F458667

General Info

Members Datasets Scaffolds Average Seq Length
521 254 1042 398

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100131743|Ga0070697_1001317431
Length 467
Sequence LYASVQTTEHYLGCKQKLRHAVMTTWDWKTSDGAFTAQNRTSGAVSVEPNRDFCEGFNQVNLGMPFAYNQCMRILLFSGKGGVGKTSLAAATGLRLADLGYRTLVMSIDAAHSLADSFDLDVELFQVQTADPFPIQDRLSIFELNIQKEVKRHWQQISSYVISVLRTTGISDVEAEELAILPGMEELSAMMYINQYRRENRYDVIVLDAAPTAESMRFISMPTTLDWYMKHIFPFQRNLLKAVRPIANRVAPFELPTDSYFANIRDLFEKLEGVDEIMEDPRTTSVRLVTNPEKMVLRETQRAFVYFSLHGLTVDNVIVNRILPPEIRDAWFNEWHSSQNNVSRELEEYFAPVPVRRVPLFAYEVLGKQRLQELAKVLYAEGEDPSAVTQTEKPYVFGKRDGMYEVRLRLPFATKGDIGLFKKGDELVVEVGTLRRHIGLPRSMATLVPARARLENRILTIEMKEAQ

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
155 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
156 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
157 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
158 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
246 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 2643221615 Nocardioides sp. Root224 Isolate Unclassified
251 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
252 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
253 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
254 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0.77
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 0.77
Rhizosphere 93.86
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100131743 3300005536 Viruses 2097
2 JGI25406J46586_10043855 3300003203 Bacteria 1553
3 Ga0065707_10118496 3300005295 Bacteria 2184
4 Ga0070683_100000001 3300005329 Bacteria 529385
5 Ga0070683_100029630 3300005329 Unclassified 4958
6 Ga0070683_100253501 3300005329 Unclassified 1674
7 Ga0070680_100013191 3300005336 Bacteria 6434
8 Ga0070688_100227933 3300005365 Bacteria 1317
9 Ga0070714_100033565 3300005435 Bacteria 4291
10 Ga0070713_100003050 3300005436 Bacteria 11003
11 Ga0070713_100022936 3300005436 Bacteria 4833
12 Ga0070713_100034136 3300005436 Bacteria 4083
13 Ga0070713_100047856 3300005436 Bacteria 3517
14 Ga0070710_10102351 3300005437 Unclassified 1708
15 Ga0070710_10114155 3300005437 Bacteria 1626
16 Ga0070711_100012049 3300005439 Bacteria 5391
17 Ga0070708_100017422 3300005445 Bacteria 5991
18 Ga0070708_100026075 3300005445 Bacteria 5000
19 Ga0070662_100001657 3300005457 Bacteria 13699
20 Ga0070681_10026602 3300005458 Bacteria 5815
21 Ga0070681_10037266 3300005458 Bacteria 4881
22 Ga0070681_10201015 3300005458 Unclassified 1911
23 Ga0070681_10303841 3300005458 Bacteria 1505
24 Ga0070706_100011493 3300005467 Bacteria 8230
25 Ga0070706_100017842 3300005467 Bacteria 6547
26 Ga0070707_100165237 3300005468 Bacteria 2157
27 Ga0070707_100282807 3300005468 Bacteria 1612
28 Ga0070698_100002704 3300005471 Bacteria 19498
29 Ga0070698_100007849 3300005471 Bacteria 11555
30 Ga0070698_100019924 3300005471 Bacteria 7035
31 Ga0070698_100065911 3300005471 Bacteria 3646
32 Ga0070698_100224627 3300005471 Bacteria 1811
33 Ga0070699_100016624 3300005518 Bacteria 6315
34 Ga0070679_100087887 3300005530 Unclassified 3096
35 Ga0070684_100000108 3300005535 Bacteria 54047
36 Ga0070684_100020286 3300005535 Bacteria 5513
37 Ga0070684_100127510 3300005535 Bacteria 2293
38 Ga0070697_100007239 3300005536 Bacteria 8630
39 Ga0070697_100018592 3300005536 Bacteria 5480
40 Ga0070697_100097555 3300005536 Unclassified 2439
41 Ga0070672_100309746 3300005543 Bacteria 1340
42 Ga0070696_100004095 3300005546 Bacteria 9718
43 Ga0070704_100004112 3300005549 Bacteria 8400
44 Ga0068855_100030434 3300005563 Bacteria 6458
45 Ga0068855_100099392 3300005563 Bacteria 3351
46 Ga0068857_100304040 3300005577 Unclassified 1471
47 Ga0068852_100070721 3300005616 Bacteria 3062
48 Ga0068852_100165814 3300005616 Bacteria 2067
49 Ga0068859_100000076 3300005617 Bacteria 91596
50 Ga0068863_100251565 3300005841 Bacteria 1707
51 Ga0068858_100104334 3300005842 Unclassified 2645
52 Ga0068860_100002898 3300005843 Bacteria 17781
53 Ga0081455_10027633 3300005937 Bacteria 5198
54 Ga0081455_10091173 3300005937 Bacteria 2469
55 Ga0081455_10131257 3300005937 Bacteria 1959
56 Ga0081538_10000725 3300005981 Bacteria 35930
57 Ga0081538_10004746 3300005981 Bacteria 12440
58 Ga0081538_10009036 3300005981 Bacteria 8367
59 Ga0081538_10016660 3300005981 Bacteria 5622
60 Ga0081540_1066830 3300005983 Bacteria 1682
61 Ga0081539_10009111 3300005985 Bacteria 8398
62 Ga0081539_10012374 3300005985 Bacteria 6583
63 Ga0070717_10002664 3300006028 Bacteria 12574
64 Ga0070717_10058551 3300006028 Bacteria 3186
65 Ga0070717_10141730 3300006028 Bacteria 2074
66 Ga0070717_10298509 3300006028 Unclassified 1432
67 Ga0075365_10118708 3300006038 Bacteria 1823
68 Ga0075368_10060941 3300006042 Bacteria 1510
69 Ga0070712_100152506 3300006175 Unclassified 1776
70 Ga0075367_10069835 3300006178 Bacteria 2110
71 Ga0075427_10001425 3300006194 Bacteria 3067
72 Ga0075428_100000020 3300006844 Bacteria 136123
73 Ga0075428_100004570 3300006844 Bacteria 15303
74 Ga0075428_100011591 3300006844 Bacteria 9808
75 Ga0075428_100012881 3300006844 Bacteria 9304
76 Ga0075428_100030474 3300006844 Bacteria 5965
77 Ga0075428_100064303 3300006844 Bacteria 4017
78 Ga0075430_100014411 3300006846 Bacteria 6736
79 Ga0075430_100015289 3300006846 Bacteria 6535
80 Ga0075430_100028897 3300006846 Bacteria 4707
81 Ga0075430_100075994 3300006846 Bacteria 2815
82 Ga0075430_100107116 3300006846 Bacteria 2331
83 Ga0075431_100009545 3300006847 Bacteria 9745
84 Ga0075431_100009611 3300006847 Bacteria 9712
85 Ga0075431_100014621 3300006847 Bacteria 7940
