F458582

General Info

Members Datasets Scaffolds Average Seq Length
520 326 1040 161

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0366507|Ga0466957_0366507_396_965
Length 189
Sequence VIFVDFQYAIAFRSLCVCHNGRAQNGGMDNHPNVQAVRDALAAAGARTTDGSTPQVVILDEAVHTAPAAADALGVAVGQIANSLIFDADGEPLLVLTSGAHRVDTAKVAADQGVGKLRRATPEFVREHTGQAIGGVAPVGHPKPIRTLVDTALAGYPVVWAAGGVPRAVFPITYAELLRVTDGTPADVA

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
170 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
178 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
179 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
180 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
181 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
273 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
278 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
279 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
280 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
281 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
282 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
283 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
288 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
289 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
290 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
291 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
292 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
293 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
294 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
295 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
296 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
297 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
298 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
299 2858882152 Micromonospora noduli MED15 Isolate Nodule
300 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
301 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
302 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
303 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
304 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
305 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
306 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
307 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
308 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
309 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
310 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
311 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
312 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
313 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
314 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
315 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
316 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
317 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
318 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
319 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
320 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
321 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
322 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
323 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
324 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
325 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
326 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.12
Metatranscriptomes 0.19
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0.96
Rhizoplane 6.15
Rhizosphere 80.58
Stem 0
Stem Tuber 0
Unclassified 1.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0366507 3300044842 Bacteria 980
2 JGI25406J46586_10006338 3300003203 Bacteria 5458
3 JGI25405J52794_10016738 3300003911 Bacteria 1451
4 JGI25405J52794_10064131 3300003911 Bacteria 797
5 Ga0068869_100223361 3300005334 Bacteria 1494
6 Ga0070666_10098653 3300005335 Bacteria 2012
7 Ga0070682_100019613 3300005337 Bacteria 3969
8 Ga0070689_100401523 3300005340 Bacteria 1159
9 Ga0070668_100041738 3300005347 Bacteria 3515
10 Ga0070673_100188792 3300005364 Bacteria 1769
11 Ga0070709_10027788 3300005434 Bacteria 3367
12 Ga0070713_100183931 3300005436 Bacteria 1879
13 Ga0070713_101004737 3300005436 Bacteria 805
14 Ga0070710_10010097 3300005437 Bacteria 4632
15 Ga0070711_100060634 3300005439 Bacteria 2630
16 Ga0070705_100382209 3300005440 Bacteria 1036
17 Ga0070663_100056398 3300005455 Bacteria 2815
18 Ga0070678_100164224 3300005456 Bacteria 1802
19 Ga0070681_10446063 3300005458 Bacteria 1206
20 Ga0070679_100114884 3300005530 Bacteria 2677
21 Ga0070679_100718480 3300005530 Bacteria 942
22 Ga0068853_100044618 3300005539 Bacteria 3795
23 Ga0070696_100076414 3300005546 Bacteria 2364
24 Ga0070693_100407158 3300005547 Bacteria 945
25 Ga0070665_100050911 3300005548 Bacteria 4156
26 Ga0070665_100131616 3300005548 Bacteria 2504
27 Ga0070665_100264522 3300005548 Bacteria 1721
28 Ga0070665_100293924 3300005548 Bacteria 1627
29 Ga0070665_100490179 3300005548 Bacteria 1240
30 Ga0070704_100040403 3300005549 Bacteria 3211
31 Ga0068855_100001729 3300005563 Bacteria 27297
32 Ga0068857_100306756 3300005577 Bacteria 1464
33 Ga0068857_100433117 3300005577 Bacteria 1228
