F458651

General Info

Members Datasets Scaffolds Average Seq Length
521 384 1042 170

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100455473|Ga0070670_1004554731
Length 171
Sequence MNIENFRPAFVYTIYISSTPDQVWQALTTAEFSRKYFSGLAVETELKVGGAFVVRMPDGSVHISGEVIECDPPRKLTVTWNVNWPGLVEKLGITLVTYQIEPAGDGTIRLTLTQAHDRPLSDDILSGGRTGWPAMLSSLKSLLENGNALVIRMEPPLRMLAALKEMGIKTP

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
59 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
60 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
61 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
62 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
119 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
120 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
121 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
122 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
123 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
124 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
125 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
227 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
232 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
233 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
237 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
241 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
242 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
243 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
246 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
247 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
248 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
253 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
254 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
255 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
256 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
257 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
260 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
261 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
262 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
263 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
264 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
274 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
275 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
276 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
277 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
278 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
279 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
280 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
281 2643221651 Afipia sp. Root123D2 Isolate Unclassified
282 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
283 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
284 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
285 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
286 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
287 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
288 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
289 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
290 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
291 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
292 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
293 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
294 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
295 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
296 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
297 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
298 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
299 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
300 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
301 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
302 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
303 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
304 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
305 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
306 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
307 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
308 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
309 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
310 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
311 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
312 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
313 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
314 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
315 2922368715
316 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
317 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
318 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
319 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
320 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
321 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
322 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
323 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
324 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
325 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
326 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
327 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
328 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
329 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
330 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
331 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
332 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
