300046690 Bacteria 13449
423 Ga0495624_0143929 3300046690 Bacteria 1459
424 Ga0495600_0045591 3300046809 Bacteria 2860
425 Ga0495581_0019100 3300047315 Bacteria 3978
426 Ga0495581_0192227 3300047315 Bacteria 1194
427 Ga0495604_0005509 3300047317 Bacteria 10037
428 Ga0495604_0225208 3300047317 Bacteria 1289
429 Ga0495674_0000107 3300047319 Bacteria 61460
430 Ga0495674_0006259 3300047319 Bacteria 11420
431 Ga0495674_0030746 3300047319 Bacteria 4880
432 Ga0495674_0438721 3300047319 Bacteria 1050
433 Ga0495674_0513480 3300047319 Bacteria 957
434 Ga0495676_0003116 3300047321 Bacteria 14997
435 Ga0495680_0004567 3300047322 Bacteria 13205
436 Ga0495680_0011133 3300047322 Bacteria 7987
437 Ga0495680_0038143 3300047322 Bacteria 3842
438 Ga0495675_0184697 3300047444 Bacteria 1275
439 Ga0495675_0294131 3300047444 Bacteria 966
440 Ga0495684_0016186 3300047471 Bacteria 5742
441 Ga0495684_0031051 3300047471 Bacteria 4101
442 Ga0495602_0071577 3300048088 Bacteria 2961
443 Ga0495602_0134855 3300048088 Bacteria 1963
444 Ga0495602_0404279 3300048088 Bacteria 973
445 Ga0496100_0498940 3300048903 Bacteria 937
446 Ga0496102_0000797 3300048905 Bacteria 30612
447 Ga0496102_0148079 3300048905 Bacteria 2204
448 Ga0496102_0183758 3300048905 Bacteria 1970
449 Ga0496103_0295643 3300048906 Bacteria 1042
450 Ga0496104_0080715 3300048907 Bacteria 3101
451 Ga0496104_0151970 3300048907 Bacteria 2222
452 Ga0496104_0422090 3300048907 Bacteria 1246
453 Ga0496105_0153451 3300048908 Bacteria 1892
454 Ga0496106_0063233 3300048909 Bacteria 2812
455 Ga0496107_0165330 3300048910 Bacteria 1640
456 Ga0496108_0034175 3300048911 Bacteria 4223
457 Ga0496109_0022666 3300048912 Bacteria 5562
458 Ga0496110_0175065 3300048913 Bacteria 1947
459 Ga0496110_0303752 3300048913 Bacteria 1453
460 Ga0496111_0036907 3300048914 Bacteria 3495
461 Ga0496111_0081194 3300048914 Bacteria 2367
462 Ga0496113_0011839 3300048916 Bacteria 5844
463 Ga0496114_0018317 3300048917 Bacteria 5662
464 Ga0496114_0075961 3300048917 Bacteria 2830
465 Ga0496120_0001756 3300048923 Bacteria 24523
466 Ga0496121_0090571 3300048924 Bacteria 2390
467 Ga0496126_0398198 3300048929 Bacteria 1117
468 Ga0501031_0111796 3300049568 Bacteria 1784
469 Ga0501037_0013100 3300049573 Bacteria 6115
470 Ga0501040_0113234 3300049576 Bacteria 1898
471 Ga0501042_0016517 3300049578 Bacteria 5068
472 Ga0501043_0011638 3300049579 Bacteria 6885
473 Ga0501047_0147482 3300049581 Bacteria 2229
474 Ga0501069_0099769 3300049585 Bacteria 1648
475 Ga0501070_0002470 3300049586 Bacteria 16196
476 Ga0501073_0036514 3300049589 Bacteria 3491
477 Ga0501076_0314724 3300049592 Bacteria 1284
478 Ga0501080_0000025 3300049742 Bacteria 89908
479 Ga0501081_0432664 3300049743 Bacteria 976
480 nmdc:mga0yw44_341758_c1 3300050492 Bacteria 1007
481 nmdc:mga05p37_262915_c1 3300050507 Bacteria 2064
482 nmdc:mga05p37_271257_c1 3300050507 Bacteria 2027
483 nmdc:mga05p37_69622_c1 3300050507 Bacteria 4328
484 nmdc:mga09592_412215_c1 3300050508 Bacteria 1167
485 nmdc:mga0qj67_403502_c1 3300050509 Bacteria 1103
486 nmdc:mga0qj67_544681_c1 3300050509 Bacteria 931
487 nmdc:mga06r32_12576_c1 3300050510 Bacteria 4902
488 nmdc:mga08y16_18438_c1 3300050511 Bacteria 7354
489 nmdc:mga0n895_443390_c1 3300050512 Bacteria 1311
490 nmdc:mga0n895_76772_c1 3300050512 Bacteria 3322
491 nmdc:mga0rr50_42642_c1 3300050513 Bacteria 3315
492 nmdc:mga08x19_86678_c1 3300050514 Bacteria 2062
493 nmdc:mga0a205_35477_c1 3300050515 Bacteria 4789
494 nmdc:mga0a205_687019_c1 3300050515 Bacteria 874
495 Ga0495601_0209208 3300053077 Bacteria 1274
496 Ga0495601_0419536 3300053077 Bacteria 867
497 Ga0495612_0075601 3300053078 Bacteria 1410
498 Ga0495595_0097878 3300053084 Bacteria 1413
499 Ga0495619_0054560 3300053085 Bacteria 2645
500 Ga0495619_0166904 3300053085 Bacteria 1522
501 Ga0500643_000883 3300053087 Bacteria 18990
502 Ga0500583_0072342 3300053092 Bacteria 1651
503 Ga0500573_0076832 3300053140 Bacteria 1900
504 Ga0500616_0001461 3300053153 Bacteria 22580
505 Ga0466962_0056259 3300061719 Bacteria 1879
506 Ga0466962_0146250 3300061719 Bacteria 1146
507 Ga0530510_0072300 3300061734 Bacteria 2503
508 Ga0530510_0135048 3300061734 Bacteria 1816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0159057 Ga0466967_0159057_388_1188 213
2 3300032002 Ga0307416_100060510 Ga0307416_1000605104 217
3 3300005337 Ga0070682_100059039 Ga0070682_1000590393 219
4 3300046499 Ga0495594_0290908 Ga0495594_0290908_235_897 219
5 3300009094 Ga0111539_10003178 Ga0111539_1000317820 221
6 3300010375 Ga0105239_10025438 Ga0105239_100254387 221
7 3300013308 Ga0157375_10514704 Ga0157375_105147042 221
8 3300050511 nmdc:mga08y16_18438_c1 nmdc:mga08y16_18438_c1_1473_2138 221