86 Ga0075431_100120287 3300006847 Bacteria 2709
87 Ga0075431_100138616 3300006847 Bacteria 2508
88 Ga0075431_100167197 3300006847 Bacteria 2260
89 Ga0075433_10001596 3300006852 Bacteria 16791
90 Ga0075434_100002592 3300006871 Bacteria 15954
91 Ga0075434_100056869 3300006871 Unclassified 3888
92 Ga0075429_100004694 3300006880 Bacteria 11764
93 Ga0075429_100007660 3300006880 Bacteria 9375
94 Ga0075429_100014559 3300006880 Bacteria 6816
95 Ga0075429_100104331 3300006880 Bacteria 2476
96 Ga0075436_100001080 3300006914 Bacteria 18353
97 Ga0075436_100016331 3300006914 Bacteria 5083
98 Ga0075436_100093576 3300006914 Bacteria 2090
99 Ga0075436_100182261 3300006914 Bacteria 1484
100 Ga0097620_100000076 3300006931 Bacteria 91596
101 Ga0075435_100009914 3300007076 Bacteria 6938
102 Ga0075435_100033213 3300007076 Unclassified 4079
103 Ga0075435_100041314 3300007076 Bacteria 3686
104 Ga0075435_100050249 3300007076 Bacteria 3355
105 Ga0075435_100175435 3300007076 Bacteria 1810
106 Ga0099794_10004645 3300007265 Bacteria 5428
107 Ga0099794_10006355 3300007265 Bacteria 4779
108 Ga0099795_10026248 3300007788 Bacteria 1961
109 Ga0105240_10018208 3300009093 Bacteria 9442
110 Ga0105240_10072072 3300009093 Bacteria 4271
111 Ga0105240_10327446 3300009093 Bacteria 1744
112 Ga0105240_10499156 3300009093 Bacteria 1353
113 Ga0111539_10007151 3300009094 Bacteria 14309
114 Ga0111539_10014447 3300009094 Bacteria 9853
115 Ga0111539_10070211 3300009094 Bacteria 4135
116 Ga0111539_10090433 3300009094 Bacteria 3597
117 Ga0111539_10213760 3300009094 Bacteria 2246
118 Ga0114129_10009803 3300009147 Bacteria 13659
119 Ga0114129_10031507 3300009147 Bacteria 7495
120 Ga0114129_10091414 3300009147 Bacteria 4217
121 Ga0105243_10070522 3300009148 Bacteria 2822
122 Ga0105242_10076536 3300009176 Bacteria 2790
123 Ga0105248_10001338 3300009177 Bacteria 27441
124 Ga0105248_10044361 3300009177 Bacteria 4987
125 Ga0105248_10058853 3300009177 Bacteria 4315
126 Ga0105237_10015074 3300009545 Bacteria 8055
127 Ga0105237_10051683 3300009545 Bacteria 4127
128 Ga0105237_10212267 3300009545 Bacteria 1935
129 Ga0105238_10257701 3300009551 Bacteria 1723
130 Ga0105238_10363521 3300009551 Bacteria 1437
131 Ga0105249_10003629 3300009553 Bacteria 13344
132 Ga0105239_10324064 3300010375 Archaea 1738
133 Ga0157373_10100163 3300013100 Unclassified 2039
134 Ga0157370_10002869 3300013104 Bacteria 20560
135 Ga0157370_10189031 3300013104 Bacteria 1912
136 Ga0157369_10002714 3300013105 Bacteria 21128
137 Ga0157369_10042954 3300013105 Unclassified 4929
138 Ga0157369_10152130 3300013105 Unclassified 2446
139 Ga0157369_10255267 3300013105 Bacteria 1829
140 Ga0157374_10012262 3300013296 Bacteria 7453
141 Ga0157374_10015861 3300013296 Bacteria 6619
142 Ga0157378_10002325 3300013297 Bacteria 16895
143 Ga0157378_10013962 3300013297 Bacteria 7027
144 Ga0163162_10111758 3300013306 Bacteria 2830
145 Ga0163163_10085818 3300014325 Bacteria 3156
146 Ga0163163_10096539 3300014325 Bacteria 2976
147 Ga0163163_10177840 3300014325 Bacteria 2175
148 Ga0163163_10268088 3300014325 Bacteria 1758
149 Ga0163163_10469638 3300014325 Bacteria 1319
150 Ga0157380_10107512 3300014326 Bacteria 2336
151 Ga0157380_10141609 3300014326 Bacteria 2067
152 Ga0157379_10025682 3300014968 Bacteria 5235
153 Ga0157376_10096358 3300014969 Bacteria 2575
154 Ga0157376_10192242 3300014969 Bacteria 1872
155 Ga0213872_10000270 3300021361 Bacteria 44678
156 Ga0213872_10006737 3300021361 Bacteria 5721
157 Ga0213874_10001053 3300021377 Bacteria 5660
158 Ga0213876_10024981 3300021384 Bacteria 3154
159 Ga0213875_10010717 3300021388 Bacteria 4583
160 Ga0213875_10014153 3300021388 Bacteria 3899
161 Ga0224712_10019394 3300022467 Bacteria 2292
162 Ga0224712_10025875 3300022467 Unclassified 2067
163 Ga0207684_10013325 3300025910 Bacteria 7113
164 Ga0207684_10020420 3300025910 Bacteria 5660
165 Ga0207684_10049015 3300025910 Bacteria 3583
166 Ga0207684_10050747 3300025910 Bacteria 3520
167 Ga0207707_10021000 3300025912 Bacteria 5703
168 Ga0207707_10228631 3300025912 Bacteria 1619
169 Ga0207695_10009105 3300025913 Bacteria 12329
170 Ga0207695_10088936 3300025913 Bacteria 3107
171 Ga0207695_10141773 3300025913 Bacteria 2351
172 Ga0207695_10336731 3300025913 Bacteria 1397
173 Ga0207671_10222270 3300025914 Bacteria 1480
174 Ga0207663_10029929 3300025916 Bacteria 3205
175 Ga0207663_10055861 3300025916 Bacteria 2479
176 Ga0207660_10003318 3300025917 Bacteria 10514
177 Ga0207646_10006026 3300025922 Bacteria 12629
178 Ga0207646_10101516 3300025922 Bacteria 2579
179 Ga0207646_10236542 3300025922 Bacteria 1650
180 Ga0207646_10321911 3300025922 Bacteria 1397
181 Ga0207694_10183278 3300025924 Bacteria 1699
182 Ga0207687_10146943 3300025927 Unclassified 1794
183 Ga0207700_10139784 3300025928 Bacteria 1988
184 Ga0207664_10008218 3300025929 Bacteria 7266
185 Ga0207664_10064244 3300025929 Unclassified 2935
186 Ga0207670_10214211 3300025936 Bacteria 1471
187 Ga0207711_10067054 3300025941 Bacteria 3106
188 Ga0207711_10111198 3300025941 Bacteria 2437
189 Ga0207711_10186681 3300025941 Unclassified 1888
190 Ga0207661_10000005 3300025944 Bacteria 557888
191 Ga0207661_10020362 3300025944 Unclassified 4958
192 Ga0207661_10132663 3300025944 Unclassified 2136
193 Ga0207667_10038192 3300025949 Bacteria 5129
194 Ga0207667_10250909 3300025949 Unclassified 1810
195 Ga0207667_10258138 3300025949 Bacteria 1782
196 Ga0207712_10063687 3300025961 Bacteria 2626
197 Ga0207703_10078385 3300026035 Unclassified 2745
198 Ga0207639_10060820 3300026041 Bacteria 2915
