F458453

General Info

Members Datasets Scaffolds Average Seq Length
519 230 1038 304

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0010737|Ga0495621_0010737_607_1641
Length 336
Sequence MHKIKKVAIIGLGLIGSSIAHAVRRGNLAAQIAGSDSSADVLARARVLDFCDSLHADAAAAAQDADVVILCTPVGAYKTIAAEIAPHLKPGAILSDVGSVKSAVIRDVGPVVPKGVHFVPAHPIAGTEFSGPEAGFASLFDGRWTILTPVRGSDPGAVERLRDFWQSLGSQVDVMNAGHHDLVLAITSHLPHLIAYNIVGTAHDLEKVTQGEVIKYSASGFRDFTRIAASDPTMWRDVFLNNRDAVLEVLGRFNEDLSQLQRAVRNGDGKTLFEWFTRTRAIRRAIVNTGQDVPSFGRLPFQVYIPPEKTRKTGAKKKAKVVPRKAAGKTRKRGAR

Samples

Sample ID Description Type Environment
1 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
144 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
213 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
223 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
224 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
225 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
226 2842694124 Methylopila sp. R-72369 Isolate Unclassified
227 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
228 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
229 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
230 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.47
Nodule 0.19
Rhizoplane 2.5
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495621_0010737 3300046539 Bacteria 2813
2 JGI25153J46596_10000362 3300003215 Bacteria 31305
3 Ga0055524_1013305 3300003775 Bacteria 3107
4 Ga0070658_10013678 3300005327 Bacteria 6510
5 Ga0070658_10034448 3300005327 Bacteria 4073
6 Ga0070658_10146852 3300005327 Bacteria 1972
7 Ga0070658_10363612 3300005327 Bacteria 1240
8 Ga0070676_10014966 3300005328 Bacteria 4271
9 Ga0070683_100115334 3300005329 Bacteria 2536
10 Ga0068869_100042207 3300005334 Bacteria 3269
11 Ga0070666_10003899 3300005335 Bacteria 9060
12 Ga0070666_10039230 3300005335 Bacteria 3155
13 Ga0070666_10168383 3300005335 Bacteria 1534
14 Ga0070680_100027855 3300005336 Bacteria 4528
15 Ga0070680_100179525 3300005336 Bacteria 1783
16 Ga0068868_100052446 3300005338 Bacteria 3211
17 Ga0068868_100169482 3300005338 Bacteria 1807
18 Ga0070660_100151027 3300005339 Bacteria 1867
19 Ga0070660_100236474 3300005339 Bacteria 1487
20 Ga0070661_100042858 3300005344 Bacteria 3305
21 Ga0070661_100196863 3300005344 Bacteria 1538
22 Ga0070668_100214959 3300005347 Bacteria 1583
23 Ga0070669_100113432 3300005353 Bacteria 2059
24 Ga0070673_100040706 3300005364 Bacteria 3567
25 Ga0070659_100202847 3300005366 Bacteria 1633
26 Ga0070667_100020369 3300005367 Bacteria 5506
27 Ga0070667_100147268 3300005367 Bacteria 2066
28 Ga0070709_10279395 3300005434 Bacteria 1213
29 Ga0070710_10044293 3300005437 Bacteria 2469
30 Ga0070678_100122378 3300005456 Bacteria 2054
31 Ga0070681_10000057 3300005458 Bacteria 79475
32 Ga0070681_10196730 3300005458 Bacteria 1935
33 Ga0068867_100026549 3300005459 Bacteria 4159
34 Ga0068867_100083210 3300005459 Bacteria 2416
35 Ga0070679_100000043 3300005530 Bacteria 95125
36 Ga0070679_100004129 3300005530 Bacteria 13386
37 Ga0070679_100044057 3300005530 Bacteria 4445