9 3300005435 Ga0070714_100000056 Ga0070714_10000005654 222
10 3300025929 Ga0207664_10000074 Ga0207664_1000007449 222
11 3300038443 Ga0395901_0082149 Ga0395901_0082149_1004_1765 222
12 3300047315 Ga0495581_0019100 Ga0495581_0019100_1057_1782 222
13 3300053092 Ga0500583_0072342 Ga0500583_0072342_957_1625 222
14 3300005355 Ga0070671_100009736 Ga0070671_1000097367 223
15 3300005544 Ga0070686_100088080 Ga0070686_1000880802 223
16 3300005841 Ga0068863_100002586 Ga0068863_1000025865 223
17 3300025931 Ga0207644_10009373 Ga0207644_100093735 223
18 3300025986 Ga0207658_10017027 Ga0207658_100170272 223
19 3300026088 Ga0207641_10000904 Ga0207641_1000090439 223
20 3300035091 Ga0373951_0112593 Ga0373951_0112593_11_682 223
21 3300035111 Ga0373923_0025015 Ga0373923_0025015_1664_2335 223
22 3300035111 Ga0373923_0062996 Ga0373923_0062996_541_1212 223
23 3300035119 Ga0373956_0028904 Ga0373956_0028904_1245_1916 223
24 3300035398 Ga0316574_0004592 Ga0316574_0004592_4605_5276 223
25 3300035724 Ga0373933_0026878 Ga0373933_0026878_2366_3037 223
26 3300036401 Ga0373937_0077509 Ga0373937_0077509_1939_2610 223
27 3300036712 Ga0316584_0077707 Ga0316584_0077707_366_1037 223
28 3300037853 Ga0436364_0250876 Ga0436364_0250876_3127_3798 223
29 3300045049 Ga0466959_0434970 Ga0466959_0434970_182_853 223
30 3300046454 Ga0495592_0041064 Ga0495592_0041064_2278_2949 223
31 3300046463 Ga0495653_0054437 Ga0495653_0054437_1459_2130 223
32 3300046473 Ga0495582_0065496 Ga0495582_0065496_1326_1997 223
33 3300046511 Ga0495608_0000925 Ga0495608_0000925_10781_11452 223
34 3300046511 Ga0495608_0189579 Ga0495608_0189579_570_1241 223
35 3300046533 Ga0495640_0017996 Ga0495640_0017996_2308_2979 223
36 3300046536 Ga0495587_0029901 Ga0495587_0029901_735_1406 223
37 3300046559 Ga0495667_0515407 Ga0495667_0515407_62_733 223
38 3300046675 Ga0495657_0041699 Ga0495657_0041699_2029_2700 223
39 3300046678 Ga0495599_0240289 Ga0495599_0240289_35_706 223
40 3300046680 Ga0495646_0123939 Ga0495646_0123939_127_798 223
41 3300046690 Ga0495624_0143929 Ga0495624_0143929_758_1429 223
42 3300046809 Ga0495600_0045591 Ga0495600_0045591_2132_2803 223
43 3300047317 Ga0495604_0005509 Ga0495604_0005509_4238_4909 223
44 3300047317 Ga0495604_0225208 Ga0495604_0225208_49_720 223
45 3300047322 Ga0495680_0004567 Ga0495680_0004567_8388_9059 223
46 3300047444 Ga0495675_0184697 Ga0495675_0184697_270_941 223
47 3300047471 Ga0495684_0016186 Ga0495684_0016186_4866_5537 223
48 3300048088 Ga0495602_0134855 Ga0495602_0134855_806_1477 223
49 3300050509 nmdc:mga0qj67_544681_c1 nmdc:mga0qj67_544681_c1_234_905 223
50 3300053084 Ga0495595_0097878 Ga0495595_0097878_30_701 223
51 3300053085 Ga0495619_0054560 Ga0495619_0054560_26_697 223
52 3300003203 JGI25406J46586_10024912 JGI25406J46586_100249124 224
53 3300005536 Ga0070697_100205539 Ga0070697_1002055391 224
54 3300005985 Ga0081539_10000996 Ga0081539_1000099654 224
55 3300041413 Ga0439465_0000371 Ga0439465_0000371_2448_3212 224
56 3300048914 Ga0496111_0081194 Ga0496111_0081194_1386_2162 225
57 3300005355 Ga0070671_100000498 Ga0070671_10000049816 227
58 3300005548 Ga0070665_100002148 Ga0070665_10000214819 227
59 3300005841 Ga0068863_100045567 Ga0068863_1000455674 227
60 3300005843 Ga0068860_100019344 Ga0068860_1000193442 227
61 3300025931 Ga0207644_10001999 Ga0207644_100019994 227
62 3300026088 Ga0207641_10222893 Ga0207641_102228932 227
63 3300028379 Ga0268266_10098360 Ga0268266_100983602 227
64 3300028381 Ga0268264_10016617 Ga0268264_100166176 227
65 3300045836 Ga0466958_0434632 Ga0466958_0434632_148_831 227
66 3300048907 Ga0496104_0080715 Ga0496104_0080715_273_1049 227
67 3300048908 Ga0496105_0153451 Ga0496105_0153451_1021_1797 227
68 3300048913 Ga0496110_0175065 Ga0496110_0175065_1026_1802 227
69 3300028794 Ga0307515_10420049 Ga0307515_104200491 228
70 3300006880 Ga0075429_100486991 Ga0075429_1004869912 229
71 3300050508 nmdc:mga09592_412215_c1 nmdc:mga09592_412215_c1_388_1140 229
72 3300046543 Ga0495645_0005825 Ga0495645_0005825_2694_3386 230
73 3300048917 Ga0496114_0075961 Ga0496114_0075961_1849_2541 230
74 3300048929 Ga0496126_0398198 Ga0496126_0398198_332_1096 230
75 3300050492 nmdc:mga0yw44_341758_c1 nmdc:mga0yw44_341758_c1_57_821 230
76 3300035398 Ga0316574_0061411 Ga0316574_0061411_40_798 231
77 3300044684 Ga0466966_0134599 Ga0466966_0134599_201_965 231
78 3300044694 Ga0466963_0016024 Ga0466963_0016024_2408_3172 231
79 3300044735 Ga0466968_0015365 Ga0466968_0015365_1298_2062 231
80 3300044765 Ga0466970_0136809 Ga0466970_0136809_356_1120 231
81 3300044842 Ga0466957_0225729 Ga0466957_0225729_13_777 231
82 3300045836 Ga0466958_0019050 Ga0466958_0019050_2650_3414 231
83 3300045976 Ga0466967_0208099 Ga0466967_0208099_80_844 231