333 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
334 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
335 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
336 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
337 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
338 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
339 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
340 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
341 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
342 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
343 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
344 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
345 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
346 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
347 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
348 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
349 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
350 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
351 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
352 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
353 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
354 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
355 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
356 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
357 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
358 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
359 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
360 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
361 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
362 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
363 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
364 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
365 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
366 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
367 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
368 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
369 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
370 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
371 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
372 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
373 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
374 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
375 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
376 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
377 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
378 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
379 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
380 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
381 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
382 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
383 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
384 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.65
Metatranscriptomes 0
Isolates 21.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.73
Nodule 17.08
Rhizoplane 3.84
Rhizosphere 45.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100455473 3300005331 Bacteria 1134
2 RicEn_C1035 2010549000 Bacteria 1448
3 JGI25153J46596_10006212 3300003215 Bacteria 6113
4 JGI25153J46596_10026056 3300003215 Bacteria 2078
5 JGI25153J46596_10027181 3300003215 Bacteria 2010
6 JGI25153J46596_10027530 3300003215 Bacteria 1989
7 rootH1_10320436 3300003323 Bacteria 1784
8 JGI25160J50197_1027724 3300003354 Bacteria 1535
9 Ga0055542_1001822 3300003762 Bacteria 8723
10 Ga0055524_1032917 3300003775 Bacteria 1460
11 Ga0055531_10001156 3300003794 Bacteria 20372
12 Ga0065165_1001425 3300005262 Bacteria 25961
13 Ga0065165_1001827 3300005262 Bacteria 20819
14 Ga0065165_1004722 3300005262 Bacteria 8180
15 Ga0070658_10044514 3300005327 Bacteria 3587
16 Ga0070658_10259237 3300005327 Bacteria 1476
17 Ga0070658_10845448 3300005327 Bacteria 795
18 Ga0068868_100821260 3300005338 Bacteria 840
19 Ga0070661_100433539 3300005344 Bacteria 1043
20 Ga0070667_100242113 3300005367 Bacteria 1611
21 Ga0070711_100122874 3300005439 Bacteria 1923
22 Ga0070708_100342520 3300005445 Bacteria 1409
23 Ga0070663_100030232 3300005455 Bacteria 3709
24 Ga0070663_100048673 3300005455 Bacteria 3007
25 Ga0068867_100095261 3300005459 Bacteria 2265
26 Ga0070706_100455058 3300005467 Bacteria 1191
27 Ga0068853_101043482 3300005539 Bacteria 788
28 Ga0070665_100006911 3300005548 Bacteria 11532
29 Ga0070665_100101629 3300005548 Bacteria 2879
30 Ga0070665_100314803 3300005548 Bacteria 1569
31 Ga0070665_101086516 3300005548 Bacteria 811
32 Ga0068855_100955399 3300005563 Bacteria 902
33 Ga0068854_101195877 3300005578 Bacteria 681
34 Ga0068852_100101745 3300005616 Bacteria 2595
35 Ga0068852_100338097 3300005616 Bacteria 1467
36 Ga0068852_101096384 3300005616 Bacteria 816
37 Ga0068851_10145763 3300005834 Bacteria 1291
38 Ga0068870_10313799 3300005840 Bacteria 994
39 Ga0068858_100863818 3300005842 Bacteria 884
40 Ga0068858_101527092 3300005842 Bacteria 659
41 Ga0068860_100002522 3300005843 Bacteria 19200
42 Ga0081455_10035075 3300005937 Bacteria 4488
43 Ga0081540_1009882 3300005983 Bacteria 6519
44 Ga0070717_10963040 3300006028 Bacteria 777
45 Ga0075365_10113543 3300006038 Bacteria 1863
46 Ga0075365_10168469 3300006038 Bacteria 1528
47 Ga0075363_100086840 3300006048 Bacteria 1718
48 Ga0075363_100625052 3300006048 Bacteria 647
49 Ga0070715_10498983 3300006163 Bacteria 696
50 Ga0075367_10052037 3300006178 Bacteria 2423
51 Ga0075367_10333390 3300006178 Bacteria 956
52 Ga0075369_10040022 3300006186 Bacteria 2003