38 Ga0070679_100108720 3300005530 Bacteria 2759
39 Ga0070679_100284453 3300005530 Bacteria 1606
40 Ga0070684_100089072 3300005535 Bacteria 2743
41 Ga0070684_100171200 3300005535 Bacteria 1972
42 Ga0068853_100044309 3300005539 Bacteria 3809
43 Ga0068853_100048979 3300005539 Bacteria 3630
44 Ga0070665_100005669 3300005548 Bacteria 12833
45 Ga0070665_100025155 3300005548 Bacteria 5999
46 Ga0070665_100067481 3300005548 Bacteria 3586
47 Ga0070665_100128606 3300005548 Bacteria 2535
48 Ga0068855_100000267 3300005563 Bacteria 64909
49 Ga0068855_100000468 3300005563 Bacteria 49550
50 Ga0068855_100029992 3300005563 Bacteria 6505
51 Ga0068855_100467716 3300005563 Bacteria 1374
52 Ga0070664_100443502 3300005564 Bacteria 1191
53 Ga0068857_100049498 3300005577 Bacteria 3728
54 Ga0068856_100034568 3300005614 Bacteria 4950
55 Ga0068856_100056553 3300005614 Bacteria 3871
56 Ga0068856_100190698 3300005614 Bacteria 2063
57 Ga0068852_100014984 3300005616 Bacteria 5991
58 Ga0068852_100088567 3300005616 Bacteria 2765
59 Ga0068852_100138253 3300005616 Bacteria 2251
60 Ga0068859_100606413 3300005617 Bacteria 1188
61 Ga0068864_100096868 3300005618 Bacteria 2611
62 Ga0068861_100516080 3300005719 Bacteria 1083
63 Ga0068851_10085545 3300005834 Bacteria 1653
64 Ga0068863_100030940 3300005841 Bacteria 5112
65 Ga0068858_100214118 3300005842 Bacteria 1824
66 Ga0068860_100022607 3300005843 Bacteria 6080
67 Ga0068860_100147340 3300005843 Bacteria 2265
68 Ga0068860_100243343 3300005843 Bacteria 1750
69 Ga0068862_100013003 3300005844 Bacteria 6883
70 Ga0068862_100026950 3300005844 Bacteria 4834
71 Ga0081455_10001962 3300005937 Bacteria 24683
72 Ga0081455_10005926 3300005937 Bacteria 13263
73 Ga0081539_10049463 3300005985 Bacteria 2385
74 Ga0075366_10002613 3300006195 Bacteria 9264
75 Ga0097621_100000784 3300006237 Bacteria 22308
76 Ga0097621_100019181 3300006237 Bacteria 5244
77 Ga0068871_100002170 3300006358 Bacteria 13320
78 Ga0068871_100004990 3300006358 Bacteria 9273
79 Ga0068871_100012698 3300006358 Bacteria 6224
80 Ga0068871_100049371 3300006358 Bacteria 3401
81 Ga0075431_100015092 3300006847 Bacteria 7822
82 Ga0068865_100074325 3300006881 Bacteria 2420
83 Ga0068865_100190495 3300006881 Bacteria 1586
84 Ga0097620_100606363 3300006931 Bacteria 1188
85 Ga0105240_10001197 3300009093 Bacteria 45241
86 Ga0105240_10046921 3300009093 Bacteria 5470
87 Ga0105240_10078082 3300009093 Bacteria 4077
88 Ga0105240_10157438 3300009093 Bacteria 2701
89 Ga0105240_10254899 3300009093 Bacteria 2027
90 Ga0105245_10042716 3300009098 Bacteria 4044
91 Ga0105245_10042995 3300009098 Bacteria 4031
92 Ga0105245_10406922 3300009098 Bacteria 1361
93 Ga0105247_10009165 3300009101 Bacteria 6024
94 Ga0114129_10006555 3300009147 Bacteria 16519
95 Ga0105243_10010237 3300009148 Bacteria 7126
96 Ga0105241_10006183 3300009174 Bacteria 8832
97 Ga0105241_10031988 3300009174 Bacteria 3940
98 Ga0105241_10306233 3300009174 Bacteria 1365
99 Ga0105241_10431669 3300009174 Bacteria 1162
100 Ga0105242_10006142 3300009176 Bacteria 9260
101 Ga0105242_10013358 3300009176 Bacteria 6343