84 3300048905 Ga0496102_0000797 Ga0496102_0000797_11799_12563 231
85 3300005356 Ga0070674_100108175 Ga0070674_1001081752 232
86 3300025916 Ga0207663_10134269 Ga0207663_101342691 232
87 3300025937 Ga0207669_10211509 Ga0207669_102115092 232
88 3300013308 Ga0157375_10020231 Ga0157375_100202313 234
89 3300031901 Ga0307406_10250626 Ga0307406_102506262 234
90 3300049573 Ga0501037_0013100 Ga0501037_0013100_2323_3075 234
91 3300049579 Ga0501043_0011638 Ga0501043_0011638_1660_2412 234
92 3300049585 Ga0501069_0099769 Ga0501069_0099769_366_1118 234
93 3300049586 Ga0501070_0002470 Ga0501070_0002470_8664_9416 234
94 3300049589 Ga0501073_0036514 Ga0501073_0036514_1995_2747 234
95 3300049742 Ga0501080_0000025 Ga0501080_0000025_7904_8656 234
96 3300053153 Ga0500616_0001461 Ga0500616_0001461_4283_5047 234
97 3300005548 Ga0070665_100037908 Ga0070665_1000379085 235
98 3300005618 Ga0068864_100606710 Ga0068864_1006067102 235
99 3300005841 Ga0068863_100013136 Ga0068863_1000131362 235
100 3300009147 Ga0114129_10002921 Ga0114129_1000292125 235
101 3300026088 Ga0207641_10039586 Ga0207641_100395863 235
102 3300028379 Ga0268266_10050587 Ga0268266_100505872 235
103 3300050507 nmdc:mga05p37_69622_c1 nmdc:mga05p37_69622_c1_1043_1801 235
104 3300006038 Ga0075365_10002985 Ga0075365_100029856 236
105 3300006186 Ga0075369_10022497 Ga0075369_100224973 236
106 3300027866 Ga0209813_10039908 Ga0209813_100399081 236
107 3300046499 Ga0495594_0063339 Ga0495594_0063339_132_890 236
108 3300048924 Ga0496121_0090571 Ga0496121_0090571_1066_1821 237
109 3300005467 Ga0070706_100030779 Ga0070706_1000307792 238
110 3300005471 Ga0070698_100025637 Ga0070698_1000256375 238
111 3300031456 Ga0307513_10000432 Ga0307513_1000043210 238
112 3300032126 Ga0307415_100263002 Ga0307415_1002630021 238
113 3300046472 Ga0495580_0145272 Ga0495580_0145272_248_1012 238
114 3300006852 Ga0075433_10228002 Ga0075433_102280023 239
115 3300013307 Ga0157372_10769916 Ga0157372_107699162 239
116 3300028794 Ga0307515_10266707 Ga0307515_102667072 239
117 3300044694 Ga0466963_0049710 Ga0466963_0049710_12_776 239
118 3300044694 Ga0466963_0050518 Ga0466963_0050518_437_1156 239
119 3300044719 Ga0466971_0104874 Ga0466971_0104874_169_888 239
120 3300044842 Ga0466957_0004732 Ga0466957_0004732_1823_2542 239
121 3300045836 Ga0466958_0094209 Ga0466958_0094209_516_1235 239
122 3300045976 Ga0466967_0185885 Ga0466967_0185885_887_1606 239
123 3300049568 Ga0501031_0111796 Ga0501031_0111796_358_1077 239
124 3300049576 Ga0501040_0113234 Ga0501040_0113234_83_802 239
125 3300049592 Ga0501076_0314724 Ga0501076_0314724_552_1271 239
126 3300049743 Ga0501081_0432664 Ga0501081_0432664_126_845 239
127 3300050515 nmdc:mga0a205_35477_c1 nmdc:mga0a205_35477_c1_1353_2072 239
128 3300061719 Ga0466962_0056259 Ga0466962_0056259_157_876 239
129 3300061734 Ga0530510_0135048 Ga0530510_0135048_280_999 239
130 3300031728 Ga0316578_10025322 Ga0316578_100253221 240
131 3300032168 Ga0316593_10080614 Ga0316593_100806142 240
132 3300033524 Ga0316592_1000418 Ga0316592_10004184 240
133 3300036647 Ga0316582_0300926 Ga0316582_0300926_84_824 240
134 3300044684 Ga0466966_0194011 Ga0466966_0194011_395_1159 240
135 3300046455 Ga0495603_0258340 Ga0495603_0258340_168_932 240
136 3300048907 Ga0496104_0151970 Ga0496104_0151970_352_1089 240
137 3300005438 Ga0070701_10010110 Ga0070701_100101103 241
138 3300036712 Ga0316584_0125318 Ga0316584_0125318_510_1253 241
139 3300031548 Ga0307408_100660579 Ga0307408_1006605792 242
140 3300045976 Ga0466967_0096392 Ga0466967_0096392_432_1196 242
141 3300048923 Ga0496120_0001756 Ga0496120_0001756_14408_15136 242
142 3300013105 Ga0157369_10112916 Ga0157369_101129163 243
143 3300014326 Ga0157380_10061612 Ga0157380_100616122 243
144 3300048903 Ga0496100_0498940 Ga0496100_0498940_18_752 243
145 3300048909 Ga0496106_0063233 Ga0496106_0063233_1991_2725 243
146 3300048910 Ga0496107_0165330 Ga0496107_0165330_889_1623 243
147 3300048911 Ga0496108_0034175 Ga0496108_0034175_1188_1922 243
148 3300048912 Ga0496109_0022666 Ga0496109_0022666_2418_3152 243
149 iso_pu_bacteria 2808606364 2808868924 243
150 3300037068 Ga0373925_0132645 Ga0373925_0132645_775_1536 244
151 3300048905 Ga0496102_0183758 Ga0496102_0183758_1013_1771 244
152 3300005335 Ga0070666_10004157 Ga0070666_100041575 245
153 3300005347 Ga0070668_100044234 Ga0070668_1000442342 245
154 3300005355 Ga0070671_100193113 Ga0070671_1001931132 245
155 3300005365 Ga0070688_100555673 Ga0070688_1005556731 245
156 3300005367 Ga0070667_100046088 Ga0070667_1000460881 245
157 3300005468 Ga0070707_100408047 Ga0070707_1004080472 245
158 3300005841 Ga0068863_100000501 Ga0068863_10000050118 245
159 3300005843 Ga0068860_100000646 Ga0068860_10000064632 245
