metagRoot

F458630

General Info

Members	Datasets	Scaffolds	Average Seq Length
521	294	499	416

Family's Representative Sequence

Representative Sequence	3300002459\|JGI24751J29686_10003108\|JGI24751J29686_100031082
Length	495
Sequence	VRATPRDRIVRALNDALDALARLDERRAQVIELRFFGGLTGEETTNLWKVSXLLTGRAISVADAVTFQPRFAHWEERHPLRDMSIEARLAVMNFLQFFVWGSWLISLGAYMIGSLGFSGSQVGSIYATMGLGSLVMPGLAGIVADRWANAERVYGICHLVGAGLLLWASAVEKFDSLYLIMLLNALVYMPTIALNNAVSYNVLTQRGLNIVQTFPPIRVWGTVGFIAAMWMVDLVGWSRTALQLYAGAGAALFLGAYAFTMPQCPPTRQHGARSVISTLGLDAVVLFRRQQMAVFFVFAMLLGAALQITNAFGGAFLDDFNGTYPGSFGVTHPNLLLSISQISETLFVLTIPFFLQRFGIKKIMLISIFAWVFRFGLFAGGNPGARLWMLVLSMIIYGMAFDFFNISGSLFVDRESDSTIRASAQGLFMIMTNGLGAFLGGMTSGWVVDHFTVNGVKEWTSIWLAFAGYALILGVIFPIVFRYRHDPEQATPGRA

Samples

	Sample ID	Description	Type	Environment
1	2506520007	Serratia plymuthica AS9	Isolate	Rhizosphere
2	2506520008	Serratia plymuthica AS12	Isolate	Unclassified
3	2508501071	Serratia proteamaculans S4	Isolate	Rhizosphere
4	2643221716	Flavobacterium sp. Root901	Isolate	Unclassified
5	2671180115	Cedecea sp. NFIX57	Isolate	Rhizoplane
6	2738541278	Niastella sp. CF465	Isolate	Unclassified
7	2772190666	Serratia surfactantfaciens YD25	Isolate	Unclassified
8	2806310673	Serratia quinivorans NCTC 13189	Isolate	Rhizosphere
9	2869551831	Serratia inhibens PRI-2C	Isolate	Rhizosphere
10	2881247448	Flavobacterium beibuense RSKm HC5	Isolate	Rhizosphere
11	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
12	2919191525	Flavobacterium sp. 2755	Isolate	Rhizosphere
13	2932406140	Serratia sp. 2723	Isolate	Rhizosphere
14	2937967321	Serratia sp. YC16	Isolate	Unclassified
15	2938649242	Paenibacillus helianthi P26E	Isolate	Rhizosphere
16	2939577877	Serratia sp. 509	Isolate	Rhizosphere
17	2968558590	Paenibacillus sp. P3E	Isolate	Rhizosphere
18	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
19	2996632988	Paenibacillus sp. P32E	Isolate	Rhizosphere
20	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
21	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
22	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
23	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
24	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
25	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
26	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
27	3300005272	Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1	Metagenome	Rhizosphere
28	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
29	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
30	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
31	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
32	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
33	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
34	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
35	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
36	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
37	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
38	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
39	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
40	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
41	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
42	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
43	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
44	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
45	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
46	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
47	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
48	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
49	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
50	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
51	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
52	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
53	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
54	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
55	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
56	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
57	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
58	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
59	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
60	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
61	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
62	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
63	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
64	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
65	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
66	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
67	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
68	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
69	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
70	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
71	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
72	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
73	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
74	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
75	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
76	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
77	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
79	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
80	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
81	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
82	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
83	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
84	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
85	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
87	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
88	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
89	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
90	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
91	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
92	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
93	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
94	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
95	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
96	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
97	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
98	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
99	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
100	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
101	3300009987	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG	Metagenome	Rhizosphere
102	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
103	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
104	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
105	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
106	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
107	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
108	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
109	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
110	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
111	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
112	3300013874	Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213	Metagenome	Rhizosphere
113	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
114	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
115	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
116	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
117	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
118	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
119	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
120	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
122	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
165	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
176	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
179	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
180	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
181	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
182	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
183	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
184	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
185	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
186	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
187	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
188	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
189	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
190	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
191	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
192	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
193	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
194	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
195	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
196	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
197	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
198	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
199	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
200	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
201	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
202	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
203	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
204	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
205	3300042009	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348	Metagenome	Rhizosphere
206	3300042011	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204	Metagenome	Rhizosphere
207	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
208	3300042123	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228	Metagenome	Rhizosphere
209	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
210	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
211	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
212	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
213	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
214	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
215	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
216	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
217	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
218	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
219	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
220	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
221	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
222	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
223	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
224	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
225	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
226	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
227	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
228	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
229	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
230	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
231	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
232	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
233	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
234	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
235	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
236	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
237	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
238	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
239	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
240	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
241	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
242	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
243	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
244	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
245	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
246	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
247	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
248	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
249	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
250	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
251	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
252	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
253	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
254	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
255	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
256	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
257	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
258	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
259	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
260	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
261	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
262	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
263	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
264	3300049671	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought	Metagenome	Rhizosphere
265	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
266	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
267	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
268	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
269	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
270	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
271	3300049761	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control	Metagenome	Rhizosphere
272	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
273	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
274	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
275	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
276	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
277	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
278	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
279	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
280	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
281	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
282	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
283	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
284	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
285	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
286	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
287	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
288	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
289	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
290	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
291	640753048	Serratia proteamaculans 568	Isolate	Endosphere
292	8004592986	Serratia sp. S119	Isolate	Unclassified
293	8015394850	Serratia sp. PGPR-27	Isolate	Rhizosphere
294	8056440228	Flavobacterium hibisci THG-HG1.4	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	95.59
Metatranscriptomes	0
Isolates	4.41

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.07
Nodule	0.96
Rhizoplane	0.38
Rhizosphere	88.68
Stem	0
Stem Tuber	0
Unclassified	6.91