102 Ga0105242_10148027 3300009176 Bacteria 2045
103 Ga0105248_10093888 3300009177 Bacteria 3379
104 Ga0105237_10068786 3300009545 Bacteria 3535
105 Ga0105237_10130125 3300009545 Bacteria 2511
106 Ga0105237_10253577 3300009545 Bacteria 1762
107 Ga0105238_10050188 3300009551 Bacteria 4200
108 Ga0105238_10107579 3300009551 Bacteria 2770
109 Ga0105238_10109050 3300009551 Bacteria 2750
110 Ga0105238_10149972 3300009551 Bacteria 2307
111 Ga0105238_10231607 3300009551 Bacteria 1824
112 Ga0105238_10346684 3300009551 Bacteria 1474
113 Ga0105249_10457030 3300009553 Bacteria 1316
114 Ga0105239_10019462 3300010375 Bacteria 7494
115 Ga0105239_10024995 3300010375 Bacteria 6579
116 Ga0105239_10035573 3300010375 Bacteria 5469
117 Ga0105239_10162260 3300010375 Bacteria 2498
118 Ga0105239_10177954 3300010375 Bacteria 2379
119 Ga0105246_10004462 3300011119 Bacteria 8516
120 Ga0157371_10196245 3300013102 Bacteria 1446
121 Ga0157370_10023718 3300013104 Bacteria 6088
122 Ga0157370_10082603 3300013104 Bacteria 3022
123 Ga0157370_10363438 3300013104 Bacteria 1334
124 Ga0157369_10068688 3300013105 Bacteria 3807
125 Ga0157369_10170509 3300013105 Bacteria 2293
126 Ga0157374_10134377 3300013296 Bacteria 2397
127 Ga0157378_10007188 3300013297 Bacteria 9725
128 Ga0157378_10110943 3300013297 Bacteria 2515
129 Ga0157378_10120597 3300013297 Bacteria 2417
130 Ga0157378_10130418 3300013297 Bacteria 2326
131 Ga0163162_10009230 3300013306 Bacteria 9595
132 Ga0157372_10104200 3300013307 Bacteria 3242
133 Ga0157372_10279094 3300013307 Bacteria 1942
134 Ga0157375_10004694 3300013308 Bacteria 11890
135 Ga0163163_10000004 3300014325 Bacteria 416569
136 Ga0163163_10015448 3300014325 Bacteria 7059
137 Ga0157379_10007697 3300014968 Bacteria 9329
138 Ga0157379_10016709 3300014968 Bacteria 6456
139 Ga0163161_10042679 3300017792 Bacteria 3263
140 Ga0213872_10016057 3300021361 Bacteria 3477
141 Ga0213872_10051147 3300021361 Bacteria 1875
142 Ga0213874_10000653 3300021377 Bacteria 7020
143 Ga0213871_10001018 3300021441 Bacteria 4403
144 Ga0209025_1013224 3300025294 Bacteria 5208
145 Ga0209758_1000008 3300025297 Bacteria 1215263
146 Ga0209256_1001212 3300025299 Bacteria 28781
147 Ga0207692_10137817 3300025898 Bacteria 1385
148 Ga0207642_10022401 3300025899 Bacteria 2505
149 Ga0207680_10033691 3300025903 Bacteria 2924
150 Ga0207680_10194731 3300025903 Bacteria 1378
151 Ga0207645_10046667 3300025907 Bacteria 2767
152 Ga0207645_10249052 3300025907 Bacteria 1175
153 Ga0207705_10112319 3300025909 Bacteria 2014
154 Ga0207705_10148310 3300025909 Bacteria 1756
155 Ga0207654_10348693 3300025911 Bacteria 1019
156 Ga0207707_10000001 3300025912 Bacteria 1212482
157 Ga0207707_10079452 3300025912 Bacteria 2864
158 Ga0207695_10000012 3300025913 Bacteria 840961
159 Ga0207695_10017143 3300025913 Bacteria 8443
160 Ga0207695_10034545 3300025913 Bacteria 5496
161 Ga0207695_10136414 3300025913 Bacteria 2406
162 Ga0207693_10088724 3300025915 Bacteria 2423
163 Ga0207660_10023997 3300025917 Bacteria 4125
164 Ga0207660_10130847 3300025917 Bacteria 1910
165 Ga0207657_10068662 3300025919 Bacteria 3010