34 Ga0068854_100013763 3300005578 Bacteria 5319
35 Ga0068854_100758728 3300005578 Bacteria 842
36 Ga0068856_100004071 3300005614 Bacteria 14629
37 Ga0068856_100007390 3300005614 Bacteria 10722
38 Ga0068852_100011462 3300005616 Bacteria 6675
39 Ga0068852_100738132 3300005616 Bacteria 996
40 Ga0068859_100215022 3300005617 Bacteria 2009
41 Ga0068859_101622904 3300005617 Bacteria 714
42 Ga0068864_100086715 3300005618 Bacteria 2755
43 Ga0068866_10385110 3300005718 Bacteria 900
44 Ga0068851_10473536 3300005834 Bacteria 747
45 Ga0068863_100021550 3300005841 Bacteria 6148
46 Ga0068863_101614448 3300005841 Bacteria 658
47 Ga0068858_100019039 3300005842 Bacteria 6423
48 Ga0068858_100136716 3300005842 Bacteria 2300
49 Ga0068860_100032666 3300005843 Bacteria 5000
50 Ga0068862_100062517 3300005844 Bacteria 3202
51 Ga0068862_101412993 3300005844 Bacteria 699
52 Ga0081455_10000660 3300005937 Bacteria 44685
53 Ga0081455_10001889 3300005937 Bacteria 25199
54 Ga0081455_10006930 3300005937 Bacteria 12051
55 Ga0081455_10007468 3300005937 Bacteria 11513
56 Ga0081455_10079490 3300005937 Bacteria 2692
57 Ga0081455_10139616 3300005937 Bacteria 1884
58 Ga0081455_10232658 3300005937 Bacteria 1359
59 Ga0081455_10281354 3300005937 Bacteria 1202
60 Ga0081538_10001112 3300005981 Bacteria 28483
61 Ga0081540_1018698 3300005983 Bacteria 4241
62 Ga0081539_10000242 3300005985 Bacteria 127897
63 Ga0081539_10000253 3300005985 Bacteria 124747
64 Ga0081539_10000364 3300005985 Bacteria 99066
65 Ga0081539_10002412 3300005985 Bacteria 26444
66 Ga0081539_10133033 3300005985 Bacteria 1219
67 Ga0081539_10166003 3300005985 Bacteria 1048
68 Ga0070717_10310158 3300006028 Bacteria 1404
69 Ga0070717_10403958 3300006028 Bacteria 1227
70 Ga0075364_10727521 3300006051 Bacteria 677
71 Ga0075432_10000011 3300006058 Bacteria 35422
72 Ga0075432_10000400 3300006058 Bacteria 12664
73 Ga0070712_100070872 3300006175 Bacteria 2492
74 Ga0068871_100132818 3300006358 Bacteria 2112
75 Ga0075428_100002261 3300006844 Bacteria 20852
76 Ga0075428_100009022 3300006844 Bacteria 11065
77 Ga0075428_100025264 3300006844 Bacteria 6574
78 Ga0075428_100138053 3300006844 Bacteria 2651
79 Ga0075430_100004478 3300006846 Bacteria 11779
80 Ga0075430_100020675 3300006846 Bacteria 5599
81 Ga0075430_100162043 3300006846 Bacteria 1862
82 Ga0075431_100012896 3300006847 Bacteria 8436
83 Ga0075431_100028355 3300006847 Bacteria 5752
84 Ga0075431_100053876 3300006847 Bacteria 4148
85 Ga0075431_100706962 3300006847 Bacteria 985
86 Ga0075433_10000526 3300006852 Bacteria 25062
87 Ga0075433_10013663 3300006852 Bacteria 6611
88 Ga0075434_100000622 3300006871 Bacteria 27325
89 Ga0075434_100001913 3300006871 Bacteria 18047
90 Ga0075429_100019971 3300006880 Bacteria 5810
91 Ga0075429_100036584 3300006880 Bacteria 4270
92 Ga0075429_100089386 3300006880 Bacteria 2685
93 Ga0075429_100226451 3300006880 Bacteria 1637
94 Ga0097620_100215026 3300006931 Bacteria 2009
95 Ga0097620_100850006 3300006931 Bacteria 999
96 Ga0097620_101623250 3300006931 Bacteria 714
97 Ga0075435_100000387 3300007076 Bacteria 26901
98 Ga0075435_100065371 3300007076 Bacteria 2957
99 Ga0105240_10010196 3300009093 Bacteria 13224
100 Ga0105240_10030467 3300009093 Bacteria 7013
101 Ga0111539_10000029 3300009094 Bacteria 184798
102 Ga0111539_10003884 3300009094 Bacteria 19670
103 Ga0105245_10244150 3300009098 Bacteria 1742
104 Ga0105245_11046398 3300009098 Bacteria 861
105 Ga0105247_10330832 3300009101 Bacteria 1066
106 Ga0114129_10005281 3300009147 Bacteria 18222
107 Ga0114129_10007314 3300009147 Bacteria 15718
108 Ga0114129_10009563 3300009147 Bacteria 13828
109 Ga0114129_10009978 3300009147 Bacteria 13532
110 Ga0114129_10015183 3300009147 Bacteria 10961
111 Ga0114129_10241436 3300009147 Bacteria 2428
112 Ga0114129_11188070 3300009147 Bacteria 951
113 Ga0105243_10221312 3300009148 Bacteria 1673
114 Ga0105241_10005121 3300009174 Bacteria 9669
115 Ga0105241_10174782 3300009174 Bacteria 1776
116 Ga0105241_12101201 3300009174 Bacteria 558
117 Ga0105242_11203651 3300009176 Unclassified 777
118 Ga0105248_10216030 3300009177 Bacteria 2159
119 Ga0105248_10330705 3300009177 Bacteria 1716
120 Ga0105237_10037249 3300009545 Bacteria 4918
121 Ga0105237_10286731 3300009545 Bacteria 1649
122 Ga0105237_10847383 3300009545 Bacteria 921
123 Ga0105238_10037219 3300009551 Bacteria 4948
124 Ga0105249_11545143 3300009553 Bacteria 736
125 Ga0105033_100569 3300009986 Bacteria 2860
126 Ga0105239_10027638 3300010375 Bacteria 6242
127 Ga0105239_10058710 3300010375 Bacteria 4222
128 Ga0105239_10093535 3300010375 Bacteria 3319
129 Ga0105246_10243356 3300011119 Bacteria 1423
130 Ga0105246_10859942 3300011119 Bacteria 810
131 Ga0157373_10129985 3300013100 Bacteria 1771
132 Ga0157371_10636038 3300013102 Bacteria 795
133 Ga0157374_10222828 3300013296 Bacteria 1851
134 Ga0157374_10463591 3300013296 Bacteria 1269
135 Ga0163162_10073392 3300013306 Bacteria 3477
136 Ga0163162_10427620 3300013306 Bacteria 1456
137 Ga0163162_11151830 3300013306 Bacteria 879
138 Ga0157372_10016676 3300013307 Bacteria 7885
139 Ga0157372_10100337 3300013307 Bacteria 3304
140 Ga0157375_10595837 3300013308 Bacteria 1265
141 Ga0157375_11466240 3300013308 Bacteria 805
142 Ga0157515_110198 3300013875 Bacteria 692