53 Ga0075369_10174769 3300006186 Bacteria 987
54 Ga0075366_10083111 3300006195 Bacteria 1914
55 Ga0097621_101507168 3300006237 Bacteria 638
56 Ga0075370_10222059 3300006353 Bacteria 1117
57 Ga0068871_100214763 3300006358 Bacteria 1665
58 Ga0099794_10115169 3300007265 Bacteria 1349
59 Ga0099794_10116368 3300007265 Bacteria 1342
60 Ga0105245_10276004 3300009098 Bacteria 1641
61 Ga0105245_10561236 3300009098 Bacteria 1164
62 Ga0105247_10380914 3300009101 Bacteria 1000
63 Ga0114129_10087116 3300009147 Bacteria 4331
64 Ga0105243_10831445 3300009148 Bacteria 913
65 Ga0105241_10207439 3300009174 Bacteria 1640
66 Ga0105242_10766693 3300009176 Bacteria 951
67 Ga0105242_11418769 3300009176 Bacteria 722
68 Ga0105248_10395251 3300009177 Bacteria 1557
69 Ga0105237_10258772 3300009545 Bacteria 1743
70 Ga0105238_10064228 3300009551 Bacteria 3671
71 Ga0105249_11232744 3300009553 Bacteria 819
72 Ga0099796_10021176 3300010159 Bacteria 1999
73 Ga0105239_10050749 3300010375 Bacteria 4549
74 Ga0105239_10260895 3300010375 Bacteria 1947
75 Ga0105239_10820439 3300010375 Bacteria 1066
76 Ga0157373_10129358 3300013100 Bacteria 1775
77 Ga0157374_11241972 3300013296 Bacteria 767
78 Ga0157372_10986653 3300013307 Bacteria 976
79 Ga0157375_10026462 3300013308 Bacteria 5407
80 Ga0157379_10310793 3300014968 Bacteria 1438
81 Ga0214544_1000163 3300021320 Bacteria 101631
82 Ga0214542_1000156 3300021321 Bacteria 101631
83 Ga0214545_1000078 3300021324 Bacteria 101631
84 Ga0214543_1000136 3300021327 Bacteria 101629
85 Ga0209563_101608 3300025230 Bacteria 5843
86 Ga0207425_1040708 3300025245 Bacteria 886
87 Ga0209677_105532 3300025253 Bacteria 3269
88 Ga0209148_1000333 3300025254 Bacteria 64490
89 Ga0209129_1028811 3300025258 Bacteria 941
90 Ga0209233_1002558 3300025261 Bacteria 6631
91 Ga0209233_1016510 3300025261 Bacteria 2032
92 Ga0209455_1004271 3300025272 Bacteria 4744
93 Ga0209564_1055367 3300025295 Bacteria 929
94 Ga0209758_1000109 3300025297 Bacteria 214759
95 Ga0209758_1000938 3300025297 Bacteria 39351
96 Ga0209758_1002619 3300025297 Bacteria 17898
97 Ga0209758_1008100 3300025297 Bacteria 6924
98 Ga0209758_1132499 3300025297 Bacteria 657
99 Ga0209256_1003201 3300025299 Bacteria 11828
100 Ga0207426_1002293 3300025302 Bacteria 12619
101 Ga0207426_1040946 3300025302 Bacteria 1440
102 Ga0209257_1001604 3300025304 Bacteria 25883
103 Ga0207688_10328910 3300025901 Bacteria 939
104 Ga0207705_10167236 3300025909 Bacteria 1654
105 Ga0207705_10179383 3300025909 Bacteria 1598
106 Ga0207705_10193875 3300025909 Bacteria 1537
107 Ga0207705_10560340 3300025909 Bacteria 888
108 Ga0207684_10166756 3300025910 Bacteria 1898
109 Ga0207654_10732200 3300025911 Bacteria 712
110 Ga0207671_10112415 3300025914 Bacteria 2074
111 Ga0207660_10724004 3300025917 Bacteria 812
112 Ga0207657_10013645 3300025919 Bacteria 7964
113 Ga0207649_10119488 3300025920 Bacteria 1775
114 Ga0207649_10814196 3300025920 Bacteria 729
115 Ga0207694_10111555 3300025924 Bacteria 2176
116 Ga0207694_10193334 3300025924 Bacteria 1654
117 Ga0207664_11695014 3300025929 Bacteria 554
118 Ga0207709_10540244 3300025935 Bacteria 915
119 Ga0207665_10522443 3300025939 Bacteria 919
120 Ga0207668_10228958 3300025972 Bacteria 1497
121 Ga0207703_10274573 3300026035 Bacteria 1528
122 Ga0207639_10439490 3300026041 Bacteria 1182
123 Ga0207678_10036971 3300026067 Bacteria 4250
124 Ga0207678_10068776 3300026067 Bacteria 3038
125 Ga0207678_10279546 3300026067 Bacteria 1432
126 Ga0207708_10192773 3300026075 Bacteria 1623
127 Ga0207641_10370707 3300026088 Bacteria 1369
128 Ga0207676_10594845 3300026095 Bacteria 1062
129 Ga0207683_10018090 3300026121 Bacteria 6009
130 Ga0207683_10396921 3300026121 Bacteria 1269
131 Ga0207698_10215655 3300026142 Bacteria 1730
132 Ga0207698_10269647 3300026142 Bacteria 1568
133 Ga0207698_11002223 3300026142 Bacteria 846
134 Ga0209588_1001521 3300027671 Bacteria 6116
135 Ga0209588_1058402 3300027671 Bacteria 1247
136 Ga0268266_10019611 3300028379 Bacteria 5762
137 Ga0268266_10533030 3300028379 Bacteria 1123
138 Ga0268266_10717279 3300028379 Bacteria 964
139 Ga0268265_10572326 3300028380 Bacteria 1075
140 Ga0268264_10000458 3300028381 Bacteria 55551
141 Ga0265337_1007952 3300028556 Bacteria 3910
142 Ga0265319_1015907 3300028563 Bacteria 2897
143 Ga0265334_10020947 3300028573 Bacteria 2674
144 Ga0265318_10009409 3300028577 Bacteria 4297
145 Ga0265323_10023699 3300028653 Bacteria 2338
146 Ga0265336_10000785 3300028666 Bacteria 16778
147 Ga0307515_10018157 3300028794 Bacteria 12759
148 Ga0265338_10002598 3300028800 Bacteria 26701
149 Ga0307513_10249642 3300031456 Bacteria 1572
150 Ga0307508_10135090 3300031616 Bacteria 2070
151 Ga0307412_10015026 3300031911 Bacteria 4580
152 Ga0307414_11277151 3300032004 Bacteria 681
153 Ga0307411_11487374 3300032005 Bacteria 622
154 Ga0307510_10038375 3300033180 Bacteria 5297
155 Ga0395899_0427569 3300037312 Bacteria 871
156 Ga0395900_0098487 3300037418 Bacteria 3004
157 Ga0395900_0286381 3300037418 Bacteria 1638
158 Ga0395898_0272457 3300037466 Bacteria 1614
159 Ga0395905_0014360 3300037471 Bacteria 7567
160 Ga0395905_0014770 3300037471 Bacteria 7445
161 Ga0395901_0103718 3300038443 Bacteria 2984
162 Ga0395901_0250715 3300038443 Bacteria 1844
163 Ga0451793_1499122 3300041452 Bacteria 1388
164 Ga0451797_0866107 3300041453 Bacteria 1725
165 Ga0451833_0526616 3300041491 Bacteria 2000
166 Ga0451835_1133548 3300041492 Bacteria 726
167 Ga0451847_0771734 3300041503 Bacteria 1444
168 Ga0451851_0965009 3300041507 Bacteria 825
169 Ga0451843_1756506 3300041509 Bacteria 686
170 Ga0451855_0667162 3300041511 Bacteria 945
171 Ga0439458_0029761 3300042157 Bacteria 1297