199 Ga0207678_10016295 3300026067 Bacteria 6524
200 Ga0207702_10268952 3300026078 Bacteria 1607
201 Ga0207641_10333320 3300026088 Bacteria 1442
202 Ga0207675_100010668 3300026118 Bacteria 8608
203 Ga0207683_10153708 3300026121 Bacteria 2078
204 Ga0207698_10008597 3300026142 Bacteria 6469
205 Ga0207698_10327940 3300026142 Bacteria 1437
206 Ga0209588_1020224 3300027671 Bacteria 2083
207 Ga0207428_10000988 3300027907 Bacteria 31503
208 Ga0207428_10133349 3300027907 Bacteria 1900
209 Ga0268264_10167646 3300028381 Bacteria 1984
210 Ga0265323_10012435 3300028653 Bacteria 3410
211 Ga0265324_10013062 3300029957 Bacteria 3109
212 Ga0265760_10005431 3300031090 Unclassified 3656
213 Ga0265760_10024112 3300031090 Bacteria 1770
214 Ga0265330_10032953 3300031235 Bacteria 2320
215 Ga0265320_10005890 3300031240 Bacteria 7804
216 Ga0265325_10008339 3300031241 Bacteria 6120
217 Ga0265325_10068727 3300031241 Bacteria 1782
218 Ga0265340_10041727 3300031247 Bacteria 2255
219 Ga0265331_10006855 3300031250 Bacteria 6658
220 Ga0265331_10055753 3300031250 Unclassified 1879
221 Ga0265316_10001428 3300031344 Bacteria 25696
222 Ga0265316_10007570 3300031344 Bacteria 10215
223 Ga0265316_10009426 3300031344 Bacteria 8996
224 Ga0265316_10123718 3300031344 Bacteria 1952
225 Ga0307408_100012146 3300031548 Bacteria 5701
226 Ga0307408_100091512 3300031548 Bacteria 2297
227 Ga0316575_10026687 3300031665 Bacteria 2245
228 Ga0316579_10054869 3300031691 Bacteria 1868
229 Ga0265314_10009716 3300031711 Bacteria 8091
230 Ga0265342_10014788 3300031712 Bacteria 5168
231 Ga0265342_10046817 3300031712 Bacteria 2598
232 Ga0316578_10091401 3300031728 Bacteria 1818
233 Ga0316577_10018583 3300031733 Bacteria 3845
234 Ga0316577_10051793 3300031733 Bacteria 2290
235 Ga0307413_10015494 3300031824 Bacteria 3908
236 Ga0307410_10010500 3300031852 Bacteria 5250
237 Ga0307406_10024390 3300031901 Bacteria 3612
238 Ga0307412_10031109 3300031911 Bacteria 3367
239 Ga0307412_10043483 3300031911 Bacteria 2925
240 Ga0307409_100005507 3300031995 Bacteria 7303
241 Ga0307416_100000712 3300032002 Bacteria 17270
242 Ga0307416_100020762 3300032002 Bacteria 4696
243 Ga0307416_100090285 3300032002 Bacteria 2626
244 Ga0307415_100000656 3300032126 Bacteria 15241
245 Ga0307415_100010889 3300032126 Bacteria 5172
246 Ga0373926_0010265 3300035083 Bacteria 3137
247 Ga0373926_0046621 3300035083 Bacteria 1556
248 Ga0373934_0005622 3300035086 Bacteria 4644
249 Ga0373934_0014772 3300035086 Bacteria 2957
250 Ga0373923_0039149 3300035111 Bacteria 1946
251 Ga0373954_0005088 3300035118 Bacteria 5673
252 Ga0373956_0001219 3300035119 Bacteria 10651
253 Ga0373956_0036615 3300035119 Bacteria 2166
254 Ga0373957_0002719 3300035120 Bacteria 5082
255 Ga0373943_0098839 3300035170 Bacteria 1523
256 Ga0373955_0015831 3300035172 Bacteria 3699
257 Ga0373955_0072861 3300035172 Bacteria 1925
258 Ga0373955_0092269 3300035172 Bacteria 1727
259 Ga0373935_0032695 3300035692 Bacteria 3233
260 Ga0373927_0001593 3300035695 Bacteria 17025
261 Ga0373927_0002669 3300035695 Bacteria 12999
262 Ga0373927_0036585 3300035695 Bacteria 3192
263 Ga0373927_0113147 3300035695 Bacteria 1769
264 Ga0373933_0000590 3300035724 Bacteria 22703
265 Ga0373933_0006216 3300035724 Bacteria 6496
266 Ga0373947_0137567 3300035725 Bacteria 1564
267 Ga0373937_0000429 3300036401 Bacteria 39116
268 Ga0373937_0017200 3300036401 Bacteria 6436
269 Ga0373937_0021013 3300036401 Bacteria 5856
270 Ga0316582_0008089 3300036647 Bacteria 5629
271 Ga0316582_0024185 3300036647 Bacteria 3632
272 Ga0316584_0064477 3300036712 Bacteria 2743
273 Ga0316584_0072128 3300036712 Unclassified 2588
274 Ga0373925_0000106 3300037068 Bacteria 89944
275 Ga0373925_0025096 3300037068 Bacteria 4353
276 Ga0373925_0048084 3300037068 Bacteria 3177
277 Ga0373925_0201771 3300037068 Unclassified 1582
278 Ga0395900_0007328 3300037418 Bacteria 11413
279 Ga0395900_0030843 3300037418 Bacteria 5505
280 Ga0395900_0075699 3300037418 Bacteria 3460
281 Ga0395900_0101570 3300037418 Bacteria 2954
282 Ga0395905_0059668 3300037471 Unclassified 3566
283 Ga0395905_0122374 3300037471 Bacteria 2446
284 Ga0395905_0224981 3300037471 Bacteria 1755
285 Ga0316581_0009921 3300037588 Bacteria 2628
286 Ga0436364_0454994 3300037853 Bacteria 9047
287 Ga0436364_0732889 3300037853 Unclassified 4004
288 Ga0436364_1262834 3300037853 Bacteria 5173
289 Ga0436364_1524688 3300037853 Unclassified 3205
290 Ga0395901_0005924 3300038443 Bacteria 12378
291 Ga0395901_0065317 3300038443 Bacteria 3788
292 Ga0395901_0268113 3300038443 Bacteria 1776
293 Ga0400489_44610 3300039093 Bacteria 146572
294 Ga0436365_0565592 3300039437 Bacteria 3004
295 Ga0436365_0647949 3300039437 Bacteria 3170
296 Ga0436365_0686475 3300039437 Bacteria 3003
297 Ga0436365_1735198 3300039437 Bacteria 7110
298 Ga0436360_0152872 3300039438 Bacteria 2655
299 Ga0436361_0326575 3300039447 Bacteria 6064
300 Ga0436361_0420925 3300039447 Bacteria 2235
301 Ga0436361_0761235 3300039447 Bacteria 90297
302 Ga0436361_1092390 3300039447 Bacteria 1595
303 Ga0436363_0534313 3300039450 Bacteria 10871
304 Ga0436363_1143990 3300039450 Unclassified 1485
305 Ga0436363_1159644 3300039450 Bacteria 4281
306 Ga0436362_0569566 3300039453 Bacteria 6091
307 Ga0436362_1087173 3300039453 Bacteria 9113
308 Ga0439448_0000312 3300042005 Bacteria 10740
309 Ga0439450_000409 3300042008 Bacteria 5522
310 Ga0439451_004947 3300042009 Bacteria 2712
311 Ga0439463_000324 3300042016 Bacteria 13332
312 Ga0450916_000985 3300042530 Bacteria 2736
313 Ga0450901_004405 3300042533 Bacteria 1457