143 Ga0163163_10032282 3300014325 Bacteria 5056
144 Ga0163163_10373161 3300014325 Bacteria 1484
145 Ga0163163_10644315 3300014325 Bacteria 1123
146 Ga0157377_10421078 3300014745 Bacteria 915
147 Ga0157379_10015989 3300014968 Bacteria 6596
148 Ga0157379_10070527 3300014968 Bacteria 3126
149 Ga0163161_10044862 3300017792 Bacteria 3185
150 Ga0206353_10609391 3300020082 Bacteria 609
151 Ga0207692_10456501 3300025898 Bacteria 805
152 Ga0207642_10060734 3300025899 Bacteria 1755
153 Ga0207710_10266324 3300025900 Bacteria 860
154 Ga0207680_10563000 3300025903 Bacteria 814
155 Ga0207647_10003497 3300025904 Bacteria 11778
156 Ga0207647_10135906 3300025904 Bacteria 1443
157 Ga0207699_10608348 3300025906 Bacteria 796
158 Ga0207654_10088922 3300025911 Bacteria 1878
159 Ga0207654_10856510 3300025911 Bacteria 658
160 Ga0207695_10012660 3300025913 Bacteria 10105
161 Ga0207695_10023232 3300025913 Bacteria 7014
162 Ga0207671_10002039 3300025914 Bacteria 22187
163 Ga0207693_10024949 3300025915 Bacteria 4742
164 Ga0207681_10455275 3300025923 Bacteria 1042
165 Ga0207694_10005592 3300025924 Bacteria 9634
166 Ga0207694_10311950 3300025924 Bacteria 1297
167 Ga0207687_10130571 3300025927 Bacteria 1893
168 Ga0207700_10196060 3300025928 Bacteria 1699
169 Ga0207664_10010837 3300025929 Bacteria 6454
170 Ga0207664_10372636 3300025929 Bacteria 1266
171 Ga0207644_10876831 3300025931 Bacteria 752
172 Ga0207690_10057224 3300025932 Bacteria 2633
173 Ga0207690_11135318 3300025932 Bacteria 652
174 Ga0207711_10066401 3300025941 Bacteria 3120
175 Ga0207711_10235722 3300025941 Bacteria 1677
176 Ga0207689_10098958 3300025942 Bacteria 2396
177 Ga0207661_10405945 3300025944 Bacteria 1236
178 Ga0207667_10017915 3300025949 Bacteria 7960
179 Ga0207667_11325983 3300025949 Bacteria 695
180 Ga0207651_10081574 3300025960 Bacteria 2332
181 Ga0207712_10100886 3300025961 Bacteria 2146
182 Ga0207668_10032926 3300025972 Bacteria 3431
183 Ga0207668_10334147 3300025972 Bacteria 1262
184 Ga0207640_10037303 3300025981 Bacteria 3057
185 Ga0207640_10080462 3300025981 Bacteria 2224
186 Ga0207658_10049401 3300025986 Bacteria 3091
187 Ga0207658_10193010 3300025986 Bacteria 1695
188 Ga0207703_10031078 3300026035 Bacteria 4221
189 Ga0207703_10255989 3300026035 Bacteria 1580
190 Ga0207639_10035859 3300026041 Bacteria 3672
191 Ga0207678_10019442 3300026067 Bacteria 5967
192 Ga0207708_10117251 3300026075 Bacteria 2072
193 Ga0207702_10007850 3300026078 Bacteria 9051
194 Ga0207702_10160914 3300026078 Bacteria 2050
195 Ga0207641_10004769 3300026088 Bacteria 11694
196 Ga0207641_10809636 3300026088 Bacteria 927
197 Ga0207648_10177257 3300026089 Bacteria 1885
198 Ga0207676_10045054 3300026095 Bacteria 3406
199 Ga0207676_10739327 3300026095 Bacteria 956
200 Ga0207674_10118837 3300026116 Bacteria 2613
201 Ga0207674_10236586 3300026116 Bacteria 1774
202 Ga0207675_100044422 3300026118 Bacteria 4152
203 Ga0207675_100070220 3300026118 Bacteria 3274
204 Ga0207683_10013434 3300026121 Bacteria 6986
205 Ga0207683_10739113 3300026121 Bacteria 913
206 Ga0207683_10972670 3300026121 Bacteria 788
207 Ga0207698_10023022 3300026142 Bacteria 4345
208 Ga0207428_10000496 3300027907 Bacteria 47043
209 Ga0207428_10000730 3300027907 Bacteria 37917
210 Ga0268266_10042879 3300028379 Bacteria 3866
211 Ga0268266_10052085 3300028379 Bacteria 3515
212 Ga0268265_10211788 3300028380 Bacteria 1689
213 Ga0268265_10271957 3300028380 Bacteria 1512
214 Ga0268264_10048010 3300028381 Bacteria 3550
215 Ga0268264_10140645 3300028381 Bacteria 2152
216 Ga0307515_10000356 3300028794 Bacteria 112492
217 Ga0307515_10008871 3300028794 Bacteria 19529
218 Ga0307515_10016392 3300028794 Bacteria 13563
219 Ga0307515_10069077 3300028794 Bacteria 4839
220 Ga0307515_10147850 3300028794 Bacteria 2477
221 Ga0307515_10482401 3300028794 Bacteria 852
222 Ga0265338_10040643 3300028800 Bacteria 4364
223 Ga0307512_10005363 3300030522 Bacteria 13410
224 Ga0307512_10027409 3300030522 Bacteria 5012
225 Ga0307512_10069096 3300030522 Bacteria 2643
226 Ga0265325_10034130 3300031241 Bacteria 2710
227 Ga0265340_10002843 3300031247 Bacteria 9849
228 Ga0265339_10198478 3300031249 Bacteria 991
229 Ga0265316_10135006 3300031344 Bacteria 1857
230 Ga0265316_10399441 3300031344 Bacteria 990
231 Ga0307513_10014170 3300031456 Bacteria 9755
232 Ga0307513_10149991 3300031456 Bacteria 2242
233 Ga0307513_10435836 3300031456 Bacteria 1038
234 Ga0307509_10018964 3300031507 Bacteria 7873
235 Ga0265313_10027459 3300031595 Bacteria 2979
236 Ga0307508_10005569 3300031616 Bacteria 11962
237 Ga0307508_10087730 3300031616 Bacteria 2695
238 Ga0307508_10355962 3300031616 Bacteria 1055
239 Ga0265342_10044728 3300031712 Bacteria 2668
240 Ga0316576_10003849 3300031727 Bacteria 8893
241 Ga0316576_10071769 3300031727 Bacteria 2554
242 Ga0316578_10050161 3300031728 Bacteria 2441
243 Ga0307516_10005090 3300031730 Bacteria 15894
244 Ga0307405_10083952 3300031731 Bacteria 2089
245 Ga0307405_10085517 3300031731 Bacteria 2073
246 Ga0307413_10002405 3300031824 Bacteria 7598
247 Ga0307413_10154978 3300031824 Bacteria 1601
248 Ga0307413_10446209 3300031824 Bacteria 1026
249 Ga0307413_10659650 3300031824 Bacteria 864
250 Ga0307518_10000154 3300031838 Bacteria 50652