172 Ga0439459_0010520 3300042438 Bacteria 1616
173 Ga0466972_0033336 3300044658 Bacteria 2526
174 Ga0466965_0075355 3300044683 Bacteria 1701
175 Ga0466968_0197691 3300044735 Bacteria 941
176 Ga0466967_0394449 3300045976 Bacteria 1346
177 Ga0495617_170473 3300046452 Bacteria 688
178 Ga0495603_0309049 3300046455 Bacteria 908
179 Ga0495638_0369811 3300046460 Bacteria 752
180 Ga0495651_0035002 3300046462 Bacteria 3913
181 Ga0495651_0046976 3300046462 Bacteria 3340
182 Ga0495651_0219718 3300046462 Bacteria 1316
183 Ga0495653_0041655 3300046463 Bacteria 3583
184 Ga0495653_0340338 3300046463 Bacteria 967
185 Ga0495605_0110065 3300046474 Bacteria 1258
186 Ga0495662_0355908 3300046476 Bacteria 720
187 Ga0495664_0010823 3300046477 Bacteria 5128
188 Ga0495596_0151433 3300046500 Bacteria 901
189 Ga0495607_0093755 3300046501 Bacteria 1621
190 Ga0495583_0027652 3300046506 Bacteria 2797
191 Ga0495583_0285171 3300046506 Bacteria 658
192 Ga0495606_0005306 3300046507 Bacteria 12411
193 Ga0495606_0184947 3300046507 Bacteria 1198
194 Ga0495606_0224547 3300046507 Bacteria 1056
195 Ga0495606_0457063 3300046507 Bacteria 653
196 Ga0495606_0486602 3300046507 Bacteria 625
197 Ga0495606_0570158 3300046507 Bacteria 560
198 Ga0495608_0027531 3300046511 Bacteria 3868
199 Ga0495608_0398827 3300046511 Bacteria 842
200 Ga0495610_0139677 3300046512 Bacteria 1044
201 Ga0495616_0077636 3300046513 Bacteria 1594
202 Ga0495620_0108810 3300046515 Bacteria 1100
203 Ga0495628_0026661 3300046516 Bacteria 4708
204 Ga0495628_0995521 3300046516 Bacteria 577
205 Ga0495643_0149892 3300046522 Bacteria 1156
206 Ga0495648_0126683 3300046524 Bacteria 1363
207 Ga0495648_0194301 3300046524 Bacteria 1021
208 Ga0495648_0275911 3300046524 Bacteria 799
209 Ga0495648_0408969 3300046524 Bacteria 604
210 Ga0495652_0014451 3300046529 Bacteria 7086
211 Ga0495652_0032544 3300046529 Bacteria 4559
212 Ga0495652_0172339 3300046529 Bacteria 1669
213 Ga0495640_0027774 3300046533 Bacteria 4078
214 Ga0495587_0060332 3300046536 Bacteria 2225
215 Ga0495597_0256629 3300046542 Bacteria 686
216 Ga0495645_0303919 3300046543 Bacteria 1041
217 Ga0495667_0384574 3300046559 Bacteria 885
218 Ga0495668_0189047 3300046616 Bacteria 1128
219 Ga0495668_0255044 3300046616 Bacteria 960
220 Ga0495634_0072212 3300046642 Bacteria 2270
221 Ga0495611_0035740 3300046648 Bacteria 2202
222 Ga0495625_0018524 3300046660 Bacteria 5432
223 Ga0495625_0039891 3300046660 Bacteria 3427
224 Ga0495625_0072248 3300046660 Bacteria 2420
225 Ga0495661_0151571 3300046665 Bacteria 1252
226 Ga0495588_0098374 3300046674 Bacteria 1536
227 Ga0495657_0035840 3300046675 Bacteria 3435
228 Ga0495657_0049630 3300046675 Bacteria 2825
229 Ga0495599_0028675 3300046678 Bacteria 3488
230 Ga0495623_0058377 3300046679 Bacteria 2426
231 Ga0495646_0046096 3300046680 Bacteria 2660
232 Ga0495613_0286720 3300046689 Bacteria 1142
233 Ga0495624_0029342 3300046690 Bacteria 3589
234 Ga0495624_0265077 3300046690 Bacteria 1038
235 Ga0495670_0008140 3300046691 Bacteria 5153
236 Ga0495649_0020410 3300046694 Bacteria 3717
237 Ga0495600_0007070 3300046809 Bacteria 6857
238 Ga0495600_0022089 3300046809 Bacteria 4083
239 Ga0495604_0030745 3300047317 Bacteria 4262
240 Ga0495604_0069358 3300047317 Bacteria 2672
241 Ga0495604_0128166 3300047317 Bacteria 1827
242 Ga0495604_0675191 3300047317 Bacteria 657
243 Ga0495674_0019168 3300047319 Bacteria 6355
244 Ga0495674_0692177 3300047319 Bacteria 801
245 Ga0495672_0271304 3300047320 Bacteria 814
246 Ga0495676_0028615 3300047321 Bacteria 4755
247 Ga0495680_0001058 3300047322 Bacteria 30479
248 Ga0495687_177702 3300047443 Bacteria 698
249 Ga0495673_0061013 3300047469 Bacteria 1616
250 Ga0495686_0057250 3300047472 Bacteria 2434
251 Ga0495686_0072969 3300047472 Bacteria 2109
252 Ga0495686_0379155 3300047472 Bacteria 763
253 Ga0495593_0132217 3300047673 Bacteria 1266
254 Ga0495602_0125001 3300048088 Bacteria 2062
255 Ga0495602_0427449 3300048088 Bacteria 939
256 Ga0496100_0178255 3300048903 Bacteria 1535
257 Ga0496100_0511756 3300048903 Bacteria 926
258 Ga0496101_0081607 3300048904 Bacteria 2392
259 Ga0496102_0715725 3300048905 Bacteria 924
260 Ga0496102_1129614 3300048905 Bacteria 703
261 Ga0496103_0251095 3300048906 Bacteria 1138
262 Ga0496104_0001403 3300048907 Bacteria 20868
263 Ga0496104_0584864 3300048907 Bacteria 1027
264 Ga0496105_0003256 3300048908 Bacteria 11964
265 Ga0496105_0003429 3300048908 Bacteria 11732
266 Ga0496107_0060935 3300048910 Bacteria 2731
267 Ga0496110_0389471 3300048913 Bacteria 1270
268 Ga0496111_0241990 3300048914 Bacteria 1340
269 Ga0496111_0747337 3300048914 Bacteria 710
270 Ga0496113_0050572 3300048916 Bacteria 3099
271 Ga0496113_0096716 3300048916 Bacteria 2283
272 Ga0496113_0913069 3300048916 Bacteria 694
273 Ga0496114_1048840 3300048917 Bacteria 699
274 Ga0496116_0022263 3300048919 Bacteria 4755
275 Ga0496116_0216676 3300048919 Bacteria 986
276 Ga0496117_0085179 3300048920 Bacteria 2059
277 Ga0496118_0047330 3300048921 Bacteria 3334
278 Ga0496118_0093540 3300048921 Bacteria 2059
279 Ga0496118_0267483 3300048921 Bacteria 960
280 Ga0496119_0032305 3300048922 Bacteria 3490
281 Ga0496119_0092541 3300048922 Bacteria 1715
282 Ga0496120_0002168 3300048923 Bacteria 20847
283 Ga0496120_0155711 3300048923 Bacteria 1144
284 Ga0496121_0008599 3300048924 Bacteria 11955
285 Ga0496121_0022709 3300048924 Bacteria 6072
286 Ga0496121_0024552 3300048924 Bacteria 5759
287 Ga0496121_0107757 3300048924 Bacteria 2132
288 Ga0496121_0337206 3300048924 Bacteria 1009
289 Ga0496121_0343035 3300048924 Bacteria 997
290 Ga0496122_0267963 3300048925 Bacteria 943
291 Ga0496122_0302616 3300048925 Bacteria 861