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24751J29686_10000559	3300002459	Bacteria	10191
2	JGI24751J29686_10003108	3300002459	Bacteria	3344
3	JGI25406J46586_10001663	3300003203	Bacteria	10503
4	rootH1_10009767	3300003316	Bacteria	9496
5	rootH2_10006948	3300003320	Bacteria	57399
6	rootH2_10013110	3300003320	Bacteria	45132
7	rootL2_10108051	3300003322	Bacteria	7916
8	rootH1_10010213	3300003316	Bacteria	4355
9	rootH1_10010213	3300003323	Bacteria	9050
10	rootH1_10011879	3300003323	Bacteria	7523
11	rootH1_10026295	3300003323	Bacteria	36457
12	rootH1_10038428	3300003323	Bacteria	18024
13	Ga0055538_1000558	3300003751	Bacteria	12830
14	Ga0065703_1019291	3300005272	Bacteria	3285
15	Ga0065704_10155910	3300005289	Bacteria	1383
16	Ga0065715_10002724	3300005293	Bacteria	5843
17	Ga0065707_10189729	3300005295	Bacteria	1368
18	Ga0070683_100019379	3300005329	Bacteria	6042
19	Ga0070683_100032198	3300005329	Bacteria	4774
20	Ga0070683_100045696	3300005329	Bacteria	4042
21	Ga0070683_100135049	3300005329	Bacteria	2336
22	Ga0070670_100011255	3300005331	Bacteria	7647
23	Ga0070670_100016996	3300005331	Bacteria	6244
24	Ga0070670_100029646	3300005331	Bacteria	4711
25	Ga0070677_10046780	3300005333	Bacteria	1732
26	Ga0068869_100004504	3300005334	Bacteria	8667
27	Ga0068869_100011407	3300005334	Bacteria	5827
28	Ga0068869_100054806	3300005334	Bacteria	2904
29	Ga0070666_10000047	3300005335	Bacteria	106512
30	Ga0070666_10020758	3300005335	Unclassified	4251
31	Ga0070666_10033994	3300005335	Bacteria	3379
32	Ga0070682_100020423	3300005337	Bacteria	3896
33	Ga0068868_100023257	3300005338	Bacteria	4689
34	Ga0068868_100048239	3300005338	Bacteria	3340
35	Ga0070689_100013327	3300005340	Bacteria	5946
36	Ga0070689_100030273	3300005340	Bacteria	4107
37	Ga0070689_100073187	3300005340	Bacteria	2679
38	Ga0070687_100049329	3300005343	Bacteria	2169
39	Ga0070661_100050413	3300005344	Bacteria	3046
40	Ga0070668_100105709	3300005347	Bacteria	2236
41	Ga0070671_100177743	3300005355	Bacteria	1801
42	Ga0070673_100013233	3300005364	Bacteria	5697
43	Ga0070673_100084814	3300005364	Bacteria	2577
44	Ga0070673_100227000	3300005364	Bacteria	1619
45	Ga0070688_100141380	3300005365	Bacteria	1635
46	Ga0070667_100011455	3300005367	Bacteria	7332
47	Ga0070667_100011662	3300005367	Bacteria	7266
48	Ga0070701_10063806	3300005438	Bacteria	1950
49	Ga0070700_100050346	3300005441	Bacteria	2589
50	Ga0070700_100070487	3300005441	Bacteria	2229
51	Ga0070700_100077541	3300005441	Bacteria	2137
52	Ga0070700_100080851	3300005441	Bacteria	2098
53	Ga0070694_100010548	3300005444	Bacteria	5704
54	Ga0070694_100221241	3300005444	Bacteria	1420
55	Ga0070678_100069838	3300005456	Unclassified	2624
56	Ga0070678_100070564	3300005456	Bacteria	2612
57	Ga0070662_100017248	3300005457	Bacteria	4863
58	Ga0070662_100021952	3300005457	Bacteria	4363
59	Ga0070662_100028525	3300005457	Unclassified	3884
60	Ga0070662_100049587	3300005457	Bacteria	3028
61	Ga0068867_100077902	3300005459	Bacteria	2492
62	Ga0070698_100101801	3300005471	Bacteria	2844
63	Ga0070699_100016310	3300005518	Bacteria	6379
64	Ga0070684_100023328	3300005535	Bacteria	5173
65	Ga0070684_100023629	3300005535	Bacteria	5146
66	Ga0068853_100012908	3300005539	Bacteria	6808
67	Ga0068853_100062821	3300005539	Bacteria	3215
68	Ga0068853_100073214	3300005539	Bacteria	2986
69	Ga0070686_100017205	3300005544	Bacteria	4220
70	Ga0070696_100077215	3300005546	Bacteria	2353
71	Ga0070665_100130042	3300005548	Bacteria	2520
72	Ga0070704_100010360	3300005549	Bacteria	5670
73	Ga0068855_100000370	3300005563	Bacteria	55660
74	Ga0068855_100262911	3300005563	Bacteria	1921
75	Ga0068857_100049883	3300005577	Bacteria	3713
76	Ga0068857_100123770	3300005577	Unclassified	2330
77	Ga0068857_100151614	3300005577	Bacteria	2100
78	Ga0068856_100015217	3300005614	Bacteria	7434
79	Ga0068852_100001199	3300005616	Bacteria	17214
80	Ga0068852_100009628	3300005616	Bacteria	7177
81	Ga0068859_100000030	3300005617	Bacteria	175435
82	Ga0068859_100000642	3300005617	Bacteria	34917
83	Ga0068859_100004060	3300005617	Bacteria	14926
84	Ga0068859_100033164	3300005617	Bacteria	5187
85	Ga0068859_100154913	3300005617	Bacteria	2368
86	Ga0068859_100221112	3300005617	Bacteria	1981
87	Ga0068859_100237461	3300005617	Bacteria	1911
88	Ga0068864_100004792	3300005618	Bacteria	11083
89	Ga0068864_100015437	3300005618	Bacteria	6350
90	Ga0068864_100017057	3300005618	Bacteria	6052
91	Ga0068864_100021023	3300005618	Bacteria	5465
92	Ga0068864_100025974	3300005618	Bacteria	4936
93	Ga0068861_100009008	3300005719	Bacteria	6880
94	Ga0068861_100019449	3300005719	Bacteria	4851
95	Ga0068861_100187918	3300005719	Bacteria	1725
96	Ga0068851_10047609	3300005834	Bacteria	2172
97	Ga0068870_10070023	3300005840	Bacteria	1910
98	Ga0068863_100006260	3300005841	Bacteria	11692
99	Ga0068863_100026475	3300005841	Bacteria	5532
100	Ga0068860_100001707	3300005843	Bacteria	23468
101	Ga0068860_100007009	3300005843	Bacteria	11292
102	Ga0068860_100045744	3300005843	Bacteria	4173
103	Ga0068862_100023066	3300005844	Bacteria	5212
104	Ga0068862_100135569	3300005844	Bacteria	2181
105	Ga0068862_100163881	3300005844	Bacteria	1986
106	Ga0081455_10106749	3300005937	Bacteria	2234
107	Ga0081539_10000108	3300005985	Bacteria	195322
108	Ga0081539_10000743	3300005985	Bacteria	65081
109	Ga0081539_10001090	3300005985	Bacteria	49338
110	Ga0075432_10021891	3300006058	Bacteria	2185
111	Ga0075427_10004317	3300006194	Bacteria	1989
112	Ga0075366_10027543	3300006195	Bacteria	3335
113	Ga0097621_100003381	3300006237	Bacteria	10982
114	Ga0097621_100005264	3300006237	Bacteria	9108
115	Ga0068871_100010398	3300006358	Bacteria	6788
116	Ga0068871_100087757	3300006358	Bacteria	2587
117	Ga0068871_100171190	3300006358	Bacteria	1862
118	Ga0068871_100226219	3300006358	Bacteria	1622
119	Ga0075428_100034009	3300006844	Bacteria	5623
120	Ga0075428_100292788	3300006844	Bacteria	1751
121	Ga0075430_100015210	3300006846	Bacteria	6551
122	Ga0075431_100023363	3300006847	Bacteria	6325
123	Ga0075434_100359593	3300006871	Bacteria	1477
124	Ga0075429_100026642	3300006880	Bacteria	5020
125	Ga0075429_100078083	3300006880	Bacteria	2885
126	Ga0075429_100147078	3300006880	Bacteria	2062
127	Ga0068865_100042610	3300006881	Bacteria	3096
128	Ga0097620_100000030	3300006931	Bacteria	175435
129	Ga0097620_100000642	3300006931	Bacteria	34917
130	Ga0097620_100004060	3300006931	Bacteria	14926
131	Ga0097620_100033164	3300006931	Bacteria	5187
132	Ga0097620_100154913	3300006931	Bacteria	2368
133	Ga0097620_100221124	3300006931	Bacteria	1981
134	Ga0097620_100237473	3300006931	Bacteria	1911
135	Ga0079104_1000089	3300006946	Bacteria	134252
136	Ga0079104_1002688	3300006946	Bacteria	9161
137	Ga0079104_1009209	3300006946	Bacteria	3365
138	Ga0075435_100003923	3300007076	Bacteria	10164
139	Ga0075435_100084693	3300007076	Bacteria	2609
140	Ga0105251_10000556	3300009011	Bacteria	34974
141	Ga0105251_10003006	3300009011	Bacteria	12583
142	Ga0105251_10004897	3300009011	Bacteria	8932
143	Ga0105251_10012942	3300009011	Bacteria	4692
144	Ga0105251_10013959	3300009011	Bacteria	4465
145	Ga0105251_10022742	3300009011	Bacteria	3248
146	Ga0105244_10002596	3300009036	Bacteria	13552
147	Ga0105250_10001859	3300009092	Bacteria	10993
148	Ga0105240_10000008	3300009093	Bacteria	618862
149	Ga0105240_10000326	3300009093	Bacteria	89982
150	Ga0105240_10000448	3300009093	Bacteria	75837
151	Ga0105240_10275895	3300009093	Bacteria	1934
152	Ga0111539_10005478	3300009094	Bacteria	16418
153	Ga0111539_10118099	3300009094	Bacteria	3108
154	Ga0105245_10046355	3300009098	Bacteria	3885
155	Ga0105247_10000140	3300009101	Bacteria	70239
156	Ga0114129_10016752	3300009147	Bacteria	10435
157	Ga0105241_10000006	3300009174	Bacteria	373608
158	Ga0105248_10183699	3300009177	Bacteria	2356
159	Ga0105237_10003822	3300009545	Bacteria	17701
160	Ga0105237_10044972	3300009545	Bacteria	4445
161	Ga0105237_10114528	3300009545	Bacteria	2689
162	Ga0105238_10011496	3300009551	Bacteria	8918
163	Ga0105249_10002778	3300009553	Bacteria	15107
164	Ga0105249_10009488	3300009553	Bacteria	8524
165	Ga0105249_10168390	3300009553	Bacteria	2123
166	Ga0105249_10182207	3300009553	Bacteria	2044
167	Ga0105030_102088	3300009987	Bacteria	1757
168	Ga0105239_10000079	3300010375	Bacteria	135513
169	Ga0105239_10002397	3300010375	Bacteria	23901
170	Ga0105239_10005275	3300010375	Bacteria	15191
171	Ga0105239_10013992	3300010375	Bacteria	8909
172	Ga0105239_10174941	3300010375	Unclassified	2401
173	Ga0105246_10058092	3300011119	Bacteria	2679
174	Ga0157373_10006934	3300013100	Bacteria	8436
175	Ga0157373_10134825	3300013100	Bacteria	1736
176	Ga0157370_10000263	3300013104	Bacteria	66700
177	Ga0157370_10129400	3300013104	Bacteria	2356
178	Ga0157369_10078569	3300013105	Bacteria	3535
179	Ga0157374_10000003	3300013296	Bacteria	854471
180	Ga0157374_10001132	3300013296	Bacteria	22871
181	Ga0157378_10009747	3300013297	Bacteria	8370
182	Ga0157378_10020308	3300013297	Bacteria	5842
183	Ga0157378_10033362	3300013297	Bacteria	4550
184	Ga0157378_10134407	3300013297	Bacteria	2292
185	Ga0163162_10000268	3300013306	Bacteria	47360
186	Ga0163162_10001605	3300013306	Bacteria	21146
187	Ga0163162_10018480	3300013306	Bacteria	6831
188	Ga0163162_10135625	3300013306	Bacteria	2572
189	Ga0163162_10371006	3300013306	Bacteria	1564