251 Ga0307518_10107471 3300031838 Bacteria 1991
252 Ga0307410_10000966 3300031852 Bacteria 12346
253 Ga0326468_10000343 3300031889 Bacteria 4913
254 Ga0307406_10001364 3300031901 Bacteria 13659
255 Ga0307406_10010615 3300031901 Bacteria 5199
256 Ga0307406_10046373 3300031901 Bacteria 2734
257 Ga0307406_10095172 3300031901 Bacteria 2015
258 Ga0307406_10338365 3300031901 Bacteria 1171
259 Ga0307406_10349352 3300031901 Bacteria 1155
260 Ga0307407_10012038 3300031903 Bacteria 4145
261 Ga0307412_10011465 3300031911 Bacteria 5138
262 Ga0307409_100010755 3300031995 Bacteria 5715
263 Ga0307409_100491252 3300031995 Bacteria 1193
264 Ga0307409_100840191 3300031995 Bacteria 928
265 Ga0307416_100000447 3300032002 Bacteria 21138
266 Ga0307416_100096119 3300032002 Bacteria 2561
267 Ga0307416_100353106 3300032002 Bacteria 1489
268 Ga0307416_100446318 3300032002 Bacteria 1345
269 Ga0307416_100559488 3300032002 Bacteria 1218
270 Ga0307416_100814468 3300032002 Bacteria 1030
271 Ga0307416_101263167 3300032002 Unclassified 844
272 Ga0307411_10043712 3300032005 Bacteria 2868
273 Ga0307411_10357835 3300032005 Bacteria 1192
274 Ga0307411_10451390 3300032005 Bacteria 1076
275 Ga0307411_11310047 3300032005 Bacteria 660
276 Ga0307415_100002163 3300032126 Bacteria 9743
277 Ga0307415_100002390 3300032126 Bacteria 9355
278 Ga0307415_100023262 3300032126 Bacteria 3843
279 Ga0307415_100025798 3300032126 Bacteria 3696
280 Ga0307415_100064531 3300032126 Bacteria 2548
281 Ga0307415_100135979 3300032126 Bacteria 1869
282 Ga0307415_100304823 3300032126 Bacteria 1321
283 Ga0307415_100535112 3300032126 Bacteria 1031
284 Ga0307415_100634938 3300032126 Bacteria 955
285 Ga0316580_10011899 3300032139 Bacteria 2644
286 Ga0307507_10022105 3300033179 Bacteria 7047
287 Ga0307507_10092603 3300033179 Bacteria 2579
288 Ga0307507_10185340 3300033179 Bacteria 1477
289 Ga0307507_10526072 3300033179 Bacteria 630
290 Ga0307510_10055517 3300033180 Bacteria 4136
291 Ga0373950_0069021 3300034818 Bacteria 721
292 Ga0373929_0074297 3300035085 Bacteria 818
293 Ga0373940_0005428 3300035088 Bacteria 2762
294 Ga0373932_0012771 3300035112 Bacteria 2075
295 Ga0373941_0163629 3300035115 Bacteria 824
296 Ga0373941_0321277 3300035115 Bacteria 623
297 Ga0373960_0087686 3300035121 Bacteria 990
298 Ga0373942_0000062 3300035207 Bacteria 22455
299 Ga0373962_0000873 3300035242 Bacteria 6879
300 Ga0316574_0009196 3300035398 Bacteria 5525
301 Ga0316574_0306626 3300035398 Bacteria 1009
302 Ga0316574_0654517 3300035398 Bacteria 646
303 Ga0373935_0215338 3300035692 Bacteria 1332
304 Ga0316582_0224525 3300036647 Unclassified 1285
305 Ga0395899_0408429 3300037312 Bacteria 897
306 Ga0395900_0016536 3300037418 Bacteria 7526
307 Ga0395898_0015470 3300037466 Bacteria 7826
308 Ga0395905_0029084 3300037471 Bacteria 5208
309 Ga0395901_0054149 3300038443 Bacteria 4169
310 Ga0451797_1570362 3300041453 Bacteria 843
311 Ga0451804_1006147 3300041463 Bacteria 644
312 Ga0451807_2433022 3300041486 Bacteria 757
313 Ga0439442_031972 3300042002 Bacteria 1100
314 Ga0439448_0067983 3300042005 Bacteria 1184
315 Ga0439449_0079885 3300042007 Bacteria 1206
316 Ga0439450_192413 3300042008 Unclassified 544
317 Ga0439455_0108216 3300042012 Bacteria 772
318 Ga0439455_0261762 3300042012 Bacteria 507
319 Ga0439463_004924 3300042016 Bacteria 3332
320 Ga0450902_094670 3300042137 Unclassified 529
321 Ga0450903_044199 3300042138 Unclassified 657
322 Ga0439464_0012155 3300042439 Bacteria 2289
323 Ga0439440_0005654 3300042993 Bacteria 2487
324 Ga0466966_0257955 3300044684 Bacteria 1050
325 Ga0466966_0392746 3300044684 Bacteria 833
326 Ga0466963_0968558 3300044694 Bacteria 599
327 Ga0466964_0218095 3300044706 Bacteria 925
328 Ga0466964_0523715 3300044706 Bacteria 640
329 Ga0466970_0399181 3300044765 Bacteria 784
330 Ga0466957_0026027 3300044842 Bacteria 3470
331 Ga0466959_0042345 3300045049 Bacteria 3359
332 Ga0466958_0022988 3300045836 Bacteria 3656
333 Ga0466967_0164237 3300045976 Bacteria 2086
334 Ga0466967_0268443 3300045976 Bacteria 1634
335 Ga0466967_0386940 3300045976 Bacteria 1359
336 Ga0466967_0525758 3300045976 Bacteria 1163
337 Ga0495627_113471 3300046453 Bacteria 768
338 Ga0495592_0004242 3300046454 Bacteria 10473
339 Ga0495592_0867100 3300046454 Bacteria 532
340 Ga0495603_0701614 3300046455 Bacteria 579
341 Ga0495651_0087588 3300046462 Bacteria 2341
342 Ga0495580_0004371 3300046472 Bacteria 11866
343 Ga0495580_0679541 3300046472 Bacteria 675
344 Ga0495582_0289051 3300046473 Bacteria 942
345 Ga0495662_0108401 3300046476 Bacteria 1360
346 Ga0495664_0446947 3300046477 Bacteria 774
347 Ga0495585_0041683 3300046492 Bacteria 2574
348 Ga0495594_0188913 3300046499 Bacteria 1173
349 Ga0495606_0004849 3300046507 Bacteria 13195
350 Ga0495618_0674737 3300046514 Bacteria 609
351 Ga0495637_0164111 3300046520 Bacteria 832
352 Ga0495644_0044815 3300046523 Bacteria 1664
353 Ga0495652_0001486 3300046529 Bacteria 25887
354 Ga0495652_0679499 3300046529 Bacteria 694
355 Ga0495640_0118062 3300046533 Bacteria 1726
356 Ga0495586_0019182 3300046535 Bacteria 3638
357 Ga0495587_0210735 3300046536 Bacteria 1097
358 Ga0495645_0149343 3300046543 Bacteria 1625
359 Ga0495667_0011657 3300046559 Bacteria 5950