160 3300025903 Ga0207680_10019513 Ga0207680_100195134 245
161 3300025972 Ga0207668_10182820 Ga0207668_101828202 245
162 3300025986 Ga0207658_10017944 Ga0207658_100179442 245
163 3300026088 Ga0207641_10002351 Ga0207641_100023518 245
164 3300028379 Ga0268266_10013102 Ga0268266_100131028 245
165 3300028381 Ga0268264_10000530 Ga0268264_1000053020 245
166 3300046461 Ga0495641_0072228 Ga0495641_0072228_743_1504 245
167 3300046543 Ga0495645_0206185 Ga0495645_0206185_498_1259 245
168 iso_pu_bacteria 2857733635 2857733788 245
169 3300025929 Ga0207664_10352423 Ga0207664_103524232 246
170 3300044656 Ga0466969_0024302 Ga0466969_0024302_58_822 246
171 3300053140 Ga0500573_0076832 Ga0500573_0076832_515_1255 246
172 iso_pu_bacteria 2842888712 2842891360 246
173 iso_pu_bacteria 2857710386 2857712256 246
174 iso_pu_bacteria 2857737099 2857737607 246
175 3300045976 Ga0466967_0384852 Ga0466967_0384852_576_1322 247
176 iso_pu_bacteria 2643221575 2643885418 247
177 iso_pu_bacteria 2775506925 2776371357 247
178 iso_pu_bacteria 2863067949 2863072129 247
179 iso_pu_bacteria 3001889506 3001891751 247
180 3300005436 Ga0070713_100323889 Ga0070713_1003238892 248
181 3300005548 Ga0070665_100606366 Ga0070665_1006063661 248
182 3300006173 Ga0070716_100232869 Ga0070716_1002328691 248
183 3300006175 Ga0070712_100111115 Ga0070712_1001111152 248
184 3300006844 Ga0075428_100000029 Ga0075428_10000002953 248
185 3300006846 Ga0075430_100198882 Ga0075430_1001988822 248
186 3300006847 Ga0075431_100021767 Ga0075431_1000217672 248
187 3300025928 Ga0207700_10282049 Ga0207700_102820492 248
188 3300031727 Ga0316576_10054200 Ga0316576_100542002 248
189 3300031728 Ga0316578_10044218 Ga0316578_100442184 248
190 3300036712 Ga0316584_0162603 Ga0316584_0162603_513_1259 248
191 3300050509 nmdc:mga0qj67_403502_c1 nmdc:mga0qj67_403502_c1_138_884 248
192 3300050510 nmdc:mga06r32_12576_c1 nmdc:mga06r32_12576_c1_1831_2577 248
193 iso_pu_bacteria 2671180195 2671839839 248
194 iso_pu_bacteria 2773857922 2774857995 248
195 iso_pu_bacteria 2910809715 2910814688 248
196 3300005844 Ga0068862_100519762 Ga0068862_1005197621 249
197 3300006844 Ga0075428_100299287 Ga0075428_1002992871 249
198 3300006871 Ga0075434_100497475 Ga0075434_1004974752 249
199 3300013250 Ga0171462_1001 Ga0171462_1001525 249
200 3300025944 Ga0207661_10321957 Ga0207661_103219572 249
201 3300028380 Ga0268265_10272690 Ga0268265_102726902 249
202 3300035117 Ga0373953_0026571 Ga0373953_0026571_959_1708 249
203 3300036401 Ga0373937_0155421 Ga0373937_0155421_730_1479 249
204 3300037418 Ga0395900_0316139 Ga0395900_0316139_101_865 249
205 3300044684 Ga0466966_0151648 Ga0466966_0151648_604_1365 249
206 3300044693 Ga0466961_0018949 Ga0466961_0018949_3383_4144 249
207 3300050512 nmdc:mga0n895_443390_c1 nmdc:mga0n895_443390_c1_102_851 249
208 3300053085 Ga0495619_0166904 Ga0495619_0166904_194_943 249
209 iso_pu_bacteria 2990088156 2990088935 249
210 iso_pu_bacteria 8057632132 8057634352 249
211 3300005327 Ga0070658_10004248 Ga0070658_100042488 250
212 3300005345 Ga0070692_10096238 Ga0070692_100962382 250
213 3300005434 Ga0070709_10000692 Ga0070709_100006922 250
214 3300005434 Ga0070709_10055439 Ga0070709_100554393 250
215 3300005435 Ga0070714_100000240 Ga0070714_10000024030 250
216 3300005435 Ga0070714_100006173 Ga0070714_1000061734 250
217 3300005435 Ga0070714_100042917 Ga0070714_1000429173 250
218 3300005436 Ga0070713_100002357 Ga0070713_1000023575 250
219 3300005436 Ga0070713_100040792 Ga0070713_1000407923 250
220 3300005436 Ga0070713_100146165 Ga0070713_1001461651 250
221 3300005439 Ga0070711_100011838 Ga0070711_1000118383 250
222 3300005439 Ga0070711_100061303 Ga0070711_1000613033 250
223 3300005445 Ga0070708_100016516 Ga0070708_1000165162 250
224 3300005467 Ga0070706_100020589 Ga0070706_1000205891 250
225 3300005467 Ga0070706_100078615 Ga0070706_1000786153 250
226 3300005467 Ga0070706_100084553 Ga0070706_1000845533 250
227 3300005467 Ga0070706_100300616 Ga0070706_1003006162 250
228 3300005468 Ga0070707_100008535 Ga0070707_1000085354 250
229 3300005468 Ga0070707_100023962 Ga0070707_1000239624 250
230 3300005468 Ga0070707_100026773 Ga0070707_1000267732 250
231 3300005471 Ga0070698_100027156 Ga0070698_1000271563 250
232 3300005471 Ga0070698_100066129 Ga0070698_1000661292 250
233 3300005518 Ga0070699_100621077 Ga0070699_1006210771 250
234 3300005535 Ga0070684_100038005 Ga0070684_1000380054 250
235 3300005563 Ga0068855_100190313 Ga0068855_1001903133 250
236 3300005577 Ga0068857_100208775 Ga0068857_1002087752 250
237 3300005618 Ga0068864_100416941 Ga0068864_1004169412 250
238 3300006028 Ga0070717_10065960 Ga0070717_100659602 250
239 3300006028 Ga0070717_10117291 Ga0070717_101172912 250