292 Ga0496124_0144148 3300048927 Bacteria 1876
293 Ga0496125_0324892 3300048928 Bacteria 931
294 Ga0496126_0021246 3300048929 Bacteria 6344
295 Ga0496126_0029121 3300048929 Bacteria 5249
296 Ga0496126_0052295 3300048929 Bacteria 3713
297 Ga0496126_0061654 3300048929 Bacteria 3368
298 Ga0496126_0084595 3300048929 Bacteria 2797
299 Ga0496126_0576661 3300048929 Bacteria 889
300 Ga0496126_0901532 3300048929 Bacteria 670
301 Ga0495682_0011441 3300049460 Bacteria 3414
302 Ga0501032_0101427 3300049569 Bacteria 1907
303 Ga0501032_0294467 3300049569 Bacteria 1050
304 Ga0501032_0809511 3300049569 Bacteria 591
305 Ga0501033_0079230 3300049570 Bacteria 2411
306 Ga0501033_0171050 3300049570 Bacteria 1560
307 Ga0501034_0078812 3300049571 Bacteria 3298
308 Ga0501034_0405369 3300049571 Bacteria 1286
309 Ga0501036_0117880 3300049572 Bacteria 2242
310 Ga0501036_0118298 3300049572 Bacteria 2238
311 Ga0501036_0147780 3300049572 Bacteria 1983
312 Ga0501038_0199521 3300049574 Bacteria 1606
313 Ga0501038_0430495 3300049574 Bacteria 1017
314 Ga0501038_0468811 3300049574 Bacteria 966
315 Ga0501043_0107757 3300049579 Bacteria 2188
316 Ga0501043_0187710 3300049579 Bacteria 1608
317 Ga0501043_0569475 3300049579 Bacteria 840
318 Ga0501047_0086380 3300049581 Bacteria 3014
319 Ga0501047_0110674 3300049581 Bacteria 2629
320 Ga0501048_0099214 3300049582 Bacteria 2055
321 Ga0501048_0104528 3300049582 Bacteria 1999
322 Ga0501067_0088565 3300049583 Bacteria 1718
323 Ga0501068_0102883 3300049584 Bacteria 1771
324 Ga0501070_0408614 3300049586 Bacteria 1097
325 Ga0501070_0685487 3300049586 Bacteria 811
326 Ga0501073_0177569 3300049589 Bacteria 1474
327 Ga0501035_0119122 3300049822 Bacteria 2309
328 Ga0501035_0554500 3300049822 Bacteria 941
329 Ga0501035_0589281 3300049822 Bacteria 907
330 Ga0501035_0911705 3300049822 Bacteria 695
331 Ga0501044_0042572 3300049823 Bacteria 4722
332 Ga0501044_0098158 3300049823 Bacteria 2949
333 Ga0501044_0392942 3300049823 Bacteria 1300
334 Ga0501044_0559406 3300049823 Bacteria 1040
335 nmdc:mga03n38_480159_c1 3300050490 Bacteria 695
336 nmdc:mga03n38_542782_c1 3300050490 Bacteria 657
337 nmdc:mga00v17_394787_c1 3300050491 Bacteria 899
338 nmdc:mga0yw44_124431_c1 3300050492 Bacteria 1664
339 nmdc:mga0yw44_26598_c1 3300050492 Bacteria 3307
340 nmdc:mga0yw44_761374_c1 3300050492 Bacteria 658
341 nmdc:mga0k408_307474_c1 3300050493 Bacteria 946
342 nmdc:mga06z11_396839_c1 3300050494 Bacteria 830
343 nmdc:mga06z11_95107_c1 3300050494 Bacteria 1625
344 nmdc:mga07m45_29166_c1 3300050496 Bacteria 3049
345 nmdc:mga0sz30_162281_c1 3300050516 Bacteria 990
346 nmdc:mga0sz30_207309_c1 3300050516 Bacteria 871
347 Ga0495601_0115219 3300053077 Bacteria 1743
348 Ga0500635_0011523 3300053080 Bacteria 2515
349 Ga0495655_0139822 3300053083 Bacteria 753
350 Ga0495595_0172853 3300053084 Bacteria 1070
351 Ga0500578_0078843 3300053086 Bacteria 2096
352 Ga0500578_0129969 3300053086 Bacteria 1580
353 Ga0500578_0184325 3300053086 Bacteria 1285
354 Ga0500643_000013 3300053087 Bacteria 324296
355 Ga0500643_018679 3300053087 Bacteria 2296
356 Ga0500644_0013386 3300053088 Bacteria 2290
357 Ga0500646_0101118 3300053090 Bacteria 905
358 Ga0500647_0028923 3300053091 Bacteria 2626
359 Ga0500583_0230215 3300053092 Bacteria 917
360 Ga0500651_0093712 3300053093 Bacteria 1846
361 Ga0500651_0107560 3300053093 Bacteria 1704
362 Ga0500651_0281957 3300053093 Bacteria 958
363 Ga0500566_0000192 3300053094 Bacteria 31868
364 Ga0500566_0101561 3300053094 Bacteria 1576
365 Ga0500640_051554 3300053095 Bacteria 1799
366 Ga0500641_0021761 3300053096 Bacteria 2449
367 Ga0500556_0000238 3300053104 Bacteria 44627
368 Ga0500557_000038 3300053105 Bacteria 69178
369 Ga0500569_041480 3300053109 Bacteria 1350
370 Ga0500592_000637 3300053116 Bacteria 5743
371 Ga0500594_0038425 3300053118 Bacteria 1297
372 Ga0500595_003356 3300053119 Bacteria 7515
373 Ga0500595_004576 3300053119 Bacteria 6171
374 Ga0500595_044347 3300053119 Bacteria 1410
375 Ga0500607_043318 3300053121 Bacteria 2426
376 Ga0500608_006526 3300053122 Bacteria 4758
377 Ga0500618_065766 3300053125 Bacteria 815
378 Ga0500642_0012959 3300053130 Bacteria 3045
379 Ga0500652_002951 3300053131 Bacteria 5124
380 Ga0500652_058516 3300053131 Bacteria 1583
381 Ga0500655_028228 3300053133 Bacteria 1073
382 Ga0500658_0042410 3300053134 Bacteria 1828
383 Ga0500559_0006971 3300053136 Bacteria 5052
384 Ga0500564_118001 3300053138 Bacteria 1158
385 Ga0500568_0041493 3300053139 Bacteria 1848
386 Ga0500577_0048011 3300053142 Bacteria 1590
387 Ga0500577_0307284 3300053142 Bacteria 692
388 Ga0500588_0066394 3300053146 Bacteria 1171
389 Ga0500588_0121600 3300053146 Bacteria 921
390 Ga0500590_266612 3300053148 Bacteria 668
391 Ga0500616_0000048 3300053153 Bacteria 313108
392 Ga0500616_0000197 3300053153 Bacteria 98372
393 Ga0500619_066480 3300053154 Bacteria 1193
394 Ga0500620_031368 3300053155 Bacteria 1684
395 Ga0500622_0305434 3300053156 Bacteria 676
396 Ga0500627_0036212 3300053158 Bacteria 2100
397 Ga0500627_0395505 3300053158 Bacteria 589
398 Ga0500633_0054324 3300053160 Bacteria 1392
399 Ga0500638_030090 3300053162 Bacteria 2613
400 Ga0500636_0000390 3300053177 Bacteria 24204
401 Ga0500636_0111502 3300053177 Bacteria 1545
402 Ga0500637_0148295 3300053178 Bacteria 1356
403 Ga0500625_000357 3300053729 Bacteria 11625
404 Ga0500645_019797 3300053730 Bacteria 2091
405 Ga0500601_000227 3300053737 Bacteria 11147
406 Ga0501084_0693083 3300054114 Bacteria 859
407 Ga0501082_0393115 3300060353 Bacteria 1210
408 Ga0530510_0246407 3300061734 Bacteria 1331
409 Ga0530510_0477850 3300061734 Bacteria 944
410 2507511819 2507262055 Bacteria 8048963