314 Ga0451577_0020472 3300042876 Bacteria 6071
315 Ga0439440_0000082 3300042993 Bacteria 12081
316 Ga0439440_0013723 3300042993 Bacteria 1741
317 Ga0466966_0052847 3300044684 Bacteria 2579
318 Ga0453684_0225946 3300044712 Bacteria 2164
319 Ga0466959_0028449 3300045049 Bacteria 4145
320 Ga0451576_0052200 3300045051 Bacteria 4285
321 Ga0451576_0208084 3300045051 Unclassified 2043
322 Ga0451576_0223708 3300045051 Unclassified 1965
323 Ga0451576_0499915 3300045051 Bacteria 1277
324 Ga0466967_0186876 3300045976 Bacteria 1957
325 Ga0495592_0087873 3300046454 Bacteria 2235
326 Ga0495651_0022637 3300046462 Bacteria 4884
327 Ga0495653_0093368 3300046463 Bacteria 2195
328 Ga0495580_0000327 3300046472 Bacteria 39015
329 Ga0495580_0042240 3300046472 Bacteria 3249
330 Ga0495580_0087687 3300046472 Bacteria 2167
331 Ga0495580_0127637 3300046472 Unclassified 1765
332 Ga0495580_0191600 3300046472 Unclassified 1410
333 Ga0495582_0019338 3300046473 Bacteria 3723
334 Ga0495664_0018386 3300046477 Bacteria 4003
335 Ga0495664_0051052 3300046477 Bacteria 2456
336 Ga0495618_0045938 3300046514 Bacteria 2756
337 Ga0495628_0034169 3300046516 Unclassified 4093
338 Ga0495628_0077861 3300046516 Bacteria 2579
339 Ga0495630_0011318 3300046517 Bacteria 6454
340 Ga0495652_0212848 3300046529 Bacteria 1458
341 Ga0495665_0098297 3300046531 Bacteria 1537
342 Ga0495640_0113924 3300046533 Unclassified 1764
343 Ga0495587_0008341 3300046536 Bacteria 6670
344 Ga0495587_0009146 3300046536 Bacteria 6355
345 Ga0495587_0078362 3300046536 Bacteria 1917
346 Ga0495645_0047756 3300046543 Bacteria 3119
347 Ga0495645_0060080 3300046543 Bacteria 2755
348 Ga0495645_0082363 3300046543 Unclassified 2308
349 Ga0495667_0056061 3300046559 Bacteria 2592
350 Ga0495634_0078046 3300046642 Bacteria 2170
351 Ga0495611_0077350 3300046648 Bacteria 1526
352 Ga0495635_0170156 3300046663 Unclassified 1482
353 Ga0495657_0164218 3300046675 Bacteria 1372
354 Ga0495623_0007368 3300046679 Bacteria 7143
355 Ga0495623_0029801 3300046679 Bacteria 3511
356 Ga0495613_0037900 3300046689 Bacteria 3573
357 Ga0495613_0060012 3300046689 Bacteria 2787
358 Ga0495581_0104781 3300047315 Bacteria 1643
359 Ga0495604_0006730 3300047317 Bacteria 9111
360 Ga0495604_0018523 3300047317 Bacteria 5577
361 Ga0495604_0102647 3300047317 Bacteria 2099
362 Ga0495674_0005296 3300047319 Bacteria 12370
363 Ga0495674_0073823 3300047319 Unclassified 2939
364 Ga0495674_0105542 3300047319 Bacteria 2394
365 Ga0495672_0000941 3300047320 Bacteria 30354
366 Ga0495676_0013589 3300047321 Bacteria 7310
367 Ga0495675_0002918 3300047444 Bacteria 10271
368 Ga0495675_0018631 3300047444 Bacteria 4407
369 Ga0495684_0010018 3300047471 Bacteria 7328
370 Ga0495684_0070208 3300047471 Bacteria 2663
371 Ga0495684_0274125 3300047471 Unclassified 1219
372 Ga0495602_0000216 3300048088 Bacteria 53347
373 Ga0495602_0017463 3300048088 Bacteria 7194
374 Ga0495602_0149410 3300048088 Bacteria 1838
375 Ga0496102_0024086 3300048905 Bacteria 5410
376 Ga0496104_0232658 3300048907 Bacteria 1755
377 Ga0496109_0004866 3300048912 Bacteria 11211
378 Ga0496115_0060707 3300048918 Bacteria 3047
379 Ga0501031_0002688 3300049568 Bacteria 11317
380 Ga0501031_0018521 3300049568 Bacteria 4532
381 Ga0501031_0027801 3300049568 Bacteria 3687
382 Ga0501032_0002290 3300049569 Bacteria 15027
383 Ga0501032_0079093 3300049569 Bacteria 2189
384 Ga0501033_0005077 3300049570 Bacteria 10473
385 Ga0501033_0028795 3300049570 Bacteria 4174
386 Ga0501034_0005640 3300049571 Bacteria 13619
387 Ga0501036_0000285 3300049572 Bacteria 34973
388 Ga0501036_0004797 3300049572 Bacteria 10932
389 Ga0501036_0045684 3300049572 Bacteria 3710
390 Ga0501036_0143075 3300049572 Bacteria 2017
391 Ga0501037_0001563 3300049573 Bacteria 16706
392 Ga0501037_0076038 3300049573 Bacteria 2438
393 Ga0501038_0002184 3300049574 Bacteria 18186
394 Ga0501038_0010192 3300049574 Bacteria 8599
395 Ga0501038_0041300 3300049574 Bacteria 4023
396 Ga0501039_0004563 3300049575 Bacteria 10464
397 Ga0501039_0008646 3300049575 Bacteria 7756
398 Ga0501039_0023949 3300049575 Bacteria 4688
399 Ga0501039_0036103 3300049575 Bacteria 3813
400 Ga0501039_0070086 3300049575 Bacteria 2724
401 Ga0501040_0008473 3300049576 Bacteria 6679
402 Ga0501040_0017001 3300049576 Bacteria 4823
403 Ga0501040_0101819 3300049576 Bacteria 2004
404 Ga0501041_0002171 3300049577 Bacteria 11069
405 Ga0501041_0010929 3300049577 Bacteria 5358
406 Ga0501041_0040875 3300049577 Bacteria 2816
407 Ga0501042_0002579 3300049578 Bacteria 11145
408 Ga0501042_0050363 3300049578 Bacteria 2970
409 Ga0501043_0012888 3300049579 Bacteria 6536
410 Ga0501046_0000268 3300049580 Bacteria 53036
411 Ga0501046_0002430 3300049580 Bacteria 17463
412 Ga0501046_0017458 3300049580 Bacteria 5988
413 Ga0501047_0015249 3300049581 Bacteria 7321
414 Ga0501047_0171404 3300049581 Bacteria 2039
415 Ga0501048_0133830 3300049582 Bacteria 1751
416 Ga0501067_0000866 3300049583 Bacteria 16261
417 Ga0501067_0130133 3300049583 Bacteria 1401
418 Ga0501068_0000584 3300049584 Bacteria 18499
419 Ga0501068_0000810 3300049584 Bacteria 16242
420 Ga0501068_0072287 3300049584 Bacteria 2106
421 Ga0501069_0002873 3300049585 Bacteria 8836
422 Ga0501069_0003484 3300049585 Bacteria 8104
423 Ga0501070_0088088 3300049586 Bacteria 2570
424 Ga0501071_0013329 3300049587 Bacteria 5600
425 Ga0501071_0013700 3300049587 Bacteria 5531
426 Ga0501071_0019088 3300049587 Bacteria 4757
427 Ga0501071_0033247 3300049587 Bacteria 3664
428 Ga0501071_0040517 3300049587 Bacteria 3333
429 Ga0501072_0000967 3300049588 Bacteria 21214