166 Ga0207652_10000147 3300025921 Bacteria 76127
167 Ga0207652_10000489 3300025921 Bacteria 40293
168 Ga0207652_10025951 3300025921 Bacteria 4875
169 Ga0207652_10144893 3300025921 Bacteria 2125
170 Ga0207694_10000156 3300025924 Bacteria 70186
171 Ga0207694_10079180 3300025924 Bacteria 2577
172 Ga0207687_10076856 3300025927 Bacteria 2399
173 Ga0207687_10106711 3300025927 Bacteria 2071
174 Ga0207690_10132958 3300025932 Bacteria 1823
175 Ga0207706_10023986 3300025933 Bacteria 5473
176 Ga0207686_10007097 3300025934 Bacteria 6028
177 Ga0207686_10014546 3300025934 Bacteria 4384
178 Ga0207686_10014599 3300025934 Bacteria 4377
179 Ga0207686_10040108 3300025934 Bacteria 2845
180 Ga0207709_10009199 3300025935 Bacteria 5441
181 Ga0207709_10189287 3300025935 Bacteria 1460
182 Ga0207670_10054655 3300025936 Bacteria 2695
183 Ga0207704_10009175 3300025938 Bacteria 4762
184 Ga0207704_10105723 3300025938 Bacteria 1889
185 Ga0207704_10161422 3300025938 Bacteria 1595
186 Ga0207711_10021122 3300025941 Bacteria 5438
187 Ga0207711_10203741 3300025941 Bacteria 1806
188 Ga0207661_10127084 3300025944 Bacteria 2178
189 Ga0207661_10419588 3300025944 Bacteria 1215
190 Ga0207667_10000068 3300025949 Bacteria 180716
191 Ga0207667_10002816 3300025949 Bacteria 21561
192 Ga0207667_10044044 3300025949 Bacteria 4732
193 Ga0207667_10068579 3300025949 Bacteria 3693
194 Ga0207651_10063567 3300025960 Bacteria 2578
195 Ga0207651_10248114 3300025960 Bacteria 1455
196 Ga0207658_10004979 3300025986 Bacteria 9158
197 Ga0207658_10027881 3300025986 Bacteria 3973
198 Ga0207677_10158623 3300026023 Bacteria 1755
199 Ga0207703_10236830 3300026035 Bacteria 1639
200 Ga0207639_10031279 3300026041 Bacteria 3911
201 Ga0207639_10042693 3300026041 Bacteria 3400
202 Ga0207639_10051660 3300026041 Bacteria 3128
203 Ga0207702_10128107 3300026078 Bacteria 2281
204 Ga0207702_10351780 3300026078 Bacteria 1410
205 Ga0207641_10019847 3300026088 Bacteria 5516
206 Ga0207648_10005128 3300026089 Bacteria 13268
207 Ga0207648_10365662 3300026089 Bacteria 1302
208 Ga0207674_10043946 3300026116 Bacteria 4605
209 Ga0207674_10152427 3300026116 Bacteria 2268
210 Ga0207683_10046495 3300026121 Bacteria 3798
211 Ga0207683_10260981 3300026121 Bacteria 1582
212 Ga0207698_10006097 3300026142 Bacteria 7500
213 Ga0207698_10039651 3300026142 Bacteria 3491
214 Ga0207698_10069853 3300026142 Bacteria 2780
215 Ga0207698_10135519 3300026142 Bacteria 2112
216 Ga0268266_10000364 3300028379 Bacteria 70331
217 Ga0268266_10041960 3300028379 Bacteria 3906
218 Ga0268266_10058094 3300028379 Bacteria 3330
219 Ga0268266_10283449 3300028379 Bacteria 1541
220 Ga0268266_10395634 3300028379 Bacteria 1306
221 Ga0268265_10024823 3300028380 Bacteria 4247
222 Ga0268265_10101338 3300028380 Bacteria 2326
223 Ga0268264_10017819 3300028381 Bacteria 5813
224 Ga0268264_10139820 3300028381 Bacteria 2158
225 Ga0268264_10200911 3300028381 Bacteria 1824
226 Ga0265338_10052288 3300028800 Bacteria 3667
227 Ga0265330_10012510 3300031235 Bacteria 3969
228 Ga0265330_10036736 3300031235 Bacteria 2182