360 Ga0495656_0253847 3300046615 Bacteria 889
361 Ga0495668_0000644 3300046616 Bacteria 41961
362 Ga0495634_0135421 3300046642 Bacteria 1567
363 Ga0495625_0001056 3300046660 Bacteria 36110
364 Ga0495635_0063647 3300046663 Bacteria 2532
365 Ga0495657_0662377 3300046675 Bacteria 601
366 Ga0495599_0006915 3300046678 Bacteria 6856
367 Ga0495623_0488618 3300046679 Bacteria 651
368 Ga0495600_0303183 3300046809 Bacteria 1007
369 Ga0495604_0069024 3300047317 Bacteria 2680
370 Ga0495674_0086509 3300047319 Bacteria 2683
371 Ga0495675_0478540 3300047444 Bacteria 717
372 Ga0495684_0117192 3300047471 Bacteria 2007
373 Ga0495626_0000563 3300048091 Bacteria 36858
374 Ga0496100_0102686 3300048903 Bacteria 1973
375 Ga0496101_0031765 3300048904 Bacteria 3714
376 Ga0496102_0130208 3300048905 Bacteria 2354
377 Ga0496102_0902782 3300048905 Bacteria 805
378 Ga0496103_0038166 3300048906 Bacteria 2946
379 Ga0496104_0087979 3300048907 Bacteria 2967
380 Ga0496104_0168931 3300048907 Bacteria 2098
381 Ga0496104_0396543 3300048907 Bacteria 1292
382 Ga0496104_0445602 3300048907 Bacteria 1207
383 Ga0496105_0008699 3300048908 Bacteria 7899
384 Ga0496105_0091833 3300048908 Bacteria 2507
385 Ga0496105_0358572 3300048908 Unclassified 1163
386 Ga0496105_1120602 3300048908 Bacteria 583
387 Ga0496106_0831474 3300048909 Bacteria 731
388 Ga0496107_0302029 3300048910 Bacteria 1191
389 Ga0496108_0000130 3300048911 Bacteria 74276
390 Ga0496108_0012414 3300048911 Bacteria 6932
391 Ga0496109_0009874 3300048912 Bacteria 8148
392 Ga0496110_0048013 3300048913 Bacteria 3740
393 Ga0496111_0030704 3300048914 Bacteria 3822
394 Ga0496112_0037641 3300048915 Bacteria 4721
395 Ga0496112_0056367 3300048915 Bacteria 3867
396 Ga0496112_0116645 3300048915 Bacteria 2640
397 Ga0496113_0328437 3300048916 Bacteria 1226
398 Ga0496113_0723081 3300048916 Bacteria 794
399 Ga0496114_0000468 3300048917 Bacteria 29550
400 Ga0496114_0015473 3300048917 Bacteria 6133
401 Ga0496114_0121418 3300048917 Bacteria 2247
402 Ga0496115_0192171 3300048918 Bacteria 1686
403 Ga0501034_0013335 3300049571 Bacteria 8464
404 Ga0501034_0475433 3300049571 Bacteria 1165
405 Ga0501034_0686625 3300049571 Bacteria 923
406 Ga0501036_0002330 3300049572 Bacteria 14849
407 Ga0501037_0019249 3300049573 Bacteria 5032
408 Ga0501038_0015106 3300049574 Bacteria 7027
409 Ga0501038_0237711 3300049574 Unclassified 1447
410 Ga0501039_0057421 3300049575 Bacteria 3014
411 Ga0501042_0016451 3300049578 Bacteria 5076
412 Ga0501043_0006145 3300049579 Bacteria 9645
413 Ga0501046_0128099 3300049580 Bacteria 1927
414 Ga0501046_0197952 3300049580 Bacteria 1496
415 Ga0501047_0002369 3300049581 Bacteria 18022
416 Ga0501047_0357006 3300049581 Bacteria 1298
417 Ga0501048_0029510 3300049582 Bacteria 3977
418 Ga0501067_0506540 3300049583 Bacteria 675
419 Ga0501068_0300353 3300049584 Bacteria 1028
420 Ga0501069_0042701 3300049585 Bacteria 2509
421 Ga0501070_0003335 3300049586 Bacteria 13946
422 Ga0501073_0252132 3300049589 Bacteria 1218
423 Ga0501074_0024508 3300049590 Bacteria 4385
424 Ga0501075_1384001 3300049591 Bacteria 533
425 Ga0501077_0412523 3300049593 Bacteria 864
426 Ga0501081_0359956 3300049743 Bacteria 1073
427 Ga0501081_0702653 3300049743 Bacteria 759
428 Ga0501044_0053055 3300049823 Bacteria 4173
429 Ga0501044_0404055 3300049823 Bacteria 1278
430 Ga0501045_0206647 3300049824 Bacteria 1463
431 nmdc:mga00v17_624031_c1 3300050491 Bacteria 694
432 nmdc:mga05p37_240_c1 3300050507 Bacteria 56075
433 nmdc:mga05p37_64901_c1 3300050507 Bacteria 4493
434 nmdc:mga05p37_7034_c1 3300050507 Bacteria 13262
435 nmdc:mga05p37_742_c1 3300050507 Bacteria 36147
436 nmdc:mga05p37_851837_c1 3300050507 Bacteria 990
437 nmdc:mga09592_1167415_c1 3300050508 Bacteria 638
438 nmdc:mga09592_14_c1 3300050508 Bacteria 66825
439 nmdc:mga09592_18883_c1 3300050508 Bacteria 5655
440 nmdc:mga09592_20716_c1 3300050508 Bacteria 5411
441 nmdc:mga09592_29495_c1 3300050508 Bacteria 4563
442 nmdc:mga09592_34875_c1 3300050508 Bacteria 4208
443 nmdc:mga09592_852427_c1 3300050508 Unclassified 768
444 nmdc:mga0qj67_11349_c1 3300050509 Bacteria 6674
445 nmdc:mga0qj67_13598_c1 3300050509 Bacteria 6140
446 nmdc:mga0qj67_283705_c1 3300050509 Bacteria 1342
447 nmdc:mga0qj67_54_c4 3300050509 Bacteria 15718
448 nmdc:mga06r32_18_c3 3300050510 Bacteria 53938
449 nmdc:mga06r32_22802_c1 3300050510 Bacteria 5791
450 nmdc:mga06r32_267215_c1 3300050510 Bacteria 1698
451 nmdc:mga06r32_435593_c1 3300050510 Bacteria 1291
452 nmdc:mga06r32_636514_c1 3300050510 Bacteria 1035
453 nmdc:mga06r32_71466_c1 3300050510 Bacteria 3358
454 nmdc:mga08y16_18035_c1 3300050511 Bacteria 7435
455 nmdc:mga0n895_1015_c1 3300050512 Bacteria 20402
456 nmdc:mga0n895_153222_c1 3300050512 Bacteria 2336
457 nmdc:mga0n895_9303_c1 3300050512 Bacteria 8585
458 nmdc:mga0rr50_12159_c1 3300050513 Bacteria 5548
459 nmdc:mga0rr50_805_c1 3300050513 Bacteria 16907
460 nmdc:mga08x19_78192_c1 3300050514 Bacteria 2168
461 nmdc:mga0a205_20537_c1 3300050515 Bacteria 6234
462 nmdc:mga0a205_474_c1 3300050515 Bacteria 31330
463 Ga0495601_0036668 3300053077 Bacteria 3063
464 Ga0495595_0528024 3300053084 Bacteria 602
465 Ga0500644_0029483 3300053088 Bacteria 1726
466 Ga0500646_0000443 3300053090 Bacteria 12281