240 3300006028 Ga0070717_10403423 Ga0070717_104034232 250
241 3300006048 Ga0075363_100138467 Ga0075363_1001384672 250
242 3300006163 Ga0070715_10004596 Ga0070715_100045963 250
243 3300006173 Ga0070716_100001292 Ga0070716_10000129213 250
244 3300006173 Ga0070716_100023106 Ga0070716_1000231063 250
245 3300006175 Ga0070712_100009541 Ga0070712_1000095412 250
246 3300007265 Ga0099794_10010974 Ga0099794_100109743 250
247 3300013105 Ga0157369_10027806 Ga0157369_100278063 250
248 3300013307 Ga0157372_10265972 Ga0157372_102659721 250
249 3300020070 Ga0206356_11293914 Ga0206356_112939142 250
250 3300020082 Ga0206353_10792024 Ga0206353_107920243 250
251 3300025898 Ga0207692_10000307 Ga0207692_1000030712 250
252 3300025898 Ga0207692_10011141 Ga0207692_100111413 250
253 3300025906 Ga0207699_10000349 Ga0207699_1000034913 250
254 3300025906 Ga0207699_10008551 Ga0207699_100085513 250
255 3300025909 Ga0207705_10051163 Ga0207705_100511634 250
256 3300025910 Ga0207684_10014085 Ga0207684_100140856 250
257 3300025910 Ga0207684_10019961 Ga0207684_100199615 250
258 3300025910 Ga0207684_10145761 Ga0207684_101457612 250
259 3300025910 Ga0207684_10161606 Ga0207684_101616062 250
260 3300025910 Ga0207684_10278634 Ga0207684_102786342 250
261 3300025912 Ga0207707_10063159 Ga0207707_100631593 250
262 3300025915 Ga0207693_10004496 Ga0207693_100044964 250
263 3300025915 Ga0207693_10453512 Ga0207693_104535122 250
264 3300025916 Ga0207663_10001100 Ga0207663_100011002 250
265 3300025916 Ga0207663_10032854 Ga0207663_100328543 250
266 3300025921 Ga0207652_10170071 Ga0207652_101700712 250
267 3300025922 Ga0207646_10026466 Ga0207646_100264665 250
268 3300025928 Ga0207700_10011715 Ga0207700_100117152 250
269 3300025928 Ga0207700_10022387 Ga0207700_100223873 250
270 3300025928 Ga0207700_10444202 Ga0207700_104442022 250
271 3300025929 Ga0207664_10000717 Ga0207664_1000071715 250
272 3300025929 Ga0207664_10000863 Ga0207664_1000086315 250
273 3300025929 Ga0207664_10017064 Ga0207664_100170646 250
274 3300025929 Ga0207664_10154511 Ga0207664_101545111 250
275 3300025929 Ga0207664_10316994 Ga0207664_103169941 250
276 3300025932 Ga0207690_10187986 Ga0207690_101879861 250
277 3300025939 Ga0207665_10000258 Ga0207665_1000025817 250
278 3300025939 Ga0207665_10000803 Ga0207665_1000080314 250
279 3300025939 Ga0207665_10004683 Ga0207665_100046833 250
280 3300025944 Ga0207661_10051561 Ga0207661_100515612 250
281 3300026116 Ga0207674_10053704 Ga0207674_100537042 250
282 3300031903 Ga0307407_10489018 Ga0307407_104890181 250
283 3300035083 Ga0373926_0000314 Ga0373926_0000314_10993_11745 250
284 3300035086 Ga0373934_0076820 Ga0373934_0076820_550_1302 250
285 3300035089 Ga0373944_0000269 Ga0373944_0000269_6351_7103 250
286 3300035111 Ga0373923_0133937 Ga0373923_0133937_246_998 250
287 3300035113 Ga0373936_0000992 Ga0373936_0000992_8580_9332 250
288 3300035113 Ga0373936_0013468 Ga0373936_0013468_72_824 250
289 3300035116 Ga0373945_0003433 Ga0373945_0003433_811_1563 250
290 3300035117 Ga0373953_0025836 Ga0373953_0025836_1463_2215 250
291 3300035118 Ga0373954_0062735 Ga0373954_0062735_907_1668 250
292 3300035118 Ga0373954_0242716 Ga0373954_0242716_76_828 250
293 3300035120 Ga0373957_0011493 Ga0373957_0011493_171_923 250
294 3300035170 Ga0373943_0005181 Ga0373943_0005181_281_1033 250
295 3300035171 Ga0373946_0001018 Ga0373946_0001018_4962_5714 250
296 3300035171 Ga0373946_0131670 Ga0373946_0131670_346_1107 250
297 3300035171 Ga0373946_0197336 Ga0373946_0197336_35_796 250
298 3300035172 Ga0373955_0025082 Ga0373955_0025082_485_1237 250
299 3300035410 Ga0373924_0015080 Ga0373924_0015080_512_1264 250
300 3300035410 Ga0373924_0020237 Ga0373924_0020237_365_1126 250
301 3300035692 Ga0373935_0001241 Ga0373935_0001241_5543_6295 250
302 3300035692 Ga0373935_0108010 Ga0373935_0108010_621_1373 250
303 3300035695 Ga0373927_0002562 Ga0373927_0002562_3465_4217 250
304 3300035725 Ga0373947_0000106 Ga0373947_0000106_17740_18492 250
305 3300036401 Ga0373937_0048560 Ga0373937_0048560_1488_2240 250
306 3300037068 Ga0373925_0515147 Ga0373925_0515147_24_776 250
307 3300037853 Ga0436364_0822916 Ga0436364_0822916_2237_2989 250
308 3300037853 Ga0436364_1503097 Ga0436364_1503097_38266_39018 250
309 3300039450 Ga0436363_0818886 Ga0436363_0818886_1164_1931 250
310 3300039450 Ga0436363_0880854 Ga0436363_0880854_150_902 250
311 3300044684 Ga0466966_0049867 Ga0466966_0049867_178_933 250
312 3300046454 Ga0495592_0035831 Ga0495592_0035831_2940_3692 250
313 3300046454 Ga0495592_0312252 Ga0495592_0312252_58_810 250
314 3300046463 Ga0495653_0006148 Ga0495653_0006148_1523_2275 250
315 3300046463 Ga0495653_0120550 Ga0495653_0120550_30_782 250
316 3300046477 Ga0495664_0000304 Ga0495664_0000304_20079_20831 250