190	Ga0157372_10000988	3300013307	Bacteria	31100
191	Ga0157375_10026534	3300013308	Bacteria	5401
192	Ga0157375_10053756	3300013308	Bacteria	3964
193	Ga0157375_10126767	3300013308	Bacteria	2668
194	Ga0157375_10345665	3300013308	Bacteria	1653
195	Ga0157514_122829	3300013874	Bacteria	1622
196	Ga0163163_10001468	3300014325	Bacteria	19949
197	Ga0163163_10040634	3300014325	Bacteria	4543
198	Ga0163163_10140112	3300014325	Unclassified	2461
199	Ga0163163_10207130	3300014325	Bacteria	2010
200	Ga0163163_10399338	3300014325	Bacteria	1433
201	Ga0157380_10023800	3300014326	Bacteria	4625
202	Ga0157380_10155966	3300014326	Bacteria	1979
203	Ga0157380_10204718	3300014326	Bacteria	1754
204	Ga0157377_10025011	3300014745	Bacteria	3180
205	Ga0157377_10032738	3300014745	Bacteria	2833
206	Ga0157379_10009886	3300014968	Bacteria	8309
207	Ga0157379_10047371	3300014968	Unclassified	3835
208	Ga0157379_10064283	3300014968	Bacteria	3279
209	Ga0157376_10004926	3300014969	Bacteria	9310
210	Ga0157376_10046350	3300014969	Bacteria	3585
211	Ga0157376_10120916	3300014969	Bacteria	2321
212	Ga0163161_10004011	3300017792	Bacteria	10300
213	Ga0163161_10038860	3300017792	Unclassified	3414
214	Ga0163161_10104224	3300017792	Bacteria	2114
215	Ga0213876_10005891	3300021384	Bacteria	6700
216	Ga0209784_100096	3300025224	Bacteria	106927
217	Ga0209646_1002794	3300025246	Bacteria	3694
218	Ga0209676_1000877	3300025292	Bacteria	38519
219	Ga0209676_1003407	3300025292	Bacteria	9824
220	Ga0209025_1040848	3300025294	Bacteria	1998
221	Ga0207697_10013905	3300025315	Bacteria	3351
222	Ga0207656_10032269	3300025321	Bacteria	2175
223	Ga0207696_1000014	3300025711	Bacteria	517939
224	Ga0207696_1002080	3300025711	Bacteria	10099
225	Ga0207655_1020707	3300025728	Bacteria	3368
226	Ga0207713_1000052	3300025735	Bacteria	222663
227	Ga0207713_1000139	3300025735	Bacteria	110486
228	Ga0207713_1000227	3300025735	Bacteria	76225
229	Ga0207713_1013540	3300025735	Bacteria	4289
230	Ga0207682_10038770	3300025893	Bacteria	1935
231	Ga0207710_10000007	3300025900	Bacteria	488292
232	Ga0207688_10060687	3300025901	Bacteria	2130
233	Ga0207680_10000084	3300025903	Bacteria	42773
234	Ga0207680_10012527	3300025903	Bacteria	4322
235	Ga0207680_10015236	3300025903	Bacteria	4007
236	Ga0207645_10059315	3300025907	Bacteria	2444
237	Ga0207645_10071866	3300025907	Bacteria	2215
238	Ga0207643_10048194	3300025908	Bacteria	2413
239	Ga0207654_10000008	3300025911	Bacteria	375871
240	Ga0207654_10063458	3300025911	Bacteria	2168
241	Ga0207695_10000021	3300025913	Bacteria	679399
242	Ga0207695_10000039	3300025913	Bacteria	454801
243	Ga0207695_10000073	3300025913	Bacteria	312565
244	Ga0207671_10000842	3300025914	Bacteria	38914
245	Ga0207671_10050025	3300025914	Bacteria	3094
246	Ga0207681_10053484	3300025923	Bacteria	2741
247	Ga0207694_10104571	3300025924	Bacteria	2247
248	Ga0207650_10009418	3300025925	Bacteria	6677
249	Ga0207650_10010537	3300025925	Bacteria	6345
250	Ga0207650_10019968	3300025925	Bacteria	4717
251	Ga0207650_10070189	3300025925	Bacteria	2633
252	Ga0207650_10239626	3300025925	Bacteria	1465
253	Ga0207659_10056638	3300025926	Bacteria	2808
254	Ga0207687_10152849	3300025927	Bacteria	1763
255	Ga0207690_10074741	3300025932	Bacteria	2348
256	Ga0207706_10002585	3300025933	Bacteria	17635
257	Ga0207706_10004202	3300025933	Bacteria	13558
258	Ga0207706_10032219	3300025933	Bacteria	4668
259	Ga0207706_10059980	3300025933	Bacteria	3351
260	Ga0207706_10070509	3300025933	Bacteria	3074
261	Ga0207670_10034949	3300025936	Bacteria	3255
262	Ga0207670_10051481	3300025936	Bacteria	2765
263	Ga0207691_10006577	3300025940	Bacteria	11226
264	Ga0207691_10021581	3300025940	Bacteria	6079
265	Ga0207691_10031271	3300025940	Bacteria	4969
266	Ga0207691_10053002	3300025940	Bacteria	3705
267	Ga0207691_10105729	3300025940	Bacteria	2507
268	Ga0207689_10000829	3300025942	Bacteria	29817
269	Ga0207689_10010670	3300025942	Bacteria	7905
270	Ga0207689_10020426	3300025942	Bacteria	5575
271	Ga0207689_10027958	3300025942	Bacteria	4717
272	Ga0207689_10056134	3300025942	Bacteria	3240
273	Ga0207661_10013113	3300025944	Bacteria	6048
274	Ga0207679_10052728	3300025945	Bacteria	2985
275	Ga0207667_10002679	3300025949	Bacteria	22020
276	Ga0207667_10191285	3300025949	Bacteria	2100
277	Ga0207712_10001625	3300025961	Bacteria	15154
278	Ga0207712_10022901	3300025961	Bacteria	4118
279	Ga0207712_10046775	3300025961	Bacteria	3001
280	Ga0207677_10004043	3300026023	Bacteria	7831
281	Ga0207677_10088703	3300026023	Bacteria	2243
282	Ga0207677_10111263	3300026023	Unclassified	2040
283	Ga0207639_10003315	3300026041	Bacteria	10838
284	Ga0207678_10041514	3300026067	Bacteria	3989
285	Ga0207678_10109032	3300026067	Bacteria	2362
286	Ga0207708_10028651	3300026075	Bacteria	4217
287	Ga0207708_10058449	3300026075	Bacteria	2942
288	Ga0207708_10062386	3300026075	Bacteria	2847
289	Ga0207708_10122223	3300026075	Bacteria	2029
290	Ga0207702_10050173	3300026078	Bacteria	3523
291	Ga0207641_10000061	3300026088	Bacteria	160161
292	Ga0207641_10003000	3300026088	Bacteria	15245
293	Ga0207641_10084041	3300026088	Bacteria	2770
294	Ga0207648_10003331	3300026089	Bacteria	16874
295	Ga0207648_10024944	3300026089	Bacteria	5330
296	Ga0207648_10102647	3300026089	Unclassified	2507
297	Ga0207648_10131340	3300026089	Bacteria	2204
298	Ga0207676_10009356	3300026095	Bacteria	6973
299	Ga0207676_10017633	3300026095	Bacteria	5177
300	Ga0207676_10026343	3300026095	Bacteria	4325
301	Ga0207674_10009206	3300026116	Bacteria	11319
302	Ga0207674_10036582	3300026116	Bacteria	5112
303	Ga0207674_10347480	3300026116	Bacteria	1434
304	Ga0207675_100097636	3300026118	Bacteria	2766
305	Ga0207675_100268402	3300026118	Bacteria	1655
306	Ga0207683_10015981	3300026121	Bacteria	6387
307	Ga0207683_10074424	3300026121	Unclassified	3005
308	Ga0207683_10157078	3300026121	Bacteria	2055
309	Ga0207698_10008998	3300026142	Bacteria	6340
310	Ga0209281_1000203	3300027111	Bacteria	134489
311	Ga0209281_1000225	3300027111	Bacteria	120218
312	Ga0209984_1002133	3300027424	Bacteria	2194
313	Ga0209968_1008308	3300027526	Bacteria	1580
314	Ga0209982_1007958	3300027552	Bacteria	1550
315	Ga0209970_1007174	3300027614	Bacteria	1827
316	Ga0210002_1002144	3300027617	Bacteria	2851
317	Ga0210002_1006985	3300027617	Bacteria	1707
318	Ga0209983_1003600	3300027665	Bacteria	3287
319	Ga0209971_1018676	3300027682	Bacteria	1646
320	Ga0209966_1008386	3300027695	Bacteria	1833
321	Ga0209998_10008818	3300027717	Bacteria	2088
322	Ga0209974_10014508	3300027876	Bacteria	2621
323	Ga0209974_10038911	3300027876	Bacteria	1581
324	Ga0207428_10010446	3300027907	Bacteria	8291
325	Ga0207428_10059170	3300027907	Bacteria	3038
326	Ga0268265_10017165	3300028380	Bacteria	4988
327	Ga0268265_10085957	3300028380	Bacteria	2498
328	Ga0268264_10001112	3300028381	Bacteria	26576
329	Ga0268264_10004361	3300028381	Bacteria	12074
330	Ga0268264_10008902	3300028381	Bacteria	8326
331	Ga0268264_10046280	3300028381	Bacteria	3613
332	Ga0265337_1003433	3300028556	Bacteria	6868
333	Ga0265337_1009947	3300028556	Bacteria	3358
334	Ga0265319_1009227	3300028563	Bacteria	4225
335	Ga0265318_10003187	3300028577	Bacteria	8376
336	Ga0265318_10004113	3300028577	Bacteria	7129
337	Ga0265318_10020955	3300028577	Bacteria	2629
338	Ga0307515_10000016	3300028794	Bacteria	554870
339	Ga0307515_10000057	3300028794	Bacteria	261695
340	Ga0265338_10001187	3300028800	Bacteria	42989
341	Ga0265338_10016461	3300028800	Bacteria	8045
342	Ga0265338_10113229	3300028800	Bacteria	2180
343	Ga0265324_10007556	3300029957	Bacteria	4393
344	Ga0265324_10012105	3300029957	Bacteria	3264
345	Ga0307511_10000649	3300030521	Bacteria	37147
346	Ga0265320_10004525	3300031240	Bacteria	9103
347	Ga0265320_10015524	3300031240	Bacteria	4303
348	Ga0265325_10011612	3300031241	Bacteria	5059
349	Ga0265339_10016922	3300031249	Bacteria	4332
350	Ga0265327_10014213	3300031251	Bacteria	5220
351	Ga0265327_10035045	3300031251	Bacteria	2779
352	Ga0307513_10021372	3300031456	Bacteria	7642
353	Ga0307513_10032924	3300031456	Bacteria	5836
354	Ga0307509_10028991	3300031507	Bacteria	6147
355	Ga0307509_10090023	3300031507	Bacteria	3145
356	Ga0307509_10196123	3300031507	Bacteria	1863
357	Ga0307408_100020807	3300031548	Bacteria	4432
358	Ga0265313_10001621	3300031595	Bacteria	20889
359	Ga0265313_10006142	3300031595	Bacteria	8625
360	Ga0265314_10014396	3300031711	Bacteria	6332
361	Ga0265342_10014342	3300031712	Bacteria	5264
362	Ga0307411_10145167	3300032005	Bacteria	1755
363	Ga0307510_10007434	3300033180	Bacteria	13061
364	Ga0307510_10027285	3300033180	Bacteria	6545
365	Ga0373935_0076710	3300035692	Bacteria	2165
366	Ga0242420_006754	3300038996	Bacteria	1821
367	Ga0436365_1528891	3300039437	Bacteria	35712
368	Ga0439453_0001763	3300041408	Bacteria	2856
369	Ga0439433_0014703	3300041999	Bacteria	1725
370	Ga0439442_018707	3300042002	Bacteria	1433
371	Ga0439443_000882	3300042003	Bacteria	3032
372	Ga0439449_0052104	3300042007	Bacteria	1514
373	Ga0439451_003109	3300042009	Bacteria	3372
374	Ga0439454_000414	3300042011	Bacteria	3350
375	Ga0450920_003382	3300042122	Bacteria	2761
376	Ga0450921_001024	3300042123	Bacteria	1574
377	Ga0450888_000902	3300042126	Bacteria	2829
378	Ga0450907_004462	3300042146	Bacteria	2411
379	Ga0439446_0003974	3300042156	Bacteria	3719
380	Ga0439446_0004820	3300042156	Bacteria	3439
381	Ga0450908_000225	3300042184	Bacteria	11400