467 Ga0500583_0002429 3300053092 Bacteria 5597
468 Ga0500566_0430973 3300053094 Bacteria 582
469 Ga0500641_0016646 3300053096 Bacteria 2740
470 Ga0500569_002462 3300053109 Bacteria 3649
471 Ga0500594_0191036 3300053118 Bacteria 670
472 Ga0500621_146045 3300053126 Bacteria 892
473 Ga0500577_0115136 3300053142 Bacteria 1113
474 Ga0500588_0002191 3300053146 Bacteria 3917
475 Ga0500600_0145833 3300053149 Bacteria 1185
476 Ga0590075_004624 3300059424 Bacteria 3260
477 Ga0501082_0988233 3300060353 Bacteria 736
478 Ga0466962_0037968 3300061719 Bacteria 2307
479 Ga0466962_0381497 3300061719 Bacteria 704
480 Ga0530510_0046628 3300061734 Bacteria 3131
481 2515719116 2515154129 Bacteria 5584369
482 2586062758 2585427649 Bacteria 9053857
483 2623590836 2622736626 Bacteria 7181580
484 2753268330 2751185782 Bacteria 11227053
485 2791912638 2791354901 Bacteria 8322202
486 2795784331 2795385470 Bacteria 8317180
487 2809588059 2808606522 Bacteria 9488490
488 2832010531 2832004796 Bacteria 6538017
489 2855676416 2855670206 Bacteria 7120389
490 2855678662 2855676851 Bacteria 7063653
491 2857289307 2857288857 Bacteria 7189066
492 2858855181 2858848962 Bacteria 6963058
493 2858888746 2858882152 Bacteria 7230291
494 2858889020 2858888857 Bacteria 7060307
495 2858897407 2858895516 Bacteria 7378898
496 2866066249 2866065130 Bacteria 6518152
497 2866615118 2866612099 Bacteria 7543886
498 2867303519 2867302475 Bacteria 7087181
499 2867316125 2867312974 Bacteria 7058875
500 2867320991 2867319477 Bacteria 7069771
501 2867511758 2867507094 Bacteria 6506033
502 2869051858 2869048445 Bacteria 6875584
503 2869067381 2869061728 Bacteria 7112407
504 2869075219 2869068681 Bacteria 7205615
505 2880489668 2880489317 Bacteria 7096270
506 2880496035 2880495981 Bacteria 7340502
507 2887481115 2887478801 Bacteria 8972725
508 2891331915 2891326441 Bacteria 6439512
509 2899363931 2899359706 Bacteria 10940472
510 2915773580 2915768154 Bacteria 8424322
511 2929224712 2929219909 Bacteria 6984360
512 2929232349 2929226422 Bacteria 7248583
513 2966927288 2966924647 Bacteria 3268643
514 2974306921 2974302888 Bacteria 4369871
515 2996227553 2996221748 Bacteria 6799777
516 8001789953 8001781756 Bacteria 9586736
517 8003862170 8003856774 Bacteria 7675274
518 8054707757 8054704163 Bacteria 7247792
519 8054732799 8054727385 Bacteria 7558670
520 8054739012 8054734606 Bacteria 6947278
521 Ga0466957_0366507
522 JGI25406J46586_10006338
523 JGI25405J52794_10016738
524 JGI25405J52794_10064131
525 Ga0068869_100223361
526 Ga0070666_10098653
527 Ga0070682_100019613
528 Ga0070689_100401523
529 Ga0070668_100041738
530 Ga0070673_100188792
531 Ga0070709_10027788
532 Ga0070713_100183931
533 Ga0070713_101004737
534 Ga0070710_10010097
535 Ga0070711_100060634
536 Ga0070705_100382209
537 Ga0070663_100056398
538 Ga0070678_100164224
539 Ga0070681_10446063
540 Ga0070679_100114884
541 Ga0070679_100718480
542 Ga0068853_100044618
543 Ga0070696_100076414
544 Ga0070693_100407158
545 Ga0070665_100050911
546 Ga0070665_100131616
547 Ga0070665_100264522
548 Ga0070665_100293924
549 Ga0070665_100490179
550 Ga0070704_100040403
551 Ga0068855_100001729
552 Ga0068857_100306756
553 Ga0068857_100433117
554 Ga0068854_100013763
555 Ga0068854_100758728
556 Ga0068856_100004071
557 Ga0068856_100007390
558 Ga0068852_100011462
559 Ga0068852_100738132
560 Ga0068859_100215022
561 Ga0068859_101622904
562 Ga0068864_100086715
563 Ga0068866_10385110
564 Ga0068851_10473536
565 Ga0068863_100021550
566 Ga0068863_101614448
567 Ga0068858_100019039
568 Ga0068858_100136716
569 Ga0068860_100032666
570 Ga0068862_100062517
571 Ga0068862_101412993
572 Ga0081455_10000660
573 Ga0081455_10001889
574 Ga0081455_10006930
575 Ga0081455_10007468
576 Ga0081455_10079490
577 Ga0081455_10139616
578 Ga0081455_10232658
579 Ga0081455_10281354
580 Ga0081538_10001112
581 Ga0081540_1018698
582 Ga0081539_10000242
583 Ga0081539_10000253
584 Ga0081539_10000364
585 Ga0081539_10002412
586 Ga0081539_10133033
587 Ga0081539_10166003
588 Ga0070717_10310158
589 Ga0070717_10403958
590 Ga0075364_10727521
591 Ga0075432_10000011
592 Ga0075432_10000400
593 Ga0070712_100070872
594 Ga0068871_100132818
595 Ga0075428_100002261
596 Ga0075428_100009022
597 Ga0075428_100025264
598 Ga0075428_100138053
599 Ga0075430_100004478
600 Ga0075430_100020675
601 Ga0075430_100162043
602 Ga0075431_100012896
603 Ga0075431_100028355
604 Ga0075431_100053876
605 Ga0075431_100706962
606 Ga0075433_10000526
607 Ga0075433_10013663
608 Ga0075434_100000622
609 Ga0075434_100001913
610 Ga0075429_100019971
611 Ga0075429_100036584
612 Ga0075429_100089386
613 Ga0075429_100226451
614 Ga0097620_100215026
615 Ga0097620_100850006
616 Ga0097620_101623250
617 Ga0075435_100000387
618 Ga0075435_100065371
619 Ga0105240_10010196
620 Ga0105240_10030467
621 Ga0111539_10000029
622 Ga0111539_10003884
623 Ga0105245_10244150
624 Ga0105245_11046398
625 Ga0105247_10330832
626 Ga0114129_10005281
627 Ga0114129_10007314
628 Ga0114129_10009563
629 Ga0114129_10009978
630 Ga0114129_10015183
631 Ga0114129_10241436
632 Ga0114129_11188070
633 Ga0105243_10221312
634 Ga0105241_10005121
635 Ga0105241_10174782
636 Ga0105241_12101201
637 Ga0105242_11203651
638 Ga0105248_10216030
639 Ga0105248_10330705
640 Ga0105237_10037249