430 Ga0501072_0001475 3300049588 Bacteria 17628
431 Ga0501072_0070674 3300049588 Bacteria 2757
432 Ga0501074_0005187 3300049590 Bacteria 9362
433 Ga0501074_0010750 3300049590 Bacteria 6649
434 Ga0501075_0000201 3300049591 Bacteria 31663
435 Ga0501075_0009327 3300049591 Bacteria 6867
436 Ga0501075_0020209 3300049591 Bacteria 4839
437 Ga0501075_0052908 3300049591 Bacteria 3053
438 Ga0501076_0000411 3300049592 Bacteria 26822
439 Ga0501076_0000818 3300049592 Bacteria 20188
440 Ga0501076_0039631 3300049592 Bacteria 3699
441 Ga0501076_0056008 3300049592 Bacteria 3128
442 Ga0501076_0195710 3300049592 Bacteria 1650
443 Ga0501077_0001205 3300049593 Bacteria 15633
444 Ga0501077_0010619 3300049593 Bacteria 5734
445 Ga0501077_0012939 3300049593 Bacteria 5227
446 Ga0501077_0017282 3300049593 Bacteria 4550
447 Ga0501079_0000449 3300049741 Bacteria 26881
448 Ga0501079_0003613 3300049741 Bacteria 11383
449 Ga0501079_0005522 3300049741 Bacteria 9428
450 Ga0501079_0044343 3300049741 Bacteria 3432
451 Ga0501079_0086557 3300049741 Bacteria 2425
452 Ga0501080_0000059 3300049742 Bacteria 72357
453 Ga0501080_0040146 3300049742 Bacteria 4366
454 Ga0501080_0086946 3300049742 Bacteria 2904
455 Ga0501081_0000377 3300049743 Bacteria 24447
456 Ga0501081_0010858 3300049743 Bacteria 5952
457 Ga0501083_0000601 3300049744 Bacteria 23167
458 Ga0501083_0003341 3300049744 Bacteria 11221
459 Ga0501083_0006373 3300049744 Bacteria 8363
460 Ga0501083_0013781 3300049744 Bacteria 5652
461 Ga0501035_0176070 3300049822 Bacteria 1845
462 Ga0501044_0013563 3300049823 Bacteria 8806
463 Ga0501045_0004823 3300049824 Bacteria 9326
464 Ga0501045_0005263 3300049824 Bacteria 8955
465 Ga0501045_0010788 3300049824 Bacteria 6403
466 Ga0501045_0012193 3300049824 Bacteria 6053
467 Ga0501045_0029706 3300049824 Bacteria 3952
468 nmdc:mga05p37_166671_c1 3300050507 Bacteria 2688
469 nmdc:mga05p37_2144_c1 3300050507 Bacteria 23050
470 nmdc:mga05p37_365558_c1 3300050507 Bacteria 1695
471 nmdc:mga09592_1464_c1 3300050508 Bacteria 18949
472 nmdc:mga09592_4556_c1 3300050508 Bacteria 11215
473 nmdc:mga0qj67_13642_c1 3300050509 Bacteria 5536
474 nmdc:mga0qj67_15357_c1 3300050509 Bacteria 5799
475 nmdc:mga0qj67_18435_c1 3300050509 Bacteria 5320
476 nmdc:mga06r32_14694_c1 3300050510 Bacteria 7106
477 nmdc:mga06r32_161584_c1 3300050510 Bacteria 2222
478 nmdc:mga06r32_390771_c1 3300050510 Bacteria 1374
479 nmdc:mga06r32_70043_c1 3300050510 Bacteria 3391
480 nmdc:mga08y16_29820_c1 3300050511 Bacteria 5744
481 nmdc:mga08y16_2983_c1 3300050511 Bacteria 17452
482 nmdc:mga08y16_67548_c1 3300050511 Bacteria 3728
483 nmdc:mga0n895_3223_c1 3300050512 Bacteria 13070
484 nmdc:mga0n895_42543_c1 3300050512 Unclassified 4420
485 nmdc:mga0n895_66813_c1 3300050512 Bacteria 3560
486 nmdc:mga0n895_74505_c1 3300050512 Unclassified 3372
487 nmdc:mga0rr50_159953_c1 3300050513 Unclassified 1827
488 nmdc:mga0rr50_29749_c1 3300050513 Unclassified 3857
489 nmdc:mga0rr50_33052_c1 3300050513 Bacteria 3693
490 nmdc:mga0rr50_35316_c1 3300050513 Bacteria 3589
491 nmdc:mga0rr50_41474_c1 3300050513 Bacteria 3354
492 nmdc:mga08x19_13672_c2 3300050514 Bacteria 3097
493 nmdc:mga08x19_45320_c1 3300050514 Bacteria 2810
494 nmdc:mga08x19_60908_c1 3300050514 Bacteria 2445
495 nmdc:mga08x19_914_c1 3300050514 Bacteria 18665
496 nmdc:mga0a205_3370_c1 3300050515 Bacteria 14235
497 Ga0495601_0014430 3300053077 Bacteria 4761
498 Ga0500635_0043896 3300053080 Bacteria 1505
499 Ga0495595_0016635 3300053084 Bacteria 3152
500 Ga0495619_0030213 3300053085 Bacteria 3507
501 Ga0500556_0000135 3300053104 Bacteria 62834
502 Ga0500593_000410 3300053117 Bacteria 16997
503 Ga0500620_024559 3300053155 Bacteria 1843
504 Ga0501084_0001556 3300054114 Bacteria 18209
505 Ga0501084_0004537 3300054114 Bacteria 11354
506 Ga0501084_0005114 3300054114 Bacteria 10738
507 Ga0501084_0007876 3300054114 Bacteria 8769
508 Ga0501084_0012214 3300054114 Bacteria 7107
509 Ga0501084_0030596 3300054114 Bacteria 4501
510 Ga0501082_0000052 3300060353 Bacteria 83141
511 Ga0501082_0002760 3300060353 Bacteria 15351
512 Ga0501082_0004763 3300060353 Bacteria 11835
513 Ga0501082_0117544 3300060353 Bacteria 2303
514 Ga0501082_0266958 3300060353 Unclassified 1489
515 Ga0530510_0003804 3300061734 Bacteria 10395
516 Ga0530510_0061306 3300061734 Bacteria 2723
517 2644089641 2643221615 Bacteria 5487866
518 2644319486 2643221657 Bacteria 5490246
519 2884697446 2884693830 Bacteria 11273186
520 2895431021 2895427314 Bacteria 13147766
521 2895452953 2895442618 Bacteria 11027144
522 Ga0070697_100131743
523 JGI25406J46586_10043855
524 Ga0065707_10118496
525 Ga0070683_100000001
526 Ga0070683_100029630
527 Ga0070683_100253501
528 Ga0070680_100013191
529 Ga0070688_100227933
530 Ga0070714_100033565
531 Ga0070713_100003050
532 Ga0070713_100022936
533 Ga0070713_100034136
534 Ga0070713_100047856
535 Ga0070710_10102351
536 Ga0070710_10114155
537 Ga0070711_100012049
538 Ga0070708_100017422
539 Ga0070708_100026075
540 Ga0070662_100001657
541 Ga0070681_10026602
542 Ga0070681_10037266
543 Ga0070681_10201015
544 Ga0070681_10303841
545 Ga0070706_100011493
546 Ga0070706_100017842
547 Ga0070707_100165237
548 Ga0070707_100282807
549 Ga0070698_100002704
550 Ga0070698_100007849
551 Ga0070698_100019924
552 Ga0070698_100065911
553 Ga0070698_100224627
554 Ga0070699_100016624
555 Ga0070679_100087887
556 Ga0070684_100000108
557 Ga0070684_100020286
558 Ga0070684_100127510
559 Ga0070697_100007239
560 Ga0070697_100018592
561 Ga0070697_100097555
562 Ga0070672_100309746