382	Ga0439434_0003004	3300042435	Bacteria	4941
383	Ga0439434_0004337	3300042435	Bacteria	4150
384	Ga0439444_0012669	3300042437	Bacteria	1385
385	Ga0439464_0007436	3300042439	Bacteria	2865
386	Ga0439460_0005309	3300042461	Bacteria	3158
387	Ga0439460_0030319	3300042461	Bacteria	1536
388	Ga0450893_0002429	3300042532	Bacteria	2900
389	Ga0450893_0011651	3300042532	Bacteria	1455
390	Ga0451577_0000393	3300042876	Bacteria	80362
391	Ga0451577_0002271	3300042876	Bacteria	23248
392	Ga0451577_0011014	3300042876	Bacteria	8589
393	Ga0451577_0015058	3300042876	Bacteria	7195
394	Ga0451577_0028572	3300042876	Bacteria	5042
395	Ga0439440_0003858	3300042993	Bacteria	2916
396	Ga0453683_0000045	3300044673	Bacteria	211088
397	Ga0453683_0000538	3300044673	Bacteria	42284
398	Ga0453683_0040894	3300044673	Bacteria	2911
399	Ga0453683_0063094	3300044673	Bacteria	2316
400	Ga0466961_0006980	3300044693	Bacteria	7183
401	Ga0453684_0000846	3300044712	Bacteria	103225
402	Ga0453684_0001191	3300044712	Bacteria	80362
403	Ga0453684_0019938	3300044712	Bacteria	10167
404	Ga0453684_0026846	3300044712	Bacteria	8296
405	Ga0453684_0034488	3300044712	Bacteria	7024
406	Ga0453684_0240841	3300044712	Bacteria	2082
407	Ga0466957_0087916	3300044842	Bacteria	1944
408	Ga0451576_0000077	3300045051	Bacteria	243265
409	Ga0451576_0000175	3300045051	Bacteria	161976
410	Ga0451576_0000551	3300045051	Bacteria	80362
411	Ga0451576_0011699	3300045051	Bacteria	9942
412	Ga0451576_0058629	3300045051	Bacteria	4022
413	Ga0451576_0387123	3300045051	Bacteria	1466
414	Ga0466958_0019394	3300045836	Bacteria	3959
415	Ga0495606_0008914	3300046507	Bacteria	8592
416	Ga0495606_0091998	3300046507	Bacteria	1864
417	Ga0495608_0027349	3300046511	Unclassified	3881
418	Ga0495628_0057894	3300046516	Bacteria	3048
419	Ga0495643_0000542	3300046522	Bacteria	46816
420	Ga0495654_0000191	3300046530	Bacteria	59909
421	Ga0495654_0011945	3300046530	Bacteria	4682
422	Ga0495640_0164945	3300046533	Bacteria	1418
423	Ga0495597_0000512	3300046542	Bacteria	32160
424	Ga0495634_0026179	3300046642	Bacteria	4073
425	Ga0495611_0000516	3300046648	Bacteria	22957
426	Ga0495625_0000891	3300046660	Bacteria	40287
427	Ga0495625_0008317	3300046660	Bacteria	8863
428	Ga0495649_0032119	3300046694	Bacteria	2894
429	Ga0495672_0000626	3300047320	Bacteria	39474
430	Ga0495672_0011330	3300047320	Bacteria	6298
431	Ga0495679_000369	3300047446	Bacteria	34862
432	Ga0495686_0000046	3300047472	Bacteria	281963
433	Ga0496110_0297592	3300048913	Bacteria	1470
434	Ga0496116_0000009	3300048919	Bacteria	716119
435	Ga0496119_0000746	3300048922	Bacteria	43728
436	Ga0496119_0003884	3300048922	Bacteria	15219
437	Ga0496120_0000201	3300048923	Bacteria	102775
438	Ga0496120_0000225	3300048923	Bacteria	96798
439	Ga0496121_0085076	3300048924	Bacteria	2491
440	Ga0496124_0000096	3300048927	Bacteria	183847
441	Ga0496125_0001048	3300048928	Bacteria	42722
442	Ga0496126_0102233	3300048929	Bacteria	2506
443	Ga0501298_002894	3300049521	Bacteria	2634
444	Ga0501300_000618	3300049523	Bacteria	5321
445	Ga0501034_0358419	3300049571	Bacteria	1386
446	Ga0501039_0005202	3300049575	Bacteria	9846
447	Ga0501039_0007032	3300049575	Bacteria	8566
448	Ga0501040_0001817	3300049576	Bacteria	13721
449	Ga0501041_0011068	3300049577	Bacteria	5326
450	Ga0501041_0142355	3300049577	Bacteria	1495
451	Ga0501042_0011375	3300049578	Bacteria	6005
452	Ga0501047_0022050	3300049581	Bacteria	6118
453	Ga0501068_0076025	3300049584	Bacteria	2055
454	Ga0501071_0005139	3300049587	Bacteria	8382
455	Ga0501071_0020700	3300049587	Bacteria	4574
456	Ga0501072_0012211	3300049588	Bacteria	6564
457	Ga0501073_0001314	3300049589	Bacteria	18287
458	Ga0501075_0124424	3300049591	Bacteria	1963
459	Ga0501076_0004235	3300049592	Bacteria	10150
460	Ga0501198_004675	3300049649	Bacteria	1908
461	Ga0501227_019651	3300049665	Bacteria	1542
462	Ga0501238_001556	3300049671	Bacteria	2661
463	Ga0501249_005039	3300049679	Bacteria	2699
464	Ga0501225_0014502	3300049705	Bacteria	2201
465	Ga0501079_0009940	3300049741	Bacteria	7221
466	Ga0501080_0019150	3300049742	Bacteria	6339
467	Ga0501081_0009594	3300049743	Bacteria	6312
468	Ga0501081_0107531	3300049743	Bacteria	1978
469	Ga0501083_0005903	3300049744	Bacteria	8664
470	Ga0501083_0046627	3300049744	Bacteria	2930
471	Ga0501264_000783	3300049761	Bacteria	4152
472	Ga0501035_0076788	3300049822	Bacteria	2953
473	Ga0501044_0025091	3300049823	Bacteria	6322
474	Ga0501045_0023040	3300049824	Bacteria	4461
475	nmdc:mga0k408_17103_c1	3300050493	Bacteria	3418
476	nmdc:mga0k408_47147_c1	3300050493	Bacteria	2490
477	nmdc:mga05p37_30393_c1	3300050507	Bacteria	6591
478	nmdc:mga05p37_9274_c1	3300050507	Bacteria	11636
479	nmdc:mga09592_230721_c1	3300050508	Bacteria	1604
480	nmdc:mga09592_82602_c1	3300050508	Bacteria	2738
481	nmdc:mga0qj67_10725_c1	3300050509	Bacteria	6850
482	nmdc:mga06r32_180784_c1	3300050510	Bacteria	2095
483	nmdc:mga06r32_18110_c1	3300050510	Bacteria	6442
484	nmdc:mga08y16_58640_c1	3300050511	Bacteria	4022
485	nmdc:mga08y16_85918_c1	3300050511	Bacteria	3279
486	nmdc:mga08y16_86950_c1	3300050511	Bacteria	3257
487	nmdc:mga0n895_188_c1	3300050512	Bacteria	38251
488	nmdc:mga0rr50_171196_c1	3300050513	Bacteria	1770
489	nmdc:mga0rr50_2434_c1	3300050513	Bacteria	10496
490	nmdc:mga0a205_90010_c1	3300050515	Bacteria	2966
491	Ga0500578_0002458	3300053086	Bacteria	15375
492	Ga0500641_0000155	3300053096	Bacteria	25661
493	Ga0500588_0006534	3300053146	Bacteria	2649
494	Ga0500588_0019562	3300053146	Bacteria	1803
495	Ga0500589_051659	3300053147	Bacteria	1906
496	Ga0500637_0077927	3300053178	Bacteria	1912
497	Ga0500611_000007	3300053727	Bacteria	210964
498	Ga0501084_0052053	3300054114	Bacteria	3426
499	Ga0501084_0149347	3300054114	Bacteria	1969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300050493	nmdc:mga0k408_47147_c1	nmdc:mga0k408_47147_c1_24_1061	345
2	3300045051	Ga0451576_0387123	Ga0451576_0387123_30_1127	346
3	3300049571	Ga0501034_0358419	Ga0501034_0358419_327_1367	346
4	3300005617	Ga0068859_100000642	Ga0068859_10000064227	380
5	3300006931	Ga0097620_100000642	Ga0097620_10000064227	380
6	3300026088	Ga0207641_10003000	Ga0207641_100030005	381
7	3300053147	Ga0500589_051659	Ga0500589_051659_119_1354	382
8	3300013104	Ga0157370_10000263	Ga0157370_1000026370	386
9	3300005329	Ga0070683_100032198	Ga0070683_1000321981	387
10	3300005334	Ga0068869_100011407	Ga0068869_1000114072	387
11	3300044673	Ga0453683_0040894	Ga0453683_0040894_135_1382	388
12	3300044693	Ga0466961_0006980	Ga0466961_0006980_2580_3827	392
13	3300045836	Ga0466958_0019394	Ga0466958_0019394_2467_3714	392
14	3300053727	Ga0500611_000007	Ga0500611_000007_153467_154648	393
15	3300025292	Ga0209676_1003407	Ga0209676_10034078	394
16	3300030521	Ga0307511_10000649	Ga0307511_1000064911	394
17	3300005577	Ga0068857_100123770	Ga0068857_1001237702	396
18	3300031251	Ga0265327_10035045	Ga0265327_100350453	396
19	3300046694	Ga0495649_0032119	Ga0495649_0032119_15_1244	396
20	3300009094	Ga0111539_10005478	Ga0111539_1000547810	397
21	3300014969	Ga0157376_10046350	Ga0157376_100463502	397
22	3300025246	Ga0209646_1002794	Ga0209646_10027943	397
23	3300009011	Ga0105251_10013959	Ga0105251_100139593	399
24	3300025735	Ga0207713_1000052	Ga0207713_100005260	399
25	3300044673	Ga0453683_0000045	Ga0453683_0000045_112362_113621	399
26	3300044712	Ga0453684_0026846	Ga0453684_0026846_2194_3435	399
27	iso_pu_bacteria	2738541278	2738727698	399
28	3300033180	Ga0307510_10027285	Ga0307510_100272855	400
29	3300045051	Ga0451576_0058629	Ga0451576_0058629_963_2249	400
30	iso_pu_bacteria	2881247448	2881248527	400
31	3300028794	Ga0307515_10000057	Ga0307515_1000005722	401
32	3300042007	Ga0439449_0052104	Ga0439449_0052104_33_1247	401
33	3300042435	Ga0439434_0004337	Ga0439434_0004337_676_1890	401
34	3300047320	Ga0495672_0011330	Ga0495672_0011330_4701_5915	401
35	3300049584	Ga0501068_0076025	Ga0501068_0076025_826_2040	401
36	3300049744	Ga0501083_0046627	Ga0501083_0046627_1652_2866	401
37	3300053146	Ga0500588_0006534	Ga0500588_0006534_1195_2409	401
38	3300053146	Ga0500588_0019562	Ga0500588_0019562_529_1743	401
39	3300003320	rootH2_10006948	rootH2_1000694811	402
40	3300003323	rootH1_10038428	rootH1_100384287	402
41	3300031456	Ga0307513_10032924	Ga0307513_100329243	402
42	3300049823	Ga0501044_0025091	Ga0501044_0025091_3464_4681	402
43	3300053086	Ga0500578_0002458	Ga0500578_0002458_14069_15289	402
44	3300005334	Ga0068869_100004504	Ga0068869_1000045048	403
45	3300005338	Ga0068868_100023257	Ga0068868_1000232573	403
46	3300005457	Ga0070662_100017248	Ga0070662_1000172483	403
47	3300005459	Ga0068867_100077902	Ga0068867_1000779023	403
48	3300005563	Ga0068855_100262911	Ga0068855_1002629112	403
49	3300005719	Ga0068861_100019449	Ga0068861_1000194492	403
50	3300006195	Ga0075366_10027543	Ga0075366_100275434	403
51	3300009147	Ga0114129_10016752	Ga0114129_100167523	403
52	3300009545	Ga0105237_10003822	Ga0105237_100038228	403
53	3300010375	Ga0105239_10002397	Ga0105239_100023978	403
54	3300013306	Ga0163162_10001605	Ga0163162_100016054	403
55	3300017792	Ga0163161_10038860	Ga0163161_100388603	403
56	3300025911	Ga0207654_10063458	Ga0207654_100634582	403
57	3300025933	Ga0207706_10032219	Ga0207706_100322192	403
58	3300025942	Ga0207689_10056134	Ga0207689_100561342	403
59	3300025949	Ga0207667_10191285	Ga0207667_101912852	403