641 Ga0105237_10286731
642 Ga0105237_10847383
643 Ga0105238_10037219
644 Ga0105249_11545143
645 Ga0105033_100569
646 Ga0105239_10027638
647 Ga0105239_10058710
648 Ga0105239_10093535
649 Ga0105246_10243356
650 Ga0105246_10859942
651 Ga0157373_10129985
652 Ga0157371_10636038
653 Ga0157374_10222828
654 Ga0157374_10463591
655 Ga0163162_10073392
656 Ga0163162_10427620
657 Ga0163162_11151830
658 Ga0157372_10016676
659 Ga0157372_10100337
660 Ga0157375_10595837
661 Ga0157375_11466240
662 Ga0157515_110198
663 Ga0163163_10032282
664 Ga0163163_10373161
665 Ga0163163_10644315
666 Ga0157377_10421078
667 Ga0157379_10015989
668 Ga0157379_10070527
669 Ga0163161_10044862
670 Ga0206353_10609391
671 Ga0207692_10456501
672 Ga0207642_10060734
673 Ga0207710_10266324
674 Ga0207680_10563000
675 Ga0207647_10003497
676 Ga0207647_10135906
677 Ga0207699_10608348
678 Ga0207654_10088922
679 Ga0207654_10856510
680 Ga0207695_10012660
681 Ga0207695_10023232
682 Ga0207671_10002039
683 Ga0207693_10024949
684 Ga0207681_10455275
685 Ga0207694_10005592
686 Ga0207694_10311950
687 Ga0207687_10130571
688 Ga0207700_10196060
689 Ga0207664_10010837
690 Ga0207664_10372636
691 Ga0207644_10876831
692 Ga0207690_10057224
693 Ga0207690_11135318
694 Ga0207711_10066401
695 Ga0207711_10235722
696 Ga0207689_10098958
697 Ga0207661_10405945
698 Ga0207667_10017915
699 Ga0207667_11325983
700 Ga0207651_10081574
701 Ga0207712_10100886
702 Ga0207668_10032926
703 Ga0207668_10334147
704 Ga0207640_10037303
705 Ga0207640_10080462
706 Ga0207658_10049401
707 Ga0207658_10193010
708 Ga0207703_10031078
709 Ga0207703_10255989
710 Ga0207639_10035859
711 Ga0207678_10019442
712 Ga0207708_10117251
713 Ga0207702_10007850
714 Ga0207702_10160914
715 Ga0207641_10004769
716 Ga0207641_10809636
717 Ga0207648_10177257
718 Ga0207676_10045054
719 Ga0207676_10739327
720 Ga0207674_10118837
721 Ga0207674_10236586
722 Ga0207675_100044422
723 Ga0207675_100070220
724 Ga0207683_10013434
725 Ga0207683_10739113
726 Ga0207683_10972670
727 Ga0207698_10023022
728 Ga0207428_10000496
729 Ga0207428_10000730
730 Ga0268266_10042879
731 Ga0268266_10052085
732 Ga0268265_10211788
733 Ga0268265_10271957
734 Ga0268264_10048010
735 Ga0268264_10140645
736 Ga0307515_10000356
737 Ga0307515_10008871
738 Ga0307515_10016392
739 Ga0307515_10069077
740 Ga0307515_10147850
741 Ga0307515_10482401
742 Ga0265338_10040643
743 Ga0307512_10005363
744 Ga0307512_10027409
745 Ga0307512_10069096
746 Ga0265325_10034130
747 Ga0265340_10002843
748 Ga0265339_10198478
749 Ga0265316_10135006
750 Ga0265316_10399441
751 Ga0307513_10014170
752 Ga0307513_10149991
753 Ga0307513_10435836
754 Ga0307509_10018964
755 Ga0265313_10027459
756 Ga0307508_10005569
757 Ga0307508_10087730
758 Ga0307508_10355962
759 Ga0265342_10044728
760 Ga0316576_10003849
761 Ga0316576_10071769
762 Ga0316578_10050161
763 Ga0307516_10005090
764 Ga0307405_10083952
765 Ga0307405_10085517
766 Ga0307413_10002405
767 Ga0307413_10154978
768 Ga0307413_10446209
769 Ga0307413_10659650
770 Ga0307518_10000154
771 Ga0307518_10107471
772 Ga0307410_10000966
773 Ga0326468_10000343
774 Ga0307406_10001364
775 Ga0307406_10010615
776 Ga0307406_10046373
777 Ga0307406_10095172
778 Ga0307406_10338365
779 Ga0307406_10349352
780 Ga0307407_10012038
781 Ga0307412_10011465
782 Ga0307409_100010755
783 Ga0307409_100491252
784 Ga0307409_100840191
785 Ga0307416_100000447
786 Ga0307416_100096119
787 Ga0307416_100353106
788 Ga0307416_100446318
789 Ga0307416_100559488
790 Ga0307416_100814468
791 Ga0307416_101263167
792 Ga0307411_10043712
793 Ga0307411_10357835
794 Ga0307411_10451390
795 Ga0307411_11310047
796 Ga0307415_100002163
797 Ga0307415_100002390
798 Ga0307415_100023262
799 Ga0307415_100025798
800 Ga0307415_100064531
801 Ga0307415_100135979
802 Ga0307415_100304823
803 Ga0307415_100535112
804 Ga0307415_100634938
805 Ga0316580_10011899
806 Ga0307507_10022105
807 Ga0307507_10092603
808 Ga0307507_10185340
809 Ga0307507_10526072
810 Ga0307510_10055517
811 Ga0373950_0069021
812 Ga0373929_0074297
813 Ga0373940_0005428
814 Ga0373932_0012771
815 Ga0373941_0163629
816 Ga0373941_0321277
817 Ga0373960_0087686
818 Ga0373942_0000062
819 Ga0373962_0000873
820 Ga0316574_0009196
821 Ga0316574_0306626
822 Ga0316574_0654517
823 Ga0373935_0215338
824 Ga0316582_0224525
825 Ga0395899_0408429
826 Ga0395900_0016536
827 Ga0395898_0015470
828 Ga0395905_0029084
829 Ga0395901_0054149
830 Ga0451797_1570362
831 Ga0451804_1006147
832 Ga0451807_2433022
833 Ga0439442_031972
834 Ga0439448_0067983
835 Ga0439449_0079885
836 Ga0439450_192413
837 Ga0439455_0108216
838 Ga0439455_0261762
839 Ga0439463_004924
840 Ga0450902_094670
841 Ga0450903_044199
842 Ga0439464_0012155
843 Ga0439440_0005654
844 Ga0466966_0257955
845 Ga0466966_0392746
846 Ga0466963_0968558
847 Ga0466964_0218095
848 Ga0466964_0523715
849 Ga0466970_0399181
850 Ga0466957_0026027
851 Ga0466959_0042345
852 Ga0466958_0022988
853 Ga0466967_0164237
854 Ga0466967_0268443
855 Ga0466967_0386940
856 Ga0466967_0525758
857 Ga0495627_113471
858 Ga0495592_0004242
859 Ga0495592_0867100
860 Ga0495603_0701614
861 Ga0495651_0087588
862 Ga0495580_0004371
863 Ga0495580_0679541
864 Ga0495582_0289051
865 Ga0495662_0108401
866 Ga0495664_0446947
867 Ga0495585_0041683