411 2508545484 2508501009 Bacteria 7784016
412 2508694304 2508501042 Bacteria 8719808
413 2513701918 2513237102 Bacteria 7703324
414 2515624775 2515154112 Bacteria 8294334
415 2528853568 2528768022 Bacteria 10457665
416 2617349574 2617270735 Bacteria 9163226
417 2617376766 2617270741 Bacteria 8201522
418 2644287205 2643221651 Bacteria 4798932
419 2824624705 2824617872 Bacteria 8814715
420 2824633639 2824626560 Bacteria 8813858
421 2824642512 2824635225 Bacteria 8785348
422 2824650196 2824644064 Bacteria 8743947
423 2824663530 2824661429 Bacteria 9877870
424 2824685536 2824679649 Bacteria 8248951
425 2824720036 2824714736 Bacteria 8717648
426 2824730383 2824723954 Bacteria 8758240
427 2824739123 2824732956 Bacteria 7810675
428 2824750637 2824746037 Bacteria 7911610
429 2824780197 2824773399 Bacteria 8360218
430 2842042055 2842038055 Bacteria 8002051
431 2842050098 2842045827 Bacteria 8006841
432 2849077321 2849076700 Bacteria 7039503
433 2857515069 2857509624 Bacteria 7472071
434 2857526940 2857524615 Bacteria 6615449
435 2874593659 2874590934 Bacteria 8299676
436 2874624908 2874620515 Bacteria 8290088
437 2874631037 2874628541 Bacteria 8630250
438 2874648328 2874645413 Bacteria 8214782
439 2876774720 2876771140 Bacteria 8287509
440 2876821511 2876818435 Bacteria 8274608
441 2879079288 2879074833 Bacteria 8279565
442 2879102669 2879099564 Bacteria 10442239
443 2879131291 2879127579 Bacteria 8294491
444 2879144642 2879142872 Bacteria 8267021
445 2881371188 2881364244 Bacteria 7710352
446 2885374108 2885366525 Bacteria 8326213
447 2885413802 2885409591 Bacteria 9235467
448 2888391875 2888388044 Bacteria 7304136
449 2904669117 2904666416 Bacteria 8226587
450 2908782662 2908775508 Bacteria 8092255
451 2919078060 2919073203 Bacteria 6531949
452 2922370623
453 2922396766 2922393267 Bacteria 8285685
454 2929620191 2929615660 Bacteria 9193770
455 2929629504 2929624759 Bacteria 9339455
456 2932791549 2932784394 Bacteria 9704911
457 2932816811 2932809354 Bacteria 9135765
458 2932824012 2932818245 Bacteria 9955613
459 2932835451 2932828146 Bacteria 9745859
460 2933582108 2933577622 Bacteria 9116884
461 2935613543 2935608549 Bacteria 8203142
462 2935621194 2935616580 Bacteria 9032984
463 2935643486 2935638405 Bacteria 10015038
464 2935650531 2935648319 Bacteria 8801166
465 2935662973 2935656913 Bacteria 8965014
466 2935671191 2935665750 Bacteria 9571747
467 2935681206 2935675223 Bacteria 9928132
468 2935689455 2935684952 Bacteria 9590419
469 2935700028 2935694250 Bacteria 9291695
470 2935710762 2935703347 Bacteria 10242284
471 2935720706 2935713505 Bacteria 9608509
472 2935727983 2935722832 Bacteria 9608746
473 2935737421 2935732158 Bacteria 9706831
474 2935746518 2935741537 Bacteria 9707219
475 2935757485 2935750917 Bacteria 9590372
476 2935763862 2935760218 Bacteria 9817913
477 2935807840 2935801545 Bacteria 9301974
478 2935818255 2935810662 Bacteria 9401221
479 2935824604 2935819856 Bacteria 8261050
480 2935833003 2935827899 Bacteria 10038562
481 2935844325 2935837841 Bacteria 9454360
482 2935851824 2935847175 Bacteria 8228321
483 2935859613 2935855204 Bacteria 9035059
484 2935871322 2935864058 Bacteria 9784707
485 2935879065 2935873716 Bacteria 9632195
486 2935911177 2935908558 Bacteria 8568796
487 2935920709 2935916978 Bacteria 9113783
488 2935928206 2935926038 Bacteria 8601059
489 2935937851 2935934488 Bacteria 8602579
490 2935945133 2935942939 Bacteria 8599779
491 2935954362 2935951376 Bacteria 8602333
492 2935971371 2935967501 Bacteria 8603075
493 2935981976 2935975950 Bacteria 8347125
494 2935990796 2935984226 Bacteria 8302647
495 2935996708 2935992306 Bacteria 9802711
496 2936008584 2936002035 Bacteria 9362176
497 2936017113 2936011229 Bacteria 8801034
498 2936026752 2936019824 Bacteria 8804134
499 2936035495 2936028420 Bacteria 8965941
500 2936044927 2936037263 Bacteria 9446081
501 2936053644 2936046547 Bacteria 8903709
502 2936062719 2936055302 Bacteria 8785755
503 2940563691 2940556831 Bacteria 9590747
504 2941542657 2941538514 Bacteria 9402094
505 3005506958 3005506211 Bacteria 6943378
506 3005716815 3005710791 Bacteria 7622528
507 8006931711 8006926726 Bacteria 6749210
508 8016519554 8016511872 Bacteria 9921665
509 8016637266 8016630954 Bacteria 9217207
510 8017065972 8017057580 Bacteria 10023680
511 8019578679 8019576017 Bacteria 10049540
512 8019604973 8019597564 Bacteria 10041141
513 8019613560 8019608314 Bacteria 10042931
514 8019624219 8019619141 Bacteria 9218857
515 8019637802 8019629233 Bacteria 8687553
516 8019641822 8019638758 Bacteria 9062356
517 8019665724 8019659431 Bacteria 8577854
518 8019680851 8019678201 Bacteria 8863603
519 8019694933 8019687851 Bacteria 8712826
520 8055750056 8055742211 Bacteria 9226248
521 8056975831 8056967851 Bacteria 9038162
522 Ga0070670_100455473
523 RicEn_C1035
524 JGI25153J46596_10006212
525 JGI25153J46596_10026056
526 JGI25153J46596_10027181
527 JGI25153J46596_10027530
528 rootH1_10320436
529 JGI25160J50197_1027724
530 Ga0055542_1001822
531 Ga0055524_1032917
532 Ga0055531_10001156
533 Ga0065165_1001425
534 Ga0065165_1001827
535 Ga0065165_1004722
536 Ga0070658_10044514
537 Ga0070658_10259237
538 Ga0070658_10845448
539 Ga0068868_100821260
540 Ga0070661_100433539
541 Ga0070667_100242113
542 Ga0070711_100122874
543 Ga0070708_100342520
544 Ga0070663_100030232
545 Ga0070663_100048673
546 Ga0068867_100095261
547 Ga0070706_100455058
548 Ga0068853_101043482
549 Ga0070665_100006911
550 Ga0070665_100101629
551 Ga0070665_100314803
552 Ga0070665_101086516
553 Ga0068855_100955399
554 Ga0068854_101195877
555 Ga0068852_100101745
556 Ga0068852_100338097
557 Ga0068852_101096384
558 Ga0068851_10145763