60	3300026023	Ga0207677_10088703	Ga0207677_100887033	403
61	3300026089	Ga0207648_10102647	Ga0207648_101026472	403
62	3300031507	Ga0307509_10090023	Ga0307509_100900234	403
63	3300031507	Ga0307509_10196123	Ga0307509_101961232	403
64	3300044842	Ga0466957_0087916	Ga0466957_0087916_163_1383	403
65	3300045051	Ga0451576_0000077	Ga0451576_0000077_150464_151684	403
66	3300046507	Ga0495606_0091998	Ga0495606_0091998_29_1240	403
67	3300046516	Ga0495628_0057894	Ga0495628_0057894_883_2121	403
68	3300046642	Ga0495634_0026179	Ga0495634_0026179_2395_3633	403
69	3300049581	Ga0501047_0022050	Ga0501047_0022050_170_1390	403
70	3300050507	nmdc:mga05p37_9274_c1	nmdc:mga05p37_9274_c1_2282_3520	403
71	3300050515	nmdc:mga0a205_90010_c1	nmdc:mga0a205_90010_c1_1292_2512	403
72	3300053096	Ga0500641_0000155	Ga0500641_0000155_2704_3966	403
73	3300005338	Ga0068868_100048239	Ga0068868_1000482392	404
74	3300005355	Ga0070671_100177743	Ga0070671_1001777432	404
75	3300005364	Ga0070673_100084814	Ga0070673_1000848142	404
76	3300005841	Ga0068863_100026475	Ga0068863_1000264753	404
77	3300006358	Ga0068871_100171190	Ga0068871_1001711902	404
78	3300009093	Ga0105240_10275895	Ga0105240_102758952	404
79	3300009545	Ga0105237_10044972	Ga0105237_100449722	404
80	3300010375	Ga0105239_10000079	Ga0105239_1000007952	404
81	3300013297	Ga0157378_10009747	Ga0157378_100097475	404
82	3300013297	Ga0157378_10020308	Ga0157378_100203082	404
83	3300013308	Ga0157375_10053756	Ga0157375_100537562	404
84	3300025914	Ga0207671_10050025	Ga0207671_100500253	404
85	3300026023	Ga0207677_10004043	Ga0207677_100040432	404
86	3300026088	Ga0207641_10084041	Ga0207641_100840412	404
87	3300042876	Ga0451577_0015058	Ga0451577_0015058_5299_6546	404
88	3300044712	Ga0453684_0019938	Ga0453684_0019938_5427_6674	404
89	3300005331	Ga0070670_100029646	Ga0070670_1000296462	405
90	3300009545	Ga0105237_10114528	Ga0105237_101145282	405
91	3300010375	Ga0105239_10005275	Ga0105239_1000527516	405
92	3300025913	Ga0207695_10000021	Ga0207695_10000021391	405
93	3300025913	Ga0207695_10000039	Ga0207695_10000039113	405
94	3300025925	Ga0207650_10070189	Ga0207650_100701893	405
95	3300042876	Ga0451577_0002271	Ga0451577_0002271_10542_11801	405
96	3300044712	Ga0453684_0000846	Ga0453684_0000846_23049_24308	405
97	3300045051	Ga0451576_0000175	Ga0451576_0000175_81800_83059	405
98	3300048919	Ga0496116_0000009	Ga0496116_0000009_456256_457488	405
99	3300002459	JGI24751J29686_10003108	JGI24751J29686_100031082	406
100	3300005343	Ga0070687_100049329	Ga0070687_1000493292	406
101	3300005441	Ga0070700_100070487	Ga0070700_1000704872	406
102	3300005544	Ga0070686_100017205	Ga0070686_1000172052	406
103	3300005549	Ga0070704_100010360	Ga0070704_1000103603	406
104	3300005577	Ga0068857_100049883	Ga0068857_1000498832	406
105	3300005617	Ga0068859_100004060	Ga0068859_10000406013	406
106	3300005618	Ga0068864_100004792	Ga0068864_1000047928	406
107	3300005843	Ga0068860_100045744	Ga0068860_1000457442	406
108	3300006058	Ga0075432_10021891	Ga0075432_100218912	406
109	3300006844	Ga0075428_100034009	Ga0075428_1000340092	406
110	3300006846	Ga0075430_100015210	Ga0075430_1000152102	406
111	3300006847	Ga0075431_100023363	Ga0075431_1000233637	406
112	3300006880	Ga0075429_100026642	Ga0075429_1000266422	406
113	3300006931	Ga0097620_100004060	Ga0097620_10000406013	406
114	3300007076	Ga0075435_100084693	Ga0075435_1000846931	406
115	3300009098	Ga0105245_10046355	Ga0105245_100463553	406
116	3300009553	Ga0105249_10182207	Ga0105249_101822072	406
117	3300013297	Ga0157378_10033362	Ga0157378_100333622	406
118	3300013306	Ga0163162_10135625	Ga0163162_101356251	406
119	3300014325	Ga0163163_10040634	Ga0163163_100406342	406
120	3300014326	Ga0157380_10023800	Ga0157380_100238004	406
121	3300025925	Ga0207650_10019968	Ga0207650_100199682	406
122	3300025927	Ga0207687_10152849	Ga0207687_101528492	406
123	3300025942	Ga0207689_10027958	Ga0207689_100279583	406
124	3300025961	Ga0207712_10046775	Ga0207712_100467752	406
125	3300026095	Ga0207676_10017633	Ga0207676_100176332	406
126	3300028380	Ga0268265_10085957	Ga0268265_100859572	406
127	3300028381	Ga0268264_10004361	Ga0268264_1000436110	406
128	3300038996	Ga0242420_006754	Ga0242420_006754_436_1677	406
129	3300050508	nmdc:mga09592_82602_c1	nmdc:mga09592_82602_c1_317_1549	406
130	3300050509	nmdc:mga0qj67_10725_c1	nmdc:mga0qj67_10725_c1_173_1405	406
131	3300050510	nmdc:mga06r32_18110_c1	nmdc:mga06r32_18110_c1_389_1621	406
132	3300050511	nmdc:mga08y16_58640_c1	nmdc:mga08y16_58640_c1_1840_3081	406
133	3300050513	nmdc:mga0rr50_171196_c1	nmdc:mga0rr50_171196_c1_451_1692	406
134	iso_pu_bacteria	2919191525	2919195156	406
135	3300014325	Ga0163163_10399338	Ga0163163_103993382	407
136	3300026116	Ga0207674_10347480	Ga0207674_103474801	407
137	3300041999	Ga0439433_0014703	Ga0439433_0014703_347_1594	407
138	3300042122	Ga0450920_003382	Ga0450920_003382_160_1407	407
139	3300042123	Ga0450921_001024	Ga0450921_001024_257_1504	407
140	3300042146	Ga0450907_004462	Ga0450907_004462_255_1502	407
141	3300042156	Ga0439446_0004820	Ga0439446_0004820_1930_3177	407
142	3300042184	Ga0450908_000225	Ga0450908_000225_2908_4155	407
143	3300042435	Ga0439434_0003004	Ga0439434_0003004_2076_3323	407
144	3300042461	Ga0439460_0005309	Ga0439460_0005309_1605_2852	407
145	3300005347	Ga0070668_100105709	Ga0070668_1001057093	408
146	3300005457	Ga0070662_100021952	Ga0070662_1000219521	408
147	3300006880	Ga0075429_100147078	Ga0075429_1001470782	408
148	3300025893	Ga0207682_10038770	Ga0207682_100387702	408
149	3300025907	Ga0207645_10071866	Ga0207645_100718662	408
150	3300025923	Ga0207681_10053484	Ga0207681_100534842	408
151	3300025933	Ga0207706_10004202	Ga0207706_100042021	408
152	3300025940	Ga0207691_10105729	Ga0207691_101057291	408
153	3300026075	Ga0207708_10062386	Ga0207708_100623864	408
154	3300026089	Ga0207648_10024944	Ga0207648_100249443	408
155	3300027424	Ga0209984_1002133	Ga0209984_10021332	408
156	3300027526	Ga0209968_1008308	Ga0209968_10083082	408
157	3300027617	Ga0210002_1002144	Ga0210002_10021442	408
158	3300027665	Ga0209983_1003600	Ga0209983_10036003	408
159	3300027682	Ga0209971_1018676	Ga0209971_10186761	408
160	3300027876	Ga0209974_10038911	Ga0209974_100389111	408
161	3300028556	Ga0265337_1003433	Ga0265337_10034332	408
162	3300028556	Ga0265337_1009947	Ga0265337_10099473	408
163	3300028563	Ga0265319_1009227	Ga0265319_10092272	408
164	3300028577	Ga0265318_10003187	Ga0265318_1000318710	408
165	3300028577	Ga0265318_10004113	Ga0265318_100041134	408
166	3300028577	Ga0265318_10020955	Ga0265318_100209553	408
167	3300028800	Ga0265338_10001187	Ga0265338_1000118717	408
168	3300028800	Ga0265338_10016461	Ga0265338_100164616	408
169	3300028800	Ga0265338_10113229	Ga0265338_101132292	408
170	3300029957	Ga0265324_10007556	Ga0265324_100075562	408
171	3300029957	Ga0265324_10012105	Ga0265324_100121052	408
172	3300031240	Ga0265320_10004525	Ga0265320_100045256	408
173	3300031240	Ga0265320_10015524	Ga0265320_100155242	408
174	3300031241	Ga0265325_10011612	Ga0265325_100116124	408
175	3300031249	Ga0265339_10016922	Ga0265339_100169222	408
176	3300031251	Ga0265327_10014213	Ga0265327_100142133	408
177	3300031595	Ga0265313_10001621	Ga0265313_1000162111	408
178	3300031595	Ga0265313_10006142	Ga0265313_100061424	408
179	3300031711	Ga0265314_10014396	Ga0265314_100143966	408
180	3300031712	Ga0265342_10014342	Ga0265342_100143424	408
181	3300050508	nmdc:mga09592_230721_c1	nmdc:mga09592_230721_c1_219_1454	408
182	3300050510	nmdc:mga06r32_180784_c1	nmdc:mga06r32_180784_c1_303_1538	408
183	iso_pu_bacteria	2772190666	2772440818	408
184	iso_pu_bacteria	2937967321	2937971365	408
185	iso_pu_bacteria	8004592986	8004593726	408
186	iso_pu_bacteria	8015394850	8015397665	408
187	3300005289	Ga0065704_10155910	Ga0065704_101559101	409
188	3300005334	Ga0068869_100054806	Ga0068869_1000548062	409
189	3300005335	Ga0070666_10000047	Ga0070666_100000475	409
190	3300005367	Ga0070667_100011662	Ga0070667_1000116622	409
191	3300005471	Ga0070698_100101801	Ga0070698_1001018012	409
192	3300005518	Ga0070699_100016310	Ga0070699_1000163103	409
193	3300005539	Ga0068853_100012908	Ga0068853_1000129085	409
194	3300005616	Ga0068852_100001199	Ga0068852_1000011998	409
195	3300005617	Ga0068859_100033164	Ga0068859_1000331644	409
196	3300005618	Ga0068864_100017057	Ga0068864_1000170572	409
197	3300005840	Ga0068870_10070023	Ga0068870_100700231	409
198	3300005841	Ga0068863_100006260	Ga0068863_1000062606	409
199	3300005843	Ga0068860_100001707	Ga0068860_1000017072	409
200	3300005843	Ga0068860_100007009	Ga0068860_1000070092	409
201	3300005985	Ga0081539_10000108	Ga0081539_10000108173	409
202	3300005985	Ga0081539_10001090	Ga0081539_1000109028	409
203	3300006237	Ga0097621_100003381	Ga0097621_1000033818	409
204	3300006358	Ga0068871_100010398	Ga0068871_1000103981	409
205	3300006881	Ga0068865_100042610	Ga0068865_1000426102	409
206	3300006931	Ga0097620_100033164	Ga0097620_1000331644	409
207	3300013297	Ga0157378_10134407	Ga0157378_101344072	409
208	3300013306	Ga0163162_10000268	Ga0163162_1000026813	409
209	3300013306	Ga0163162_10371006	Ga0163162_103710062	409
210	3300014326	Ga0157380_10204718	Ga0157380_102047182	409
211	3300014969	Ga0157376_10120916	Ga0157376_101209163	409
212	3300025903	Ga0207680_10000084	Ga0207680_100000847	409