868 Ga0495594_0188913
869 Ga0495606_0004849
870 Ga0495618_0674737
871 Ga0495637_0164111
872 Ga0495644_0044815
873 Ga0495652_0001486
874 Ga0495652_0679499
875 Ga0495640_0118062
876 Ga0495586_0019182
877 Ga0495587_0210735
878 Ga0495645_0149343
879 Ga0495667_0011657
880 Ga0495656_0253847
881 Ga0495668_0000644
882 Ga0495634_0135421
883 Ga0495625_0001056
884 Ga0495635_0063647
885 Ga0495657_0662377
886 Ga0495599_0006915
887 Ga0495623_0488618
888 Ga0495600_0303183
889 Ga0495604_0069024
890 Ga0495674_0086509
891 Ga0495675_0478540
892 Ga0495684_0117192
893 Ga0495626_0000563
894 Ga0496100_0102686
895 Ga0496101_0031765
896 Ga0496102_0130208
897 Ga0496102_0902782
898 Ga0496103_0038166
899 Ga0496104_0087979
900 Ga0496104_0168931
901 Ga0496104_0396543
902 Ga0496104_0445602
903 Ga0496105_0008699
904 Ga0496105_0091833
905 Ga0496105_0358572
906 Ga0496105_1120602
907 Ga0496106_0831474
908 Ga0496107_0302029
909 Ga0496108_0000130
910 Ga0496108_0012414
911 Ga0496109_0009874
912 Ga0496110_0048013
913 Ga0496111_0030704
914 Ga0496112_0037641
915 Ga0496112_0056367
916 Ga0496112_0116645
917 Ga0496113_0328437
918 Ga0496113_0723081
919 Ga0496114_0000468
920 Ga0496114_0015473
921 Ga0496114_0121418
922 Ga0496115_0192171
923 Ga0501034_0013335
924 Ga0501034_0475433
925 Ga0501034_0686625
926 Ga0501036_0002330
927 Ga0501037_0019249
928 Ga0501038_0015106
929 Ga0501038_0237711
930 Ga0501039_0057421
931 Ga0501042_0016451
932 Ga0501043_0006145
933 Ga0501046_0128099
934 Ga0501046_0197952
935 Ga0501047_0002369
936 Ga0501047_0357006
937 Ga0501048_0029510
938 Ga0501067_0506540
939 Ga0501068_0300353
940 Ga0501069_0042701
941 Ga0501070_0003335
942 Ga0501073_0252132
943 Ga0501074_0024508
944 Ga0501075_1384001
945 Ga0501077_0412523
946 Ga0501081_0359956
947 Ga0501081_0702653
948 Ga0501044_0053055
949 Ga0501044_0404055
950 Ga0501045_0206647
951 nmdc:mga00v17_624031_c1
952 nmdc:mga05p37_240_c1
953 nmdc:mga05p37_64901_c1
954 nmdc:mga05p37_7034_c1
955 nmdc:mga05p37_742_c1
956 nmdc:mga05p37_851837_c1
957 nmdc:mga09592_1167415_c1
958 nmdc:mga09592_14_c1
959 nmdc:mga09592_18883_c1
960 nmdc:mga09592_20716_c1
961 nmdc:mga09592_29495_c1
962 nmdc:mga09592_34875_c1
963 nmdc:mga09592_852427_c1
964 nmdc:mga0qj67_11349_c1
965 nmdc:mga0qj67_13598_c1
966 nmdc:mga0qj67_283705_c1
967 nmdc:mga0qj67_54_c4
968 nmdc:mga06r32_18_c3
969 nmdc:mga06r32_22802_c1
970 nmdc:mga06r32_267215_c1
971 nmdc:mga06r32_435593_c1
972 nmdc:mga06r32_636514_c1
973 nmdc:mga06r32_71466_c1
974 nmdc:mga08y16_18035_c1
975 nmdc:mga0n895_1015_c1
976 nmdc:mga0n895_153222_c1
977 nmdc:mga0n895_9303_c1
978 nmdc:mga0rr50_12159_c1
979 nmdc:mga0rr50_805_c1
980 nmdc:mga08x19_78192_c1
981 nmdc:mga0a205_20537_c1
982 nmdc:mga0a205_474_c1
983 Ga0495601_0036668
984 Ga0495595_0528024
985 Ga0500644_0029483
986 Ga0500646_0000443
987 Ga0500583_0002429
988 Ga0500566_0430973
989 Ga0500641_0016646
990 Ga0500569_002462
991 Ga0500594_0191036
992 Ga0500621_146045
993 Ga0500577_0115136
994 Ga0500588_0002191
995 Ga0500600_0145833
996 Ga0590075_004624
997 Ga0501082_0988233
998 Ga0466962_0037968
999 Ga0466962_0381497
1000 Ga0530510_0046628
1001 2515719116
1002 2586062758
1003 2623590836
1004 2753268330
1005 2791912638
1006 2795784331
1007 2809588059
1008 2832010531
1009 2855676416
1010 2855678662
1011 2857289307
1012 2858855181
1013 2858888746
1014 2858889020
1015 2858897407
1016 2866066249
1017 2866615118
1018 2867303519
1019 2867316125
1020 2867320991
1021 2867511758
1022 2869051858
1023 2869067381
1024 2869075219
1025 2880489668
1026 2880496035
1027 2887481115
1028 2891331915
1029 2899363931
1030 2915773580
1031 2929224712
1032 2929232349
1033 2966927288
1034 2974306921
1035 2996227553
1036 8001789953
1037 8003862170
1038 8054707757
1039 8054732799
1040 8054739012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

60

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rij-assembly3.cif.gz_C epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9082 1 160
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9074 6 160
3ri0-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9021 7 160
3rij-assembly3.cif.gz_C epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8969 1 160
3ri0-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8949 7 160
ID Description Score Start End Superfamily
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9082 1 160 3.90.960.10
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8969 1 160 3.90.960.10
af_Q4D973_68_232_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8928 8 158 3.90.960.10
af_Q4DLP0_103_258_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8841 36 158 3.90.960.10
1dbxB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8635 28 158 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A6J6F315-F1-model_v4 Unannotated protein 0.9889 61 160 GO:0002161
AF-A0A2T0SKS8-F1-model_v4 Prolyl-tRNA editing enzyme YbaK/EbsC (Cys-tRNA(Pro) deacylase) 0.9793 10 160 GO:0002161
AF-A0A542DG43-F1-model_v4 Prolyl-tRNA editing enzyme YbaK/EbsC (Cys-tRNA(Pro) deacylase) 0.978 4 160 GO:0002161
AF-K0JXM4-F1-model_v4 YbaK/prolyl-tRNA synthetase associated region 0.9764 4 160 GO:0002161
GO:0004812
AF-H5XEL9-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9758 4 160 GO:0002161

Map