559 Ga0068870_10313799
560 Ga0068858_100863818
561 Ga0068858_101527092
562 Ga0068860_100002522
563 Ga0081455_10035075
564 Ga0081540_1009882
565 Ga0070717_10963040
566 Ga0075365_10113543
567 Ga0075365_10168469
568 Ga0075363_100086840
569 Ga0075363_100625052
570 Ga0070715_10498983
571 Ga0075367_10052037
572 Ga0075367_10333390
573 Ga0075369_10040022
574 Ga0075369_10174769
575 Ga0075366_10083111
576 Ga0097621_101507168
577 Ga0075370_10222059
578 Ga0068871_100214763
579 Ga0099794_10115169
580 Ga0099794_10116368
581 Ga0105245_10276004
582 Ga0105245_10561236
583 Ga0105247_10380914
584 Ga0114129_10087116
585 Ga0105243_10831445
586 Ga0105241_10207439
587 Ga0105242_10766693
588 Ga0105242_11418769
589 Ga0105248_10395251
590 Ga0105237_10258772
591 Ga0105238_10064228
592 Ga0105249_11232744
593 Ga0099796_10021176
594 Ga0105239_10050749
595 Ga0105239_10260895
596 Ga0105239_10820439
597 Ga0157373_10129358
598 Ga0157374_11241972
599 Ga0157372_10986653
600 Ga0157375_10026462
601 Ga0157379_10310793
602 Ga0214544_1000163
603 Ga0214542_1000156
604 Ga0214545_1000078
605 Ga0214543_1000136
606 Ga0209563_101608
607 Ga0207425_1040708
608 Ga0209677_105532
609 Ga0209148_1000333
610 Ga0209129_1028811
611 Ga0209233_1002558
612 Ga0209233_1016510
613 Ga0209455_1004271
614 Ga0209564_1055367
615 Ga0209758_1000109
616 Ga0209758_1000938
617 Ga0209758_1002619
618 Ga0209758_1008100
619 Ga0209758_1132499
620 Ga0209256_1003201
621 Ga0207426_1002293
622 Ga0207426_1040946
623 Ga0209257_1001604
624 Ga0207688_10328910
625 Ga0207705_10167236
626 Ga0207705_10179383
627 Ga0207705_10193875
628 Ga0207705_10560340
629 Ga0207684_10166756
630 Ga0207654_10732200
631 Ga0207671_10112415
632 Ga0207660_10724004
633 Ga0207657_10013645
634 Ga0207649_10119488
635 Ga0207649_10814196
636 Ga0207694_10111555
637 Ga0207694_10193334
638 Ga0207664_11695014
639 Ga0207709_10540244
640 Ga0207665_10522443
641 Ga0207668_10228958
642 Ga0207703_10274573
643 Ga0207639_10439490
644 Ga0207678_10036971
645 Ga0207678_10068776
646 Ga0207678_10279546
647 Ga0207708_10192773
648 Ga0207641_10370707
649 Ga0207676_10594845
650 Ga0207683_10018090
651 Ga0207683_10396921
652 Ga0207698_10215655
653 Ga0207698_10269647
654 Ga0207698_11002223
655 Ga0209588_1001521
656 Ga0209588_1058402
657 Ga0268266_10019611
658 Ga0268266_10533030
659 Ga0268266_10717279
660 Ga0268265_10572326
661 Ga0268264_10000458
662 Ga0265337_1007952
663 Ga0265319_1015907
664 Ga0265334_10020947
665 Ga0265318_10009409
666 Ga0265323_10023699
667 Ga0265336_10000785
668 Ga0307515_10018157
669 Ga0265338_10002598
670 Ga0307513_10249642
671 Ga0307508_10135090
672 Ga0307412_10015026
673 Ga0307414_11277151
674 Ga0307411_11487374
675 Ga0307510_10038375
676 Ga0395899_0427569
677 Ga0395900_0098487
678 Ga0395900_0286381
679 Ga0395898_0272457
680 Ga0395905_0014360
681 Ga0395905_0014770
682 Ga0395901_0103718
683 Ga0395901_0250715
684 Ga0451793_1499122
685 Ga0451797_0866107
686 Ga0451833_0526616
687 Ga0451835_1133548
688 Ga0451847_0771734
689 Ga0451851_0965009
690 Ga0451843_1756506
691 Ga0451855_0667162
692 Ga0439458_0029761
693 Ga0439459_0010520
694 Ga0466972_0033336
695 Ga0466965_0075355
696 Ga0466968_0197691
697 Ga0466967_0394449
698 Ga0495617_170473
699 Ga0495603_0309049
700 Ga0495638_0369811
701 Ga0495651_0035002
702 Ga0495651_0046976
703 Ga0495651_0219718
704 Ga0495653_0041655
705 Ga0495653_0340338
706 Ga0495605_0110065
707 Ga0495662_0355908
708 Ga0495664_0010823
709 Ga0495596_0151433
710 Ga0495607_0093755
711 Ga0495583_0027652
712 Ga0495583_0285171
713 Ga0495606_0005306
714 Ga0495606_0184947
715 Ga0495606_0224547
716 Ga0495606_0457063
717 Ga0495606_0486602
718 Ga0495606_0570158
719 Ga0495608_0027531
720 Ga0495608_0398827
721 Ga0495610_0139677
722 Ga0495616_0077636
723 Ga0495620_0108810
724 Ga0495628_0026661
725 Ga0495628_0995521
726 Ga0495643_0149892
727 Ga0495648_0126683
728 Ga0495648_0194301
729 Ga0495648_0275911
730 Ga0495648_0408969
731 Ga0495652_0014451
732 Ga0495652_0032544
733 Ga0495652_0172339
734 Ga0495640_0027774
735 Ga0495587_0060332
736 Ga0495597_0256629
737 Ga0495645_0303919
738 Ga0495667_0384574
739 Ga0495668_0189047
740 Ga0495668_0255044
741 Ga0495634_0072212
742 Ga0495611_0035740
743 Ga0495625_0018524
744 Ga0495625_0039891
745 Ga0495625_0072248
746 Ga0495661_0151571
747 Ga0495588_0098374
748 Ga0495657_0035840
749 Ga0495657_0049630
750 Ga0495599_0028675
751 Ga0495623_0058377
752 Ga0495646_0046096
753 Ga0495613_0286720
754 Ga0495624_0029342
755 Ga0495624_0265077
756 Ga0495670_0008140
757 Ga0495649_0020410
758 Ga0495600_0007070
759 Ga0495600_0022089
760 Ga0495604_0030745
761 Ga0495604_0069358
762 Ga0495604_0128166
763 Ga0495604_0675191
764 Ga0495674_0019168
765 Ga0495674_0692177
766 Ga0495672_0271304
767 Ga0495676_0028615
768 Ga0495680_0001058
769 Ga0495687_177702
770 Ga0495673_0061013
771 Ga0495686_0057250
772 Ga0495686_0072969
773 Ga0495686_0379155
774 Ga0495593_0132217
775 Ga0495602_0125001
776 Ga0495602_0427449
777 Ga0496100_0178255
778 Ga0496100_0511756
779 Ga0496101_0081607
780 Ga0496102_0715725
781 Ga0496102_1129614
782 Ga0496103_0251095
783 Ga0496104_0001403
784 Ga0496104_0584864
785 Ga0496105_0003256
786 Ga0496105_0003429
787 Ga0496107_0060935
788 Ga0496110_0389471
789 Ga0496111_0241990
790 Ga0496111_0747337
791 Ga0496113_0050572
792 Ga0496113_0096716
793 Ga0496113_0913069
794 Ga0496114_1048840
795 Ga0496116_0022263
796 Ga0496116_0216676
797 Ga0496117_0085179
798 Ga0496118_0047330
799 Ga0496118_0093540
800 Ga0496118_0267483
801 Ga0496119_0032305
802 Ga0496119_0092541
803 Ga0496120_0002168
804 Ga0496120_0155711
805 Ga0496121_0008599
806 Ga0496121_0022709
807 Ga0496121_0024552
808 Ga0496121_0107757
809 Ga0496121_0337206