213	3300025914	Ga0207671_10000842	Ga0207671_1000084216	409
214	3300025942	Ga0207689_10000829	Ga0207689_100008298	409
215	3300026088	Ga0207641_10000061	Ga0207641_1000006166	409
216	3300026142	Ga0207698_10008998	Ga0207698_100089987	409
217	3300028381	Ga0268264_10001112	Ga0268264_1000111219	409
218	3300028381	Ga0268264_10008902	Ga0268264_100089024	409
219	3300042876	Ga0451577_0028572	Ga0451577_0028572_1903_3150	409
220	3300044712	Ga0453684_0240841	Ga0453684_0240841_69_1316	409
221	3300003323	rootH1_10010213	rootH1_100102133	410
222	3300005364	Ga0070673_100227000	Ga0070673_1002270002	410
223	3300005617	Ga0068859_100000030	Ga0068859_100000030138	410
224	3300005844	Ga0068862_100163881	Ga0068862_1001638813	410
225	3300006844	Ga0075428_100292788	Ga0075428_1002927882	410
226	3300006931	Ga0097620_100000030	Ga0097620_10000003010	410
227	3300009987	Ga0105030_102088	Ga0105030_1020882	410
228	3300013874	Ga0157514_122829	Ga0157514_1228292	410
229	3300014968	Ga0157379_10009886	Ga0157379_100098866	410
230	3300025292	Ga0209676_1000877	Ga0209676_100087725	410
231	3300025294	Ga0209025_1040848	Ga0209025_10408481	410
232	3300025940	Ga0207691_10053002	Ga0207691_100530024	410
233	3300026089	Ga0207648_10003331	Ga0207648_100033318	410
234	3300031456	Ga0307513_10021372	Ga0307513_100213725	410
235	3300031507	Ga0307509_10028991	Ga0307509_100289915	410
236	3300042532	Ga0450893_0011651	Ga0450893_0011651_85_1326	410
237	3300049575	Ga0501039_0007032	Ga0501039_0007032_2673_3914	410
238	3300049576	Ga0501040_0001817	Ga0501040_0001817_2255_3496	410
239	3300049577	Ga0501041_0011068	Ga0501041_0011068_362_1612	410
240	3300049578	Ga0501042_0011375	Ga0501042_0011375_3058_4299	410
241	3300049587	Ga0501071_0020700	Ga0501071_0020700_835_2076	410
242	3300049589	Ga0501073_0001314	Ga0501073_0001314_6265_7506	410
243	3300049591	Ga0501075_0124424	Ga0501075_0124424_293_1543	410
244	3300049592	Ga0501076_0004235	Ga0501076_0004235_1580_2821	410
245	3300049741	Ga0501079_0009940	Ga0501079_0009940_1580_2821	410
246	3300049742	Ga0501080_0019150	Ga0501080_0019150_56_1297	410
247	3300049744	Ga0501083_0005903	Ga0501083_0005903_4492_5733	410
248	3300054114	Ga0501084_0052053	Ga0501084_0052053_1787_3028	410
249	3300054114	Ga0501084_0149347	Ga0501084_0149347_691_1932	410
250	iso_pu_bacteria	2506520007	2506580467	410
251	iso_pu_bacteria	2506520008	2506585606	410
252	iso_pu_bacteria	2508501071	2508854210	410
253	iso_pu_bacteria	2671180115	2671587772	410
254	iso_pu_bacteria	2806310673	2807180120	410
255	iso_pu_bacteria	2869551831	2869556417	410
256	iso_pu_bacteria	2919108558	2919111057	410
257	iso_pu_bacteria	2932406140	2932407002	410
258	iso_pu_bacteria	2938649242	2938655571	410
259	iso_pu_bacteria	2939577877	2939579589	410
260	iso_pu_bacteria	2968558590	2968559969	410
261	iso_pu_bacteria	2971820967	2971822409	410
262	iso_pu_bacteria	2996632988	2996633478	410
263	iso_pu_bacteria	640753048	640939814	410
264	3300005337	Ga0070682_100020423	Ga0070682_1000204232	411
265	3300005340	Ga0070689_100013327	Ga0070689_1000133274	411
266	3300005441	Ga0070700_100077541	Ga0070700_1000775412	411
267	3300005444	Ga0070694_100010548	Ga0070694_1000105483	411
268	3300005546	Ga0070696_100077215	Ga0070696_1000772152	411
269	3300005719	Ga0068861_100009008	Ga0068861_1000090085	411
270	3300005844	Ga0068862_100023066	Ga0068862_1000230663	411
271	3300025940	Ga0207691_10006577	Ga0207691_100065772	411
272	3300026075	Ga0207708_10028651	Ga0207708_100286512	411
273	3300026118	Ga0207675_100268402	Ga0207675_1002684022	411
274	3300028381	Ga0268264_10046280	Ga0268264_100462802	411
275	3300042876	Ga0451577_0000393	Ga0451577_0000393_33457_34716	411
276	3300042876	Ga0451577_0011014	Ga0451577_0011014_1150_2409	411
277	3300044673	Ga0453683_0000538	Ga0453683_0000538_7569_8828	411
278	3300044673	Ga0453683_0063094	Ga0453683_0063094_89_1348	411
279	3300044712	Ga0453684_0001191	Ga0453684_0001191_45647_46906	411
280	3300045051	Ga0451576_0000551	Ga0451576_0000551_33457_34716	411
281	3300045051	Ga0451576_0011699	Ga0451576_0011699_1053_2312	411
282	3300046522	Ga0495643_0000542	Ga0495643_0000542_3092_4327	411
283	3300046660	Ga0495625_0008317	Ga0495625_0008317_810_2045	411
284	3300048929	Ga0496126_0102233	Ga0496126_0102233_1013_2260	411
285	3300049575	Ga0501039_0005202	Ga0501039_0005202_8496_9740	411
286	3300049577	Ga0501041_0142355	Ga0501041_0142355_49_1293	411
287	3300049587	Ga0501071_0005139	Ga0501071_0005139_3658_4902	411
288	3300049588	Ga0501072_0012211	Ga0501072_0012211_5308_6552	411
289	3300049649	Ga0501198_004675	Ga0501198_004675_108_1355	411
290	3300049743	Ga0501081_0009594	Ga0501081_0009594_2530_3774	411
291	3300049822	Ga0501035_0076788	Ga0501035_0076788_1680_2924	411
292	3300049824	Ga0501045_0023040	Ga0501045_0023040_1571_2815	411
293	3300053178	Ga0500637_0077927	Ga0500637_0077927_136_1380	411
294	3300003203	JGI25406J46586_10001663	JGI25406J46586_100016636	412
295	3300003316	rootH1_10009767	rootH1_100097673	412
296	3300003322	rootL2_10108051	rootL2_101080517	412
297	3300003323	rootH1_10011879	rootH1_100118795	412
298	3300003323	rootH1_10026295	rootH1_100262957	412
299	3300003751	Ga0055538_1000558	Ga0055538_10005586	412
300	3300005293	Ga0065715_10002724	Ga0065715_100027242	412
301	3300005295	Ga0065707_10189729	Ga0065707_101897291	412
302	3300005331	Ga0070670_100011255	Ga0070670_1000112555	412
303	3300005333	Ga0070677_10046780	Ga0070677_100467802	412
304	3300005340	Ga0070689_100073187	Ga0070689_1000731874	412
305	3300005438	Ga0070701_10063806	Ga0070701_100638062	412
306	3300005441	Ga0070700_100050346	Ga0070700_1000503461	412
307	3300005444	Ga0070694_100221241	Ga0070694_1002212411	412
308	3300005456	Ga0070678_100070564	Ga0070678_1000705643	412
309	3300005457	Ga0070662_100049587	Ga0070662_1000495871	412
310	3300005539	Ga0068853_100062821	Ga0068853_1000628213	412
311	3300005577	Ga0068857_100151614	Ga0068857_1001516141	412
312	3300005614	Ga0068856_100015217	Ga0068856_1000152176	412
313	3300005617	Ga0068859_100221112	Ga0068859_1002211121	412
314	3300005719	Ga0068861_100187918	Ga0068861_1001879183	412
315	3300005834	Ga0068851_10047609	Ga0068851_100476092	412
316	3300005844	Ga0068862_100135569	Ga0068862_1001355692	412
317	3300005937	Ga0081455_10106749	Ga0081455_101067491	412
318	3300005985	Ga0081539_10000743	Ga0081539_1000074328	412
319	3300006194	Ga0075427_10004317	Ga0075427_100043171	412
320	3300006871	Ga0075434_100359593	Ga0075434_1003595932	412
321	3300006880	Ga0075429_100078083	Ga0075429_1000780831	412
322	3300006931	Ga0097620_100221124	Ga0097620_1002211241	412
323	3300007076	Ga0075435_100003923	Ga0075435_1000039233	412
324	3300009094	Ga0111539_10118099	Ga0111539_101180993	412
325	3300009553	Ga0105249_10002778	Ga0105249_100027783	412
326	3300009553	Ga0105249_10168390	Ga0105249_101683903	412
327	3300011119	Ga0105246_10058092	Ga0105246_100580923	412
328	3300013308	Ga0157375_10345665	Ga0157375_103456651	412
329	3300014326	Ga0157380_10155966	Ga0157380_101559661	412
330	3300014745	Ga0157377_10032738	Ga0157377_100327382	412
331	3300025224	Ga0209784_100096	Ga0209784_10009628	412
332	3300025315	Ga0207697_10013905	Ga0207697_100139053	412
333	3300025321	Ga0207656_10032269	Ga0207656_100322691	412
334	3300025901	Ga0207688_10060687	Ga0207688_100606871	412
335	3300025907	Ga0207645_10059315	Ga0207645_100593153	412
336	3300025908	Ga0207643_10048194	Ga0207643_100481942	412
337	3300025925	Ga0207650_10009418	Ga0207650_100094182	412
338	3300025925	Ga0207650_10239626	Ga0207650_102396261	412
339	3300025933	Ga0207706_10070509	Ga0207706_100705093	412
340	3300025936	Ga0207670_10051481	Ga0207670_100514813	412
341	3300025940	Ga0207691_10031271	Ga0207691_100312712	412
342	3300025945	Ga0207679_10052728	Ga0207679_100527282	412
343	3300025961	Ga0207712_10022901	Ga0207712_100229014	412
344	3300026067	Ga0207678_10109032	Ga0207678_101090322	412
345	3300026075	Ga0207708_10058449	Ga0207708_100584492	412
346	3300026078	Ga0207702_10050173	Ga0207702_100501732	412
347	3300026116	Ga0207674_10036582	Ga0207674_100365824	412
348	3300026118	Ga0207675_100097636	Ga0207675_1000976363	412
349	3300026121	Ga0207683_10015981	Ga0207683_100159814	412
350	3300026121	Ga0207683_10157078	Ga0207683_101570781	412
351	3300027552	Ga0209982_1007958	Ga0209982_10079581	412
352	3300027614	Ga0209970_1007174	Ga0209970_10071741	412
353	3300027617	Ga0210002_1006985	Ga0210002_10069852	412
354	3300027695	Ga0209966_1008386	Ga0209966_10083862	412
355	3300027717	Ga0209998_10008818	Ga0209998_100088182	412
356	3300027876	Ga0209974_10014508	Ga0209974_100145082	412
357	3300027907	Ga0207428_10010446	Ga0207428_100104463	412
358	3300027907	Ga0207428_10059170	Ga0207428_100591702	412
359	3300028380	Ga0268265_10017165	Ga0268265_100171654	412
360	3300028794	Ga0307515_10000016	Ga0307515_10000016282	412
361	3300031548	Ga0307408_100020807	Ga0307408_1000208072	412
362	3300032005	Ga0307411_10145167	Ga0307411_101451671	412
363	3300035692	Ga0373935_0076710	Ga0373935_0076710_165_1409	412
364	3300041408	Ga0439453_0001763	Ga0439453_0001763_73_1329	412
365	3300042002	Ga0439442_018707	Ga0439442_018707_70_1317	412
366	3300042003	Ga0439443_000882	Ga0439443_000882_210_1466	412
367	3300042009	Ga0439451_003109	Ga0439451_003109_1558_2814	412
368	3300042011	Ga0439454_000414	Ga0439454_000414_1695_2951	412
369	3300042126	Ga0450888_000902	Ga0450888_000902_1523_2779	412