563 Ga0070696_100004095
564 Ga0070704_100004112
565 Ga0068855_100030434
566 Ga0068855_100099392
567 Ga0068857_100304040
568 Ga0068852_100070721
569 Ga0068852_100165814
570 Ga0068859_100000076
571 Ga0068863_100251565
572 Ga0068858_100104334
573 Ga0068860_100002898
574 Ga0081455_10027633
575 Ga0081455_10091173
576 Ga0081455_10131257
577 Ga0081538_10000725
578 Ga0081538_10004746
579 Ga0081538_10009036
580 Ga0081538_10016660
581 Ga0081540_1066830
582 Ga0081539_10009111
583 Ga0081539_10012374
584 Ga0070717_10002664
585 Ga0070717_10058551
586 Ga0070717_10141730
587 Ga0070717_10298509
588 Ga0075365_10118708
589 Ga0075368_10060941
590 Ga0070712_100152506
591 Ga0075367_10069835
592 Ga0075427_10001425
593 Ga0075428_100000020
594 Ga0075428_100004570
595 Ga0075428_100011591
596 Ga0075428_100012881
597 Ga0075428_100030474
598 Ga0075428_100064303
599 Ga0075430_100014411
600 Ga0075430_100015289
601 Ga0075430_100028897
602 Ga0075430_100075994
603 Ga0075430_100107116
604 Ga0075431_100009545
605 Ga0075431_100009611
606 Ga0075431_100014621
607 Ga0075431_100120287
608 Ga0075431_100138616
609 Ga0075431_100167197
610 Ga0075433_10001596
611 Ga0075434_100002592
612 Ga0075434_100056869
613 Ga0075429_100004694
614 Ga0075429_100007660
615 Ga0075429_100014559
616 Ga0075429_100104331
617 Ga0075436_100001080
618 Ga0075436_100016331
619 Ga0075436_100093576
620 Ga0075436_100182261
621 Ga0097620_100000076
622 Ga0075435_100009914
623 Ga0075435_100033213
624 Ga0075435_100041314
625 Ga0075435_100050249
626 Ga0075435_100175435
627 Ga0099794_10004645
628 Ga0099794_10006355
629 Ga0099795_10026248
630 Ga0105240_10018208
631 Ga0105240_10072072
632 Ga0105240_10327446
633 Ga0105240_10499156
634 Ga0111539_10007151
635 Ga0111539_10014447
636 Ga0111539_10070211
637 Ga0111539_10090433
638 Ga0111539_10213760
639 Ga0114129_10009803
640 Ga0114129_10031507
641 Ga0114129_10091414
642 Ga0105243_10070522
643 Ga0105242_10076536
644 Ga0105248_10001338
645 Ga0105248_10044361
646 Ga0105248_10058853
647 Ga0105237_10015074
648 Ga0105237_10051683
649 Ga0105237_10212267
650 Ga0105238_10257701
651 Ga0105238_10363521
652 Ga0105249_10003629
653 Ga0105239_10324064
654 Ga0157373_10100163
655 Ga0157370_10002869
656 Ga0157370_10189031
657 Ga0157369_10002714
658 Ga0157369_10042954
659 Ga0157369_10152130
660 Ga0157369_10255267
661 Ga0157374_10012262
662 Ga0157374_10015861
663 Ga0157378_10002325
664 Ga0157378_10013962
665 Ga0163162_10111758
666 Ga0163163_10085818
667 Ga0163163_10096539
668 Ga0163163_10177840
669 Ga0163163_10268088
670 Ga0163163_10469638
671 Ga0157380_10107512
672 Ga0157380_10141609
673 Ga0157379_10025682
674 Ga0157376_10096358
675 Ga0157376_10192242
676 Ga0213872_10000270
677 Ga0213872_10006737
678 Ga0213874_10001053
679 Ga0213876_10024981
680 Ga0213875_10010717
681 Ga0213875_10014153
682 Ga0224712_10019394
683 Ga0224712_10025875
684 Ga0207684_10013325
685 Ga0207684_10020420
686 Ga0207684_10049015
687 Ga0207684_10050747
688 Ga0207707_10021000
689 Ga0207707_10228631
690 Ga0207695_10009105
691 Ga0207695_10088936
692 Ga0207695_10141773
693 Ga0207695_10336731
694 Ga0207671_10222270
695 Ga0207663_10029929
696 Ga0207663_10055861
697 Ga0207660_10003318
698 Ga0207646_10006026
699 Ga0207646_10101516
700 Ga0207646_10236542
701 Ga0207646_10321911
702 Ga0207694_10183278
703 Ga0207687_10146943
704 Ga0207700_10139784
705 Ga0207664_10008218
706 Ga0207664_10064244
707 Ga0207670_10214211
708 Ga0207711_10067054
709 Ga0207711_10111198
710 Ga0207711_10186681
711 Ga0207661_10000005
712 Ga0207661_10020362
713 Ga0207661_10132663
714 Ga0207667_10038192
715 Ga0207667_10250909
716 Ga0207667_10258138
717 Ga0207712_10063687
718 Ga0207703_10078385
719 Ga0207639_10060820
720 Ga0207678_10016295
721 Ga0207702_10268952
722 Ga0207641_10333320
723 Ga0207675_100010668
724 Ga0207683_10153708
725 Ga0207698_10008597
726 Ga0207698_10327940
727 Ga0209588_1020224
728 Ga0207428_10000988
729 Ga0207428_10133349
730 Ga0268264_10167646
731 Ga0265323_10012435
732 Ga0265324_10013062
733 Ga0265760_10005431
734 Ga0265760_10024112
735 Ga0265330_10032953
736 Ga0265320_10005890
737 Ga0265325_10008339
738 Ga0265325_10068727
739 Ga0265340_10041727
740 Ga0265331_10006855
741 Ga0265331_10055753
742 Ga0265316_10001428
743 Ga0265316_10007570
744 Ga0265316_10009426
745 Ga0265316_10123718
746 Ga0307408_100012146
747 Ga0307408_100091512
748 Ga0316575_10026687
749 Ga0316579_10054869
750 Ga0265314_10009716
751 Ga0265342_10014788
752 Ga0265342_10046817
753 Ga0316578_10091401
754 Ga0316577_10018583
755 Ga0316577_10051793
756 Ga0307413_10015494
757 Ga0307410_10010500
758 Ga0307406_10024390
759 Ga0307412_10031109
760 Ga0307412_10043483
761 Ga0307409_100005507
762 Ga0307416_100000712
763 Ga0307416_100020762
764 Ga0307416_100090285
765 Ga0307415_100000656
766 Ga0307415_100010889
767 Ga0373926_0010265
768 Ga0373926_0046621
769 Ga0373934_0005622
770 Ga0373934_0014772
771 Ga0373923_0039149
772 Ga0373954_0005088
773 Ga0373956_0001219
774 Ga0373956_0036615
775 Ga0373957_0002719
776 Ga0373943_0098839
777 Ga0373955_0015831
778 Ga0373955_0072861
779 Ga0373955_0092269
780 Ga0373935_0032695
781 Ga0373927_0001593
782 Ga0373927_0002669
783 Ga0373927_0036585
784 Ga0373927_0113147
785 Ga0373933_0000590
786 Ga0373933_0006216
787 Ga0373947_0137567
788 Ga0373937_0000429
789 Ga0373937_0017200
790 Ga0373937_0021013
791 Ga0316582_0008089
792 Ga0316582_0024185
793 Ga0316584_0064477
794 Ga0316584_0072128
795 Ga0373925_0000106
796 Ga0373925_0025096
797 Ga0373925_0048084
798 Ga0373925_0201771
799 Ga0395900_0007328
800 Ga0395900_0030843
801 Ga0395900_0075699