810 Ga0496121_0343035
811 Ga0496122_0267963
812 Ga0496122_0302616
813 Ga0496124_0144148
814 Ga0496125_0324892
815 Ga0496126_0021246
816 Ga0496126_0029121
817 Ga0496126_0052295
818 Ga0496126_0061654
819 Ga0496126_0084595
820 Ga0496126_0576661
821 Ga0496126_0901532
822 Ga0495682_0011441
823 Ga0501032_0101427
824 Ga0501032_0294467
825 Ga0501032_0809511
826 Ga0501033_0079230
827 Ga0501033_0171050
828 Ga0501034_0078812
829 Ga0501034_0405369
830 Ga0501036_0117880
831 Ga0501036_0118298
832 Ga0501036_0147780
833 Ga0501038_0199521
834 Ga0501038_0430495
835 Ga0501038_0468811
836 Ga0501043_0107757
837 Ga0501043_0187710
838 Ga0501043_0569475
839 Ga0501047_0086380
840 Ga0501047_0110674
841 Ga0501048_0099214
842 Ga0501048_0104528
843 Ga0501067_0088565
844 Ga0501068_0102883
845 Ga0501070_0408614
846 Ga0501070_0685487
847 Ga0501073_0177569
848 Ga0501035_0119122
849 Ga0501035_0554500
850 Ga0501035_0589281
851 Ga0501035_0911705
852 Ga0501044_0042572
853 Ga0501044_0098158
854 Ga0501044_0392942
855 Ga0501044_0559406
856 nmdc:mga03n38_480159_c1
857 nmdc:mga03n38_542782_c1
858 nmdc:mga00v17_394787_c1
859 nmdc:mga0yw44_124431_c1
860 nmdc:mga0yw44_26598_c1
861 nmdc:mga0yw44_761374_c1
862 nmdc:mga0k408_307474_c1
863 nmdc:mga06z11_396839_c1
864 nmdc:mga06z11_95107_c1
865 nmdc:mga07m45_29166_c1
866 nmdc:mga0sz30_162281_c1
867 nmdc:mga0sz30_207309_c1
868 Ga0495601_0115219
869 Ga0500635_0011523
870 Ga0495655_0139822
871 Ga0495595_0172853
872 Ga0500578_0078843
873 Ga0500578_0129969
874 Ga0500578_0184325
875 Ga0500643_000013
876 Ga0500643_018679
877 Ga0500644_0013386
878 Ga0500646_0101118
879 Ga0500647_0028923
880 Ga0500583_0230215
881 Ga0500651_0093712
882 Ga0500651_0107560
883 Ga0500651_0281957
884 Ga0500566_0000192
885 Ga0500566_0101561
886 Ga0500640_051554
887 Ga0500641_0021761
888 Ga0500556_0000238
889 Ga0500557_000038
890 Ga0500569_041480
891 Ga0500592_000637
892 Ga0500594_0038425
893 Ga0500595_003356
894 Ga0500595_004576
895 Ga0500595_044347
896 Ga0500607_043318
897 Ga0500608_006526
898 Ga0500618_065766
899 Ga0500642_0012959
900 Ga0500652_002951
901 Ga0500652_058516
902 Ga0500655_028228
903 Ga0500658_0042410
904 Ga0500559_0006971
905 Ga0500564_118001
906 Ga0500568_0041493
907 Ga0500577_0048011
908 Ga0500577_0307284
909 Ga0500588_0066394
910 Ga0500588_0121600
911 Ga0500590_266612
912 Ga0500616_0000048
913 Ga0500616_0000197
914 Ga0500619_066480
915 Ga0500620_031368
916 Ga0500622_0305434
917 Ga0500627_0036212
918 Ga0500627_0395505
919 Ga0500633_0054324
920 Ga0500638_030090
921 Ga0500636_0000390
922 Ga0500636_0111502
923 Ga0500637_0148295
924 Ga0500625_000357
925 Ga0500645_019797
926 Ga0500601_000227
927 Ga0501084_0693083
928 Ga0501082_0393115
929 Ga0530510_0246407
930 Ga0530510_0477850
931 2507511819
932 2508545484
933 2508694304
934 2513701918
935 2515624775
936 2528853568
937 2617349574
938 2617376766
939 2644287205
940 2824624705
941 2824633639
942 2824642512
943 2824650196
944 2824663530
945 2824685536
946 2824720036
947 2824730383
948 2824739123
949 2824750637
950 2824780197
951 2842042055
952 2842050098
953 2849077321
954 2857515069
955 2857526940
956 2874593659
957 2874624908
958 2874631037
959 2874648328
960 2876774720
961 2876821511
962 2879079288
963 2879102669
964 2879131291
965 2879144642
966 2881371188
967 2885374108
968 2885413802
969 2888391875
970 2904669117
971 2908782662
972 2919078060
973 2922370623
974 2922396766
975 2929620191
976 2929629504
977 2932791549
978 2932816811
979 2932824012
980 2932835451
981 2933582108
982 2935613543
983 2935621194
984 2935643486
985 2935650531
986 2935662973
987 2935671191
988 2935681206
989 2935689455
990 2935700028
991 2935710762
992 2935720706
993 2935727983
994 2935737421
995 2935746518
996 2935757485
997 2935763862
998 2935807840
999 2935818255
1000 2935824604
1001 2935833003
1002 2935844325
1003 2935851824
1004 2935859613
1005 2935871322
1006 2935879065
1007 2935911177
1008 2935920709
1009 2935928206
1010 2935937851
1011 2935945133
1012 2935954362
1013 2935971371
1014 2935981976
1015 2935990796
1016 2935996708
1017 2936008584
1018 2936017113
1019 2936026752
1020 2936035495
1021 2936044927
1022 2936053644
1023 2936062719
1024 2940563691
1025 2941542657
1026 3005506958
1027 3005716815
1028 8006931711
1029 8016519554
1030 8016637266
1031 8017065972
1032 8019578679
1033 8019604973
1034 8019613560
1035 8019624219
1036 8019637802
1037 8019641822
1038 8019665724
1039 8019680851
1040 8019694933
1041 8055750056
1042 8056975831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

17

144

0.91

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

7

148

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.863 7 147
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8489 7 147
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8461 8 142
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8429 7 147
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8141 9 166
ID Description Score Start End Superfamily
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8489 7 147 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8429 7 147 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.837 8 142 3.30.530.20
af_Q8BK64_207_336_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8258 8 142 3.30.530.20
af_Q55DB6_248_379_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8211 8 142 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7Y4GYK5-F1-model_v4 ATPase 0.9842 1 170
AF-A0A7C9VIX4-F1-model_v4 ATPase 0.9809 85 170
AF-A0A537SJZ9-F1-model_v4 ATPase 0.9675 1 144
AF-A0A4V1B8K9-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9554 8 155
AF-A0A537SJZ9-F1-model_v4 ATPase 0.9546 1 144

Map