370	3300042156	Ga0439446_0003974	Ga0439446_0003974_619_1866	412
371	3300042437	Ga0439444_0012669	Ga0439444_0012669_77_1333	412
372	3300042439	Ga0439464_0007436	Ga0439464_0007436_96_1352	412
373	3300042461	Ga0439460_0030319	Ga0439460_0030319_40_1296	412
374	3300042532	Ga0450893_0002429	Ga0450893_0002429_1596_2852	412
375	3300042993	Ga0439440_0003858	Ga0439440_0003858_126_1382	412
376	3300046648	Ga0495611_0000516	Ga0495611_0000516_21628_22869	412
377	3300048922	Ga0496119_0000746	Ga0496119_0000746_9274_10530	412
378	3300048922	Ga0496119_0003884	Ga0496119_0003884_2890_4146	412
379	3300048923	Ga0496120_0000201	Ga0496120_0000201_10874_12130	412
380	3300048923	Ga0496120_0000225	Ga0496120_0000225_83311_84567	412
381	3300048927	Ga0496124_0000096	Ga0496124_0000096_41894_43150	412
382	3300048928	Ga0496125_0001048	Ga0496125_0001048_13688_14929	412
383	3300049521	Ga0501298_002894	Ga0501298_002894_671_1918	412
384	3300049523	Ga0501300_000618	Ga0501300_000618_3451_4701	412
385	3300049665	Ga0501227_019651	Ga0501227_019651_77_1324	412
386	3300049671	Ga0501238_001556	Ga0501238_001556_19_1269	412
387	3300049679	Ga0501249_005039	Ga0501249_005039_1394_2641	412
388	3300049705	Ga0501225_0014502	Ga0501225_0014502_856_2103	412
389	3300049743	Ga0501081_0107531	Ga0501081_0107531_701_1948	412
390	3300049761	Ga0501264_000783	Ga0501264_000783_590_1843	412
391	3300050493	nmdc:mga0k408_17103_c1	nmdc:mga0k408_17103_c1_523_1857	412
392	3300050507	nmdc:mga05p37_30393_c1	nmdc:mga05p37_30393_c1_639_1886	412
393	3300050511	nmdc:mga08y16_85918_c1	nmdc:mga08y16_85918_c1_1618_2865	412
394	3300050511	nmdc:mga08y16_86950_c1	nmdc:mga08y16_86950_c1_421_1668	412
395	3300050512	nmdc:mga0n895_188_c1	nmdc:mga0n895_188_c1_1992_3239	412
396	3300050513	nmdc:mga0rr50_2434_c1	nmdc:mga0rr50_2434_c1_8051_9298	412
397	3300005329	Ga0070683_100019379	Ga0070683_1000193795	413
398	3300005535	Ga0070684_100023328	Ga0070684_1000233282	413
399	3300005563	Ga0068855_100000370	Ga0068855_10000037011	413
400	3300009093	Ga0105240_10000448	Ga0105240_1000044843	413
401	3300013100	Ga0157373_10134825	Ga0157373_101348252	413
402	3300013104	Ga0157370_10129400	Ga0157370_101294002	413
403	3300013105	Ga0157369_10078569	Ga0157369_100785692	413
404	3300021384	Ga0213876_10005891	Ga0213876_100058914	413
405	3300025913	Ga0207695_10000073	Ga0207695_10000073164	413
406	3300025944	Ga0207661_10013113	Ga0207661_100131132	413
407	3300025949	Ga0207667_10002679	Ga0207667_1000267916	413
408	3300039437	Ga0436365_1528891	Ga0436365_1528891_9256_10509	413
409	3300048924	Ga0496121_0085076	Ga0496121_0085076_39_1358	413
410	3300003320	rootH2_10013110	rootH2_1001311037	414
411	3300005272	Ga0065703_1019291	Ga0065703_10192912	414
412	3300005329	Ga0070683_100045696	Ga0070683_1000456962	414
413	3300005335	Ga0070666_10020758	Ga0070666_100207583	414
414	3300005340	Ga0070689_100030273	Ga0070689_1000302732	414
415	3300005365	Ga0070688_100141380	Ga0070688_1001413802	414
416	3300005367	Ga0070667_100011455	Ga0070667_1000114554	414
417	3300005441	Ga0070700_100080851	Ga0070700_1000808512	414
418	3300005539	Ga0068853_100073214	Ga0068853_1000732142	414
419	3300005616	Ga0068852_100009628	Ga0068852_1000096285	414
420	3300005617	Ga0068859_100237461	Ga0068859_1002374611	414
421	3300005618	Ga0068864_100015437	Ga0068864_1000154373	414
422	3300006358	Ga0068871_100087757	Ga0068871_1000877571	414
423	3300006931	Ga0097620_100237473	Ga0097620_1002374732	414
424	3300006946	Ga0079104_1000089	Ga0079104_100008957	414
425	3300006946	Ga0079104_1002688	Ga0079104_10026885	414
426	3300006946	Ga0079104_1009209	Ga0079104_10092092	414
427	3300009011	Ga0105251_10000556	Ga0105251_1000055627	414
428	3300009011	Ga0105251_10003006	Ga0105251_1000300611	414
429	3300009011	Ga0105251_10004897	Ga0105251_100048973	414
430	3300009011	Ga0105251_10012942	Ga0105251_100129423	414
431	3300009011	Ga0105251_10022742	Ga0105251_100227423	414
432	3300009036	Ga0105244_10002596	Ga0105244_1000259611	414
433	3300009092	Ga0105250_10001859	Ga0105250_100018594	414
434	3300009093	Ga0105240_10000008	Ga0105240_1000000812	414
435	3300009093	Ga0105240_10000326	Ga0105240_1000032614	414
436	3300009101	Ga0105247_10000140	Ga0105247_1000014026	414
437	3300009174	Ga0105241_10000006	Ga0105241_10000006195	414
438	3300009177	Ga0105248_10183699	Ga0105248_101836993	414
439	3300009551	Ga0105238_10011496	Ga0105238_100114965	414
440	3300010375	Ga0105239_10013992	Ga0105239_100139925	414
441	3300013100	Ga0157373_10006934	Ga0157373_100069343	414
442	3300013296	Ga0157374_10000003	Ga0157374_10000003721	414
443	3300013306	Ga0163162_10018480	Ga0163162_100184802	414
444	3300013307	Ga0157372_10000988	Ga0157372_1000098826	414
445	3300013308	Ga0157375_10026534	Ga0157375_100265343	414
446	3300014968	Ga0157379_10064283	Ga0157379_100642831	414
447	3300017792	Ga0163161_10104224	Ga0163161_101042242	414
448	3300025711	Ga0207696_1000014	Ga0207696_1000014214	414
449	3300025711	Ga0207696_1002080	Ga0207696_10020806	414
450	3300025728	Ga0207655_1020707	Ga0207655_10207072	414
451	3300025735	Ga0207713_1000139	Ga0207713_100013989	414
452	3300025735	Ga0207713_1000227	Ga0207713_100022729	414
453	3300025735	Ga0207713_1013540	Ga0207713_10135403	414
454	3300025900	Ga0207710_10000007	Ga0207710_10000007238	414
455	3300025903	Ga0207680_10015236	Ga0207680_100152362	414
456	3300025911	Ga0207654_10000008	Ga0207654_10000008198	414
457	3300025924	Ga0207694_10104571	Ga0207694_101045712	414
458	3300026041	Ga0207639_10003315	Ga0207639_100033156	414
459	3300026075	Ga0207708_10122223	Ga0207708_101222232	414
460	3300027111	Ga0209281_1000203	Ga0209281_100020357	414
461	3300027111	Ga0209281_1000225	Ga0209281_100022564	414
462	3300033180	Ga0307510_10007434	Ga0307510_100074342	414
463	3300046507	Ga0495606_0008914	Ga0495606_0008914_1835_3157	414
464	3300046530	Ga0495654_0000191	Ga0495654_0000191_4241_5500	414
465	3300046530	Ga0495654_0011945	Ga0495654_0011945_2235_3506	414
466	3300046542	Ga0495597_0000512	Ga0495597_0000512_21759_23030	414
467	3300046660	Ga0495625_0000891	Ga0495625_0000891_18993_20264	414
468	3300047320	Ga0495672_0000626	Ga0495672_0000626_29086_30357	414
469	3300047446	Ga0495679_000369	Ga0495679_000369_16680_17951	414
470	3300047472	Ga0495686_0000046	Ga0495686_0000046_135477_136769	414
471	3300005329	Ga0070683_100135049	Ga0070683_1001350492	415
472	3300005335	Ga0070666_10033994	Ga0070666_100339942	415
473	3300005344	Ga0070661_100050413	Ga0070661_1000504132	415
474	3300005364	Ga0070673_100013233	Ga0070673_1000132332	415
475	3300005456	Ga0070678_100069838	Ga0070678_1000698382	415
476	3300005457	Ga0070662_100028525	Ga0070662_1000285253	415
477	3300005535	Ga0070684_100023629	Ga0070684_1000236291	415
478	3300005548	Ga0070665_100130042	Ga0070665_1001300422	415
479	3300005617	Ga0068859_100154913	Ga0068859_1001549133	415
480	3300005618	Ga0068864_100025974	Ga0068864_1000259743	415
481	3300006237	Ga0097621_100005264	Ga0097621_1000052645	415
482	3300006358	Ga0068871_100226219	Ga0068871_1002262192	415
483	3300006931	Ga0097620_100154913	Ga0097620_1001549133	415
484	3300010375	Ga0105239_10174941	Ga0105239_101749412	415
485	3300013296	Ga0157374_10001132	Ga0157374_1000113218	415
486	3300013308	Ga0157375_10126767	Ga0157375_101267673	415
487	3300014325	Ga0163163_10001468	Ga0163163_100014687	415
488	3300014325	Ga0163163_10140112	Ga0163163_101401121	415
489	3300014745	Ga0157377_10025011	Ga0157377_100250112	415
490	3300014968	Ga0157379_10047371	Ga0157379_100473712	415
491	3300014969	Ga0157376_10004926	Ga0157376_100049266	415
492	3300017792	Ga0163161_10004011	Ga0163161_100040114	415
493	3300025903	Ga0207680_10012527	Ga0207680_100125271	415
494	3300025932	Ga0207690_10074741	Ga0207690_100747412	415
495	3300025933	Ga0207706_10002585	Ga0207706_100025858	415
496	3300025933	Ga0207706_10059980	Ga0207706_100599801	415
497	3300025936	Ga0207670_10034949	Ga0207670_100349492	415
498	3300025940	Ga0207691_10021581	Ga0207691_100215812	415
499	3300025942	Ga0207689_10010670	Ga0207689_100106706	415
500	3300025942	Ga0207689_10020426	Ga0207689_100204261	415
501	3300026023	Ga0207677_10111263	Ga0207677_101112632	415
502	3300026067	Ga0207678_10041514	Ga0207678_100415143	415
503	3300026095	Ga0207676_10009356	Ga0207676_100093562	415
504	3300026116	Ga0207674_10009206	Ga0207674_1000920611	415
505	3300026121	Ga0207683_10074424	Ga0207683_100744242	415
506	3300044712	Ga0453684_0034488	Ga0453684_0034488_4210_5460	415
507	3300046511	Ga0495608_0027349	Ga0495608_0027349_282_1556	415
508	3300046533	Ga0495640_0164945	Ga0495640_0164945_51_1325	415
509	3300048913	Ga0496110_0297592	Ga0496110_0297592_95_1369	415
510	iso_pu_bacteria	2643221716	2644642766	415
511	iso_pu_bacteria	8056440228	8056441983	415
512	3300025926	Ga0207659_10056638	Ga0207659_100566384	418
513	3300026089	Ga0207648_10131340	Ga0207648_101313401	418
514	3300002459	JGI24751J29686_10000559	JGI24751J29686_100005596	421
515	3300005331	Ga0070670_100016996	Ga0070670_1000169963	421
516	3300005618	Ga0068864_100021023	Ga0068864_1000210232	421
517	3300009553	Ga0105249_10009488	Ga0105249_100094887	421
518	3300014325	Ga0163163_10207130	Ga0163163_102071303	421
519	3300025925	Ga0207650_10010537	Ga0207650_100105373	421
520	3300025961	Ga0207712_10001625	Ga0207712_100016256	421
521	3300026095	Ga0207676_10026343	Ga0207676_100263432	421