229 Ga0265330_10097136 3300031235 Bacteria 1262
230 Ga0265328_10000668 3300031239 Bacteria 15940
231 Ga0265325_10000965 3300031241 Bacteria 20696
232 Ga0265329_10012011 3300031242 Bacteria 3129
233 Ga0265340_10000409 3300031247 Bacteria 22988
234 Ga0265340_10035448 3300031247 Bacteria 2477
235 Ga0265339_10000928 3300031249 Bacteria 22506
236 Ga0265339_10010103 3300031249 Bacteria 5882
237 Ga0265331_10000049 3300031250 Bacteria 182618
238 Ga0265331_10001693 3300031250 Bacteria 15906
239 Ga0265327_10025328 3300031251 Bacteria 3463
240 Ga0265327_10030141 3300031251 Bacteria 3072
241 Ga0265316_10003027 3300031344 Bacteria 17173
242 Ga0265316_10004443 3300031344 Bacteria 13964
243 Ga0265316_10049496 3300031344 Bacteria 3310
244 Ga0265316_10080194 3300031344 Bacteria 2503
245 Ga0265316_10123742 3300031344 Bacteria 1952
246 Ga0307513_10002302 3300031456 Bacteria 26655
247 Ga0307513_10170682 3300031456 Bacteria 2053
248 Ga0307408_100260289 3300031548 Bacteria 1435
249 Ga0265313_10003154 3300031595 Bacteria 13607
250 Ga0265313_10037914 3300031595 Bacteria 2405
251 Ga0265313_10052694 3300031595 Bacteria 1940
252 Ga0265313_10054309 3300031595 Bacteria 1903
253 Ga0265314_10022477 3300031711 Bacteria 4830
254 Ga0265314_10035073 3300031711 Bacteria 3659
255 Ga0265314_10094638 3300031711 Bacteria 1936
256 Ga0265342_10045543 3300031712 Bacteria 2640
257 Ga0265342_10108859 3300031712 Bacteria 1570
258 Ga0307516_10022592 3300031730 Bacteria 6456
259 Ga0307516_10049718 3300031730 Bacteria 4118
260 Ga0307510_10150662 3300033180 Bacteria 1946
261 Ga0373940_0003398 3300035088 Bacteria 3247
262 Ga0373955_0109387 3300035172 Bacteria 1597
263 Ga0373937_0068204 3300036401 Bacteria 3279
264 Ga0316582_0077629 3300036647 Bacteria 2162
265 Ga0316582_0085420 3300036647 Bacteria 2068
266 Ga0316584_0006027 3300036712 Bacteria 8191
267 Ga0395899_0014590 3300037312 Bacteria 5996
268 Ga0395900_0005379 3300037418 Bacteria 13415
269 Ga0395900_0015442 3300037418 Bacteria 7785
270 Ga0395900_0081826 3300037418 Bacteria 3317
271 Ga0395900_0298513 3300037418 Bacteria 1598
272 Ga0395898_0004253 3300037466 Bacteria 15703
273 Ga0395898_0036173 3300037466 Bacteria 4904
274 Ga0395898_0157225 3300037466 Bacteria 2174
275 Ga0395905_0067009 3300037471 Bacteria 3362
276 Ga0395905_0267443 3300037471 Bacteria 1595
277 Ga0436364_0468604 3300037853 Bacteria 10537
278 Ga0436364_1254677 3300037853 Bacteria 1916
279 Ga0436364_1524223 3300037853 Bacteria 4537
280 Ga0395901_0007428 3300038443 Bacteria 11059
281 Ga0395901_0010960 3300038443 Bacteria 9183
282 Ga0395901_0112724 3300038443 Bacteria 2856
283 Ga0400486_31283 3300038742 Bacteria 2937
284 Ga0400483_095621 3300039062 Bacteria 1682
285 Ga0400483_231048 3300039062 Bacteria 1637
286 Ga0436365_1934144 3300039437 Bacteria 1664
287 Ga0436360_0617322 3300039438 Bacteria 21164
288 Ga0436360_1055181 3300039438 Bacteria 1873
289 Ga0436361_0761887 3300039447 Bacteria 2580
290 Ga0436361_0858330 3300039447 Bacteria 2194
291 Ga0436361_1113559 3300039447 Bacteria 6973
292 Ga0436361_1139693 3300039447 Bacteria 2381