317 3300046511 Ga0495608_0106143 Ga0495608_0106143_814_1566 250
318 3300046511 Ga0495608_0229088 Ga0495608_0229088_112_864 250
319 3300046514 Ga0495618_0158306 Ga0495618_0158306_590_1342 250
320 3300046516 Ga0495628_0224067 Ga0495628_0224067_413_1165 250
321 3300046516 Ga0495628_0387754 Ga0495628_0387754_207_959 250
322 3300046517 Ga0495630_0001904 Ga0495630_0001904_2321_3073 250
323 3300046529 Ga0495652_0058273 Ga0495652_0058273_315_1076 250
324 3300046529 Ga0495652_0058633 Ga0495652_0058633_2285_3037 250
325 3300046529 Ga0495652_0111069 Ga0495652_0111069_1080_1832 250
326 3300046531 Ga0495665_0243817 Ga0495665_0243817_44_805 250
327 3300046533 Ga0495640_0010091 Ga0495640_0010091_1396_2148 250
328 3300046536 Ga0495587_0037325 Ga0495587_0037325_33_785 250
329 3300046543 Ga0495645_0097952 Ga0495645_0097952_570_1322 250
330 3300046559 Ga0495667_0008632 Ga0495667_0008632_2294_3046 250
331 3300046559 Ga0495667_0261987 Ga0495667_0261987_256_1008 250
332 3300046642 Ga0495634_0044235 Ga0495634_0044235_128_880 250
333 3300046663 Ga0495635_0001326 Ga0495635_0001326_14180_14932 250
334 3300046663 Ga0495635_0128640 Ga0495635_0128640_400_1161 250
335 3300046675 Ga0495657_0010315 Ga0495657_0010315_2355_3107 250
336 3300046675 Ga0495657_0018484 Ga0495657_0018484_3939_4691 250
337 3300046678 Ga0495599_0072264 Ga0495599_0072264_419_1180 250
338 3300046680 Ga0495646_0118938 Ga0495646_0118938_226_978 250
339 3300046683 Ga0495658_0305187 Ga0495658_0305187_93_845 250
340 3300046689 Ga0495613_0111288 Ga0495613_0111288_730_1482 250
341 3300046690 Ga0495624_0002667 Ga0495624_0002667_10302_11054 250
342 3300047315 Ga0495581_0192227 Ga0495581_0192227_218_970 250
343 3300047319 Ga0495674_0000107 Ga0495674_0000107_59566_60318 250
344 3300047319 Ga0495674_0006259 Ga0495674_0006259_3536_4297 250
345 3300047319 Ga0495674_0030746 Ga0495674_0030746_225_986 250
346 3300047319 Ga0495674_0438721 Ga0495674_0438721_228_989 250
347 3300047319 Ga0495674_0513480 Ga0495674_0513480_171_923 250
348 3300047321 Ga0495676_0003116 Ga0495676_0003116_7086_7838 250
349 3300047322 Ga0495680_0011133 Ga0495680_0011133_5765_6517 250
350 3300047322 Ga0495680_0038143 Ga0495680_0038143_1185_1937 250
351 3300047444 Ga0495675_0294131 Ga0495675_0294131_83_835 250
352 3300047471 Ga0495684_0031051 Ga0495684_0031051_1192_1944 250
353 3300048088 Ga0495602_0071577 Ga0495602_0071577_65_817 250
354 3300048088 Ga0495602_0404279 Ga0495602_0404279_189_941 250
355 3300048907 Ga0496104_0422090 Ga0496104_0422090_49_801 250
356 3300049578 Ga0501042_0016517 Ga0501042_0016517_575_1342 250
357 3300050507 nmdc:mga05p37_262915_c1 nmdc:mga05p37_262915_c1_522_1274 250
358 3300053077 Ga0495601_0209208 Ga0495601_0209208_461_1222 250
359 3300053077 Ga0495601_0419536 Ga0495601_0419536_40_792 250
360 3300053078 Ga0495612_0075601 Ga0495612_0075601_573_1334 250
361 3300005353 Ga0070669_100441739 Ga0070669_1004417391 251
362 3300005435 Ga0070714_100006400 Ga0070714_1000064002 251
363 3300005437 Ga0070710_10014935 Ga0070710_100149352 251
364 3300005563 Ga0068855_100463993 Ga0068855_1004639931 251
365 3300005577 Ga0068857_100515698 Ga0068857_1005156981 251
366 3300005616 Ga0068852_100012469 Ga0068852_1000124695 251
367 3300005937 Ga0081455_10000841 Ga0081455_1000084116 251
368 3300006175 Ga0070712_100135269 Ga0070712_1001352692 251
369 3300009147 Ga0114129_10447563 Ga0114129_104475633 251
370 3300013104 Ga0157370_10084083 Ga0157370_100840833 251
371 3300025294 Ga0209025_1000568 Ga0209025_100056820 251
372 3300025915 Ga0207693_10121363 Ga0207693_101213632 251
373 3300026142 Ga0207698_10002303 Ga0207698_1000230310 251
374 3300028381 Ga0268264_10243663 Ga0268264_102436631 251
375 3300030745 Ga0316182_1236056 Ga0316182_12360563 251
376 3300041491 Ga0451833_0831993 Ga0451833_0831993_1449_2204 251
377 3300046491 Ga0495584_0187193 Ga0495584_0187193_134_889 251
378 3300050507 nmdc:mga05p37_271257_c1 nmdc:mga05p37_271257_c1_677_1432 251
379 3300021384 Ga0213876_10015999 Ga0213876_100159992 252
380 3300025294 Ga0209025_1017235 Ga0209025_10172352 252
381 3300031548 Ga0307408_100072873 Ga0307408_1000728732 252
382 3300031548 Ga0307408_100180600 Ga0307408_1001806002 252
383 3300031731 Ga0307405_10003701 Ga0307405_100037014 252
384 3300031824 Ga0307413_10052452 Ga0307413_100524522 252
385 3300031852 Ga0307410_10018397 Ga0307410_100183973 252
386 3300031901 Ga0307406_10005073 Ga0307406_100050734 252
387 3300031903 Ga0307407_10033456 Ga0307407_100334562 252
388 3300031911 Ga0307412_10100783 Ga0307412_101007832 252
389 3300031995 Ga0307409_100000573 Ga0307409_1000005734 252
390 3300032002 Ga0307416_100000450 Ga0307416_10000045013 252
391 3300032126 Ga0307415_100000132 Ga0307415_10000013215 252