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03825

Nuc_H_symport

Nucleoside H+ symporter

83

486

0.98 PF07690

MFS_1

Major Facilitator Superfamily

315

495

0.86 PF07638

Sigma70_ECF

ECF sigma factor

1

70

0.84 PF12832

MFS_1_like

MFS_1 like family

86

456

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7dla-assembly1.cif.gz_A	crystal structure of nucleoside transporter nupg (d323a mutant)	0.9476	2	407
7dla-assembly1.cif.gz_A	crystal structure of nucleoside transporter nupg (d323a mutant)	0.9453	2	407
7dl9-assembly2.cif.gz_B	crystal structure of nucleoside transporter nupg	0.9036	1	409
7dl9-assembly2.cif.gz_B	crystal structure of nucleoside transporter nupg	0.9015	1	409
7yr5-assembly1.cif.gz_A	embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state	0.7883	6	404

ID	Description	Score	Start	End	Superfamily
af_P45562_195_403_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9897	200	407	1.20.1250.20
af_P45562_195_403_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9803	200	407	1.20.1250.20
af_P0AFF4_5_189_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9628	6	193	1.20.1250.20
af_P0AFF4_5_189_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9526	6	193	1.20.1250.20
af_P45562_4_189_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.9378	5	196	1.20.1250.20

ID	Description	Score	Start	End	GO Terms
AF-G5LTJ7-F1-model_v4	Nucleoside permease NupG	0.9767	130	412	GO:0005886 GO:0015212 GO:0015213
AF-A0A1M6C443-F1-model_v4	Nucleoside transporter	0.9751	215	409	GO:0005886 GO:0015212 GO:0015213
AF-A0A4U9TAS4-F1-model_v4	deleted	0.9742	134	420
AF-F4VEL2-F1-model_v4	deleted	0.9709	208	420
AF-A0A6B2G8M1-F1-model_v4	Nucleoside permease	0.9706	137	420	GO:0005886 GO:0015212 GO:0015213

Feature Viewer

pLDDT	pTM	Quality
89.02	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F458630

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03825

Nuc_H_symport

Nucleoside H+ symporter

83

486

0.98

PF07690

MFS_1

Major Facilitator Superfamily

315

495

0.86

PF07638

Sigma70_ECF

ECF sigma factor

1

70

0.84

PF12832

MFS_1_like

MFS_1 like family

86

456

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map