293 Ga0436363_1498986 3300039450 Bacteria 16727
294 Ga0451795_1698426 3300041456 Bacteria 1756
295 Ga0439445_0013882 3300042004 Bacteria 1955
296 Ga0439434_0050964 3300042435 Bacteria 1283
297 Ga0451577_0021289 3300042876 Bacteria 5936
298 Ga0466966_0056624 3300044684 Bacteria 2480
299 Ga0453684_0000015 3300044712 Bacteria 969198
300 Ga0453684_0000020 3300044712 Bacteria 879938
301 Ga0453684_0038206 3300044712 Bacteria 6568
302 Ga0466957_0055945 3300044842 Bacteria 2411
303 Ga0451576_0463328 3300045051 Bacteria 1331
304 Ga0466967_0026787 3300045976 Bacteria 4783
305 Ga0495603_0017475 3300046455 Bacteria 4339
306 Ga0495587_0037729 3300046536 Bacteria 2900
307 Ga0495636_0041633 3300047318 Bacteria 1907
308 Ga0495686_0000096 3300047472 Bacteria 184611
309 Ga0496101_0314067 3300048904 Bacteria 1229
310 Ga0496102_0126141 3300048905 Bacteria 2393
311 Ga0496102_0269722 3300048905 Bacteria 1605
312 Ga0496104_0013315 3300048907 Bacteria 7411
313 Ga0496105_0002278 3300048908 Bacteria 13922
314 Ga0496108_0000479 3300048911 Bacteria 32030
315 Ga0496109_0003408 3300048912 Bacteria 13299
316 Ga0496110_0232043 3300048913 Bacteria 1678
317 Ga0496111_0003436 3300048914 Bacteria 9795
318 Ga0496112_0159831 3300048915 Bacteria 2219
319 Ga0496115_0009683 3300048918 Bacteria 7171
320 Ga0496118_0019657 3300048921 Bacteria 6028
321 Ga0496119_0012340 3300048922 Bacteria 6947
322 Ga0496126_0201765 3300048929 Bacteria 1679
323 Ga0496126_0220282 3300048929 Bacteria 1594
324 Ga0495682_0002606 3300049460 Bacteria 8464
325 Ga0501031_0001463 3300049568 Bacteria 14652
326 Ga0501032_0004296 3300049569 Bacteria 10757
327 Ga0501032_0093067 3300049569 Bacteria 1999
328 Ga0501032_0312799 3300049569 Bacteria 1014
329 Ga0501033_0003941 3300049570 Bacteria 12039
330 Ga0501033_0006872 3300049570 Bacteria 8882
331 Ga0501033_0015364 3300049570 Bacteria 5809
332 Ga0501033_0016698 3300049570 Bacteria 5552
333 Ga0501033_0022242 3300049570 Bacteria 4784
334 Ga0501033_0167139 3300049570 Bacteria 1581
335 Ga0501033_0229134 3300049570 Bacteria 1320
336 Ga0501034_0014238 3300049571 Bacteria 8198
337 Ga0501034_0025750 3300049571 Bacteria 5990
338 Ga0501034_0105636 3300049571 Bacteria 2809
339 Ga0501034_0109669 3300049571 Bacteria 2751
340 Ga0501034_0111541 3300049571 Bacteria 2726
341 Ga0501034_0115546 3300049571 Bacteria 2672
342 Ga0501034_0175187 3300049571 Bacteria 2111
343 Ga0501034_0209059 3300049571 Bacteria 1907
344 Ga0501034_0309757 3300049571 Bacteria 1514
345 Ga0501034_0479451 3300049571 Bacteria 1159
346 Ga0501034_0511124 3300049571 Bacteria 1114
347 Ga0501036_0000573 3300049572 Bacteria 26478
348 Ga0501036_0030888 3300049572 Bacteria 4527
349 Ga0501036_0061903 3300049572 Bacteria 3170
350 Ga0501036_0075414 3300049572 Bacteria 2852
351 Ga0501036_0112784 3300049572 Bacteria 2298
352 Ga0501037_0001138 3300049573 Bacteria 19691
353 Ga0501037_0029399 3300049573 Bacteria 4060
354 Ga0501037_0073432 3300049573 Bacteria 2487
355 Ga0501037_0077224 3300049573 Bacteria 2417
356 Ga0501037_0115324 3300049573 Bacteria 1934
357 Ga0501037_0244088 3300049573 Bacteria 1258