802 Ga0395900_0101570
803 Ga0395905_0059668
804 Ga0395905_0122374
805 Ga0395905_0224981
806 Ga0316581_0009921
807 Ga0436364_0454994
808 Ga0436364_0732889
809 Ga0436364_1262834
810 Ga0436364_1524688
811 Ga0395901_0005924
812 Ga0395901_0065317
813 Ga0395901_0268113
814 Ga0400489_44610
815 Ga0436365_0565592
816 Ga0436365_0647949
817 Ga0436365_0686475
818 Ga0436365_1735198
819 Ga0436360_0152872
820 Ga0436361_0326575
821 Ga0436361_0420925
822 Ga0436361_0761235
823 Ga0436361_1092390
824 Ga0436363_0534313
825 Ga0436363_1143990
826 Ga0436363_1159644
827 Ga0436362_0569566
828 Ga0436362_1087173
829 Ga0439448_0000312
830 Ga0439450_000409
831 Ga0439451_004947
832 Ga0439463_000324
833 Ga0450916_000985
834 Ga0450901_004405
835 Ga0451577_0020472
836 Ga0439440_0000082
837 Ga0439440_0013723
838 Ga0466966_0052847
839 Ga0453684_0225946
840 Ga0466959_0028449
841 Ga0451576_0052200
842 Ga0451576_0208084
843 Ga0451576_0223708
844 Ga0451576_0499915
845 Ga0466967_0186876
846 Ga0495592_0087873
847 Ga0495651_0022637
848 Ga0495653_0093368
849 Ga0495580_0000327
850 Ga0495580_0042240
851 Ga0495580_0087687
852 Ga0495580_0127637
853 Ga0495580_0191600
854 Ga0495582_0019338
855 Ga0495664_0018386
856 Ga0495664_0051052
857 Ga0495618_0045938
858 Ga0495628_0034169
859 Ga0495628_0077861
860 Ga0495630_0011318
861 Ga0495652_0212848
862 Ga0495665_0098297
863 Ga0495640_0113924
864 Ga0495587_0008341
865 Ga0495587_0009146
866 Ga0495587_0078362
867 Ga0495645_0047756
868 Ga0495645_0060080
869 Ga0495645_0082363
870 Ga0495667_0056061
871 Ga0495634_0078046
872 Ga0495611_0077350
873 Ga0495635_0170156
874 Ga0495657_0164218
875 Ga0495623_0007368
876 Ga0495623_0029801
877 Ga0495613_0037900
878 Ga0495613_0060012
879 Ga0495581_0104781
880 Ga0495604_0006730
881 Ga0495604_0018523
882 Ga0495604_0102647
883 Ga0495674_0005296
884 Ga0495674_0073823
885 Ga0495674_0105542
886 Ga0495672_0000941
887 Ga0495676_0013589
888 Ga0495675_0002918
889 Ga0495675_0018631
890 Ga0495684_0010018
891 Ga0495684_0070208
892 Ga0495684_0274125
893 Ga0495602_0000216
894 Ga0495602_0017463
895 Ga0495602_0149410
896 Ga0496102_0024086
897 Ga0496104_0232658
898 Ga0496109_0004866
899 Ga0496115_0060707
900 Ga0501031_0002688
901 Ga0501031_0018521
902 Ga0501031_0027801
903 Ga0501032_0002290
904 Ga0501032_0079093
905 Ga0501033_0005077
906 Ga0501033_0028795
907 Ga0501034_0005640
908 Ga0501036_0000285
909 Ga0501036_0004797
910 Ga0501036_0045684
911 Ga0501036_0143075
912 Ga0501037_0001563
913 Ga0501037_0076038
914 Ga0501038_0002184
915 Ga0501038_0010192
916 Ga0501038_0041300
917 Ga0501039_0004563
918 Ga0501039_0008646
919 Ga0501039_0023949
920 Ga0501039_0036103
921 Ga0501039_0070086
922 Ga0501040_0008473
923 Ga0501040_0017001
924 Ga0501040_0101819
925 Ga0501041_0002171
926 Ga0501041_0010929
927 Ga0501041_0040875
928 Ga0501042_0002579
929 Ga0501042_0050363
930 Ga0501043_0012888
931 Ga0501046_0000268
932 Ga0501046_0002430
933 Ga0501046_0017458
934 Ga0501047_0015249
935 Ga0501047_0171404
936 Ga0501048_0133830
937 Ga0501067_0000866
938 Ga0501067_0130133
939 Ga0501068_0000584
940 Ga0501068_0000810
941 Ga0501068_0072287
942 Ga0501069_0002873
943 Ga0501069_0003484
944 Ga0501070_0088088
945 Ga0501071_0013329
946 Ga0501071_0013700
947 Ga0501071_0019088
948 Ga0501071_0033247
949 Ga0501071_0040517
950 Ga0501072_0000967
951 Ga0501072_0001475
952 Ga0501072_0070674
953 Ga0501074_0005187
954 Ga0501074_0010750
955 Ga0501075_0000201
956 Ga0501075_0009327
957 Ga0501075_0020209
958 Ga0501075_0052908
959 Ga0501076_0000411
960 Ga0501076_0000818
961 Ga0501076_0039631
962 Ga0501076_0056008
963 Ga0501076_0195710
964 Ga0501077_0001205
965 Ga0501077_0010619
966 Ga0501077_0012939
967 Ga0501077_0017282
968 Ga0501079_0000449
969 Ga0501079_0003613
970 Ga0501079_0005522
971 Ga0501079_0044343
972 Ga0501079_0086557
973 Ga0501080_0000059
974 Ga0501080_0040146
975 Ga0501080_0086946
976 Ga0501081_0000377
977 Ga0501081_0010858
978 Ga0501083_0000601
979 Ga0501083_0003341
980 Ga0501083_0006373
981 Ga0501083_0013781
982 Ga0501035_0176070
983 Ga0501044_0013563
984 Ga0501045_0004823
985 Ga0501045_0005263
986 Ga0501045_0010788
987 Ga0501045_0012193
988 Ga0501045_0029706
989 nmdc:mga05p37_166671_c1
990 nmdc:mga05p37_2144_c1
991 nmdc:mga05p37_365558_c1
992 nmdc:mga09592_1464_c1
993 nmdc:mga09592_4556_c1
994 nmdc:mga0qj67_13642_c1
995 nmdc:mga0qj67_15357_c1
996 nmdc:mga0qj67_18435_c1
997 nmdc:mga06r32_14694_c1
998 nmdc:mga06r32_161584_c1
999 nmdc:mga06r32_390771_c1
1000 nmdc:mga06r32_70043_c1
1001 nmdc:mga08y16_29820_c1
1002 nmdc:mga08y16_2983_c1
1003 nmdc:mga08y16_67548_c1
1004 nmdc:mga0n895_3223_c1
1005 nmdc:mga0n895_42543_c1
1006 nmdc:mga0n895_66813_c1
1007 nmdc:mga0n895_74505_c1
1008 nmdc:mga0rr50_159953_c1
1009 nmdc:mga0rr50_29749_c1
1010 nmdc:mga0rr50_33052_c1
1011 nmdc:mga0rr50_35316_c1
1012 nmdc:mga0rr50_41474_c1
1013 nmdc:mga08x19_13672_c2
1014 nmdc:mga08x19_45320_c1
1015 nmdc:mga08x19_60908_c1
1016 nmdc:mga08x19_914_c1
1017 nmdc:mga0a205_3370_c1
1018 Ga0495601_0014430
1019 Ga0500635_0043896
1020 Ga0495595_0016635
1021 Ga0495619_0030213
1022 Ga0500556_0000135
1023 Ga0500593_000410
1024 Ga0500620_024559
1025 Ga0501084_0001556
1026 Ga0501084_0004537
1027 Ga0501084_0005114
1028 Ga0501084_0007876
1029 Ga0501084_0012214
1030 Ga0501084_0030596
1031 Ga0501082_0000052
1032 Ga0501082_0002760
1033 Ga0501082_0004763
1034 Ga0501082_0117544
1035 Ga0501082_0266958
1036 Ga0530510_0003804
1037 Ga0530510_0061306
1038 2644089641
1039 2644319486
1040 2884697446
1041 2895431021
1042 2895452953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02374