392 3300037466 Ga0395898_0041455 Ga0395898_0041455_609_1379 252
393 3300038443 Ga0395901_0005513 Ga0395901_0005513_5197_5967 252
394 3300046499 Ga0495594_0029666 Ga0495594_0029666_59_823 252
395 3300053087 Ga0500643_000883 Ga0500643_000883_17737_18495 252
396 3300061734 Ga0530510_0072300 Ga0530510_0072300_990_1748 252
397 3300003187 JGI25151J46595_10005246 JGI25151J46595_100052466 253
398 3300003911 JGI25405J52794_10005897 JGI25405J52794_100058972 253
399 3300005329 Ga0070683_100021139 Ga0070683_1000211394 253
400 3300005338 Ga0068868_100032086 Ga0068868_1000320863 253
401 3300005341 Ga0070691_10045027 Ga0070691_100450272 253
402 3300005343 Ga0070687_100227428 Ga0070687_1002274281 253
403 3300005344 Ga0070661_100053821 Ga0070661_1000538212 253
404 3300005345 Ga0070692_10256230 Ga0070692_102562301 253
405 3300005347 Ga0070668_100001747 Ga0070668_1000017477 253
406 3300005354 Ga0070675_100166962 Ga0070675_1001669622 253
407 3300005355 Ga0070671_100079339 Ga0070671_1000793393 253
408 3300005356 Ga0070674_100156144 Ga0070674_1001561442 253
409 3300005364 Ga0070673_100088614 Ga0070673_1000886142 253
410 3300005366 Ga0070659_100089378 Ga0070659_1000893782 253
411 3300005439 Ga0070711_100037486 Ga0070711_1000374862 253
412 3300005440 Ga0070705_100123258 Ga0070705_1001232582 253
413 3300005445 Ga0070708_100003569 Ga0070708_1000035698 253
414 3300005445 Ga0070708_100290503 Ga0070708_1002905032 253
415 3300005455 Ga0070663_100099124 Ga0070663_1000991242 253
416 3300005467 Ga0070706_100028491 Ga0070706_1000284916 253
417 3300005468 Ga0070707_100000768 Ga0070707_10000076811 253
418 3300005471 Ga0070698_100018026 Ga0070698_1000180265 253
419 3300005471 Ga0070698_100152447 Ga0070698_1001524471 253
420 3300005518 Ga0070699_100002936 Ga0070699_10000293616 253
421 3300005535 Ga0070684_100090504 Ga0070684_1000905042 253
422 3300005544 Ga0070686_100093333 Ga0070686_1000933332 253
423 3300005547 Ga0070693_100059385 Ga0070693_1000593852 253
424 3300005549 Ga0070704_100010873 Ga0070704_1000108734 253
425 3300005563 Ga0068855_100015416 Ga0068855_1000154165 253
426 3300005578 Ga0068854_100055114 Ga0068854_1000551142 253
427 3300005614 Ga0068856_100107985 Ga0068856_1001079853 253
428 3300005616 Ga0068852_100123643 Ga0068852_1001236432 253
429 3300005616 Ga0068852_100290593 Ga0068852_1002905932 253
430 3300005841 Ga0068863_100081509 Ga0068863_1000815092 253
431 3300005843 Ga0068860_100179803 Ga0068860_1001798032 253
432 3300005937 Ga0081455_10004212 Ga0081455_100042129 253
433 3300005983 Ga0081540_1012301 Ga0081540_10123013 253
434 3300006028 Ga0070717_10082191 Ga0070717_100821912 253
435 3300006028 Ga0070717_10101017 Ga0070717_101010172 253
436 3300006048 Ga0075363_100344163 Ga0075363_1003441631 253
437 3300006163 Ga0070715_10214984 Ga0070715_102149841 253
438 3300006358 Ga0068871_100064852 Ga0068871_1000648523 253
439 3300006844 Ga0075428_100693334 Ga0075428_1006933342 253
440 3300006871 Ga0075434_100108686 Ga0075434_1001086863 253
441 3300006880 Ga0075429_100139331 Ga0075429_1001393312 253
442 3300006881 Ga0068865_100154016 Ga0068865_1001540162 253
443 3300006914 Ga0075436_100139233 Ga0075436_1001392332 253
444 3300007076 Ga0075435_100062529 Ga0075435_1000625293 253
445 3300009093 Ga0105240_10381120 Ga0105240_103811202 253
446 3300009094 Ga0111539_10737792 Ga0111539_107377922 253
447 3300009148 Ga0105243_10150510 Ga0105243_101505102 253
448 3300009177 Ga0105248_10220675 Ga0105248_102206752 253
449 3300009545 Ga0105237_10045775 Ga0105237_100457752 253
450 3300009551 Ga0105238_10051740 Ga0105238_100517402 253
451 3300009553 Ga0105249_10030861 Ga0105249_100308614 253
452 3300011119 Ga0105246_10049877 Ga0105246_100498772 253
453 3300013102 Ga0157371_10117612 Ga0157371_101176122 253
454 3300013104 Ga0157370_10028398 Ga0157370_100283982 253
455 3300013296 Ga0157374_10023193 Ga0157374_100231932 253
456 3300013297 Ga0157378_10027461 Ga0157378_100274613 253
457 3300013307 Ga0157372_10038158 Ga0157372_100381582 253
458 3300013308 Ga0157375_10343118 Ga0157375_103431182 253
459 3300014325 Ga0163163_10186501 Ga0163163_101865012 253
460 3300014968 Ga0157379_10061103 Ga0157379_100611033 253
461 3300014969 Ga0157376_10063952 Ga0157376_100639522 253
462 3300017792 Ga0163161_10002284 Ga0163161_100022845 253
463 3300020080 Ga0206350_10035209 Ga0206350_100352091 253
464 3300022467 Ga0224712_10091129 Ga0224712_100911292 253
465 3300025294 Ga0209025_1000130 Ga0209025_100013074 253
466 3300025885 Ga0207653_10014954 Ga0207653_100149542 253
467 3300025898 Ga0207692_10026629 Ga0207692_100266292 253
468 3300025901 Ga0207688_10001404 Ga0207688_100014049 253
469 3300025903 Ga0207680_10016053 Ga0207680_100160532 253
470 3300025904 Ga0207647_10056546 Ga0207647_100565462 253