358 Ga0501038_0012200 3300049574 Bacteria 7845
359 Ga0501038_0015737 3300049574 Bacteria 6874
360 Ga0501038_0025018 3300049574 Bacteria 5323
361 Ga0501038_0040121 3300049574 Bacteria 4092
362 Ga0501038_0102947 3300049574 Bacteria 2375
363 Ga0501038_0108170 3300049574 Bacteria 2306
364 Ga0501038_0170042 3300049574 Bacteria 1765
365 Ga0501038_0320740 3300049574 Bacteria 1212
366 Ga0501039_0016930 3300049575 Bacteria 5587
367 Ga0501039_0024866 3300049575 Bacteria 4601
368 Ga0501039_0276823 3300049575 Bacteria 1319
369 Ga0501040_0002585 3300049576 Bacteria 11675
370 Ga0501040_0050119 3300049576 Bacteria 2855
371 Ga0501041_0001154 3300049577 Bacteria 14461
372 Ga0501041_0012260 3300049577 Bacteria 5078
373 Ga0501041_0277174 3300049577 Bacteria 1055
374 Ga0501042_0013775 3300049578 Bacteria 5509
375 Ga0501042_0020319 3300049578 Bacteria 4621
376 Ga0501043_0023317 3300049579 Bacteria 4853
377 Ga0501043_0033686 3300049579 Bacteria 4031
378 Ga0501043_0060910 3300049579 Bacteria 2963
379 Ga0501043_0082833 3300049579 Bacteria 2522
380 Ga0501043_0129833 3300049579 Bacteria 1975
381 Ga0501043_0143031 3300049579 Bacteria 1873
382 Ga0501043_0194799 3300049579 Bacteria 1575
383 Ga0501043_0325997 3300049579 Bacteria 1170
384 Ga0501046_0001777 3300049580 Bacteria 20588
385 Ga0501046_0038767 3300049580 Bacteria 3821
386 Ga0501046_0041662 3300049580 Bacteria 3663
387 Ga0501046_0070070 3300049580 Bacteria 2727
388 Ga0501046_0171357 3300049580 Bacteria 1629
389 Ga0501046_0220606 3300049580 Bacteria 1404
390 Ga0501047_0000643 3300049581 Bacteria 36707
391 Ga0501047_0002089 3300049581 Bacteria 19133
392 Ga0501047_0002378 3300049581 Bacteria 17993
393 Ga0501047_0004116 3300049581 Bacteria 13687
394 Ga0501047_0013238 3300049581 Bacteria 7813
395 Ga0501047_0014215 3300049581 Bacteria 7566
396 Ga0501047_0017074 3300049581 Bacteria 6941
397 Ga0501047_0025741 3300049581 Bacteria 5658
398 Ga0501047_0033795 3300049581 Bacteria 4936
399 Ga0501047_0042961 3300049581 Bacteria 4367
400 Ga0501047_0052674 3300049581 Bacteria 3934
401 Ga0501047_0055565 3300049581 Bacteria 3828
402 Ga0501047_0082567 3300049581 Bacteria 3089
403 Ga0501047_0116396 3300049581 Bacteria 2555
404 Ga0501047_0263946 3300049581 Bacteria 1569
405 Ga0501047_0287097 3300049581 Bacteria 1489
406 Ga0501048_0000470 3300049582 Bacteria 28325
407 Ga0501048_0098093 3300049582 Bacteria 2067
408 Ga0501048_0122818 3300049582 Bacteria 1835
409 Ga0501048_0273571 3300049582 Bacteria 1201
410 Ga0501067_0000547 3300049583 Bacteria 20428
411 Ga0501067_0004722 3300049583 Bacteria 7540
412 Ga0501067_0016670 3300049583 Bacteria 4060
413 Ga0501067_0020202 3300049583 Bacteria 3684
414 Ga0501067_0030425 3300049583 Bacteria 2994
415 Ga0501067_0040105 3300049583 Bacteria 2601
416 Ga0501067_0114085 3300049583 Bacteria 1503
417 Ga0501067_0203586 3300049583 Bacteria 1102
418 Ga0501069_0000714 3300049585 Bacteria 15508
419 Ga0501069_0166967 3300049585 Bacteria 1269
420 Ga0501070_0008339 3300049586 Bacteria 8755
421 Ga0501072_0003246 3300049588 Bacteria 12214
422 Ga0501072_0003635 3300049588 Bacteria 11