ArsA_ATPase

Anion-transporting ATPase

72

380

0.97

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

401

463

0.97

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

74

356

0.75

PF13614

AAA_31

AAA domain

72

229

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
3io3-assembly1.cif.gz_A get3 with adp from d. hansenii in closed form 0.8266 1 312
3zq6-assembly2.cif.gz_C adp-alf4 complex of m. therm. trc40 0.8228 2 299
3iqx-assembly1.cif.gz_B adp complex of c.therm. get3 in closed form 0.8134 1 299
2woj-assembly1.cif.gz_C adp-alf4 complex of s. cerevisiae get3 0.805 2 294
3zq6-assembly1.cif.gz_B adp-alf4 complex of m. therm. trc40 0.7994 2 299
ID Description Score Start End Superfamily
af_O53518_307_373_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9506 323 385 2.60.40.790
af_O53518_307_373_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8839 323 385 2.60.40.790
3igfB02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8425 309 380 2.60.40.790
3io3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8266 1 312 3.40.50.300
3igfB02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8215 309 380 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A537YHW6-F1-model_v4 ArsA family ATPase 0.9828 190 386 GO:0005524
GO:0016887
AF-T1BC96-F1-model_v4 Arsenite-activated ATPase ArsA 0.9673 218 380 GO:0005524
GO:0016887
AF-T2JMW1-F1-model_v4 Arsenical pump-driving ATPase (EC 3.6.3.16) 0.9672 214 385 GO:0005524
GO:0016887
AF-A0YML9-F1-model_v4 Anion-transporting ATPase 0.9666 215 386 GO:0005524
GO:0016887
AF-A0A843FXL9-F1-model_v4 ArsA family ATPase 0.9627 207 385 GO:0005524
GO:0016887

Map