471 3300025909 Ga0207705_10167209 Ga0207705_101672091 253
472 3300025910 Ga0207684_10019854 Ga0207684_100198542 253
473 3300025914 Ga0207671_10224653 Ga0207671_102246532 253
474 3300025915 Ga0207693_10005968 Ga0207693_100059683 253
475 3300025918 Ga0207662_10245988 Ga0207662_102459881 253
476 3300025919 Ga0207657_10008499 Ga0207657_100084998 253
477 3300025920 Ga0207649_10078319 Ga0207649_100783192 253
478 3300025922 Ga0207646_10000601 Ga0207646_1000060138 253
479 3300025924 Ga0207694_10561021 Ga0207694_105610212 253
480 3300025927 Ga0207687_10035124 Ga0207687_100351244 253
481 3300025928 Ga0207700_10141949 Ga0207700_101419492 253
482 3300025931 Ga0207644_10056319 Ga0207644_100563192 253
483 3300025932 Ga0207690_10114682 Ga0207690_101146822 253
484 3300025937 Ga0207669_10133320 Ga0207669_101333202 253
485 3300025938 Ga0207704_10020641 Ga0207704_100206412 253
486 3300025939 Ga0207665_10003031 Ga0207665_100030315 253
487 3300025940 Ga0207691_10067010 Ga0207691_100670102 253
488 3300025942 Ga0207689_10126330 Ga0207689_101263302 253
489 3300025944 Ga0207661_10074400 Ga0207661_100744002 253
490 3300025949 Ga0207667_10401799 Ga0207667_104017992 253
491 3300025972 Ga0207668_10020885 Ga0207668_100208853 253
492 3300025981 Ga0207640_10144751 Ga0207640_101447512 253
493 3300026067 Ga0207678_10002457 Ga0207678_1000245712 253
494 3300026078 Ga0207702_10323442 Ga0207702_103234421 253
495 3300026088 Ga0207641_10135236 Ga0207641_101352362 253
496 3300026121 Ga0207683_10018392 Ga0207683_100183923 253
497 3300026142 Ga0207698_10028472 Ga0207698_100284722 253
498 3300034817 Ga0373948_0010736 Ga0373948_0010736_711_1475 253
499 3300034957 Ga0373938_0009494 Ga0373938_0009494_820_1584 253
500 3300035090 Ga0373949_0009399 Ga0373949_0009399_600_1364 253
501 3300035092 Ga0373952_0014303 Ga0373952_0014303_277_1041 253
502 3300039437 Ga0436365_1913791 Ga0436365_1913791_22130_22915 253
503 3300044693 Ga0466961_0002842 Ga0466961_0002842_8816_9580 253
504 3300044719 Ga0466971_0006578 Ga0466971_0006578_3398_4162 253
505 3300044719 Ga0466971_0147341 Ga0466971_0147341_277_1041 253
506 3300044765 Ga0466970_0024295 Ga0466970_0024295_380_1144 253
507 3300044842 Ga0466957_0026513 Ga0466957_0026513_352_1116 253
508 3300045049 Ga0466959_0081425 Ga0466959_0081425_16_780 253
509 3300045836 Ga0466958_0082999 Ga0466958_0082999_244_1008 253
510 3300045976 Ga0466967_0627178 Ga0466967_0627178_59_823 253
511 3300048905 Ga0496102_0148079 Ga0496102_0148079_937_1701 253
512 3300048906 Ga0496103_0295643 Ga0496103_0295643_194_958 253
513 3300048913 Ga0496110_0303752 Ga0496110_0303752_657_1421 253
514 3300048914 Ga0496111_0036907 Ga0496111_0036907_2580_3344 253
515 3300048916 Ga0496113_0011839 Ga0496113_0011839_2783_3547 253
516 3300048917 Ga0496114_0018317 Ga0496114_0018317_209_973 253
517 3300049581 Ga0501047_0147482 Ga0501047_0147482_91_858 253
518 3300050512 nmdc:mga0n895_76772_c1 nmdc:mga0n895_76772_c1_481_1245 253
519 3300050513 nmdc:mga0rr50_42642_c1 nmdc:mga0rr50_42642_c1_352_1116 253
520 3300050514 nmdc:mga08x19_86678_c1 nmdc:mga08x19_86678_c1_1254_2018 253
521 3300050515 nmdc:mga0a205_687019_c1 nmdc:mga0a205_687019_c1_28_792 253
522 3300061719 Ga0466962_0146250 Ga0466962_0146250_163_927 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

220

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

271

0.96

PF08659

KR

KR domain

28

202

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ijk-assembly1.cif.gz_A crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9695 7 249
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.9694 3 249
3ftp-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9662 1 249
4cqm-assembly2.cif.gz_C crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9653 7 249
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.965 3 253
ID Description Score Start End Superfamily
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9662 1 249 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 7 249 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9615 4 181 3.40.50.720
4hsyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 4 253 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9593 3 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A367ANW0-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9784 7 251 GO:0016491
AF-A0A7C4SFP5-F1-model_v4 SDR family oxidoreductase 0.9783 4 184 GO:0016616
GO:0030497
AF-A0A1Q9TBD1-F1-model_v4 deleted 0.9779 5 253
AF-A0A1H2VIS8-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.976 4 251
AF-A0A4U3B1F4-F1-model_v4 deleted 0.9725 56 249

Feature Viewer

pLDDT pTM Quality
95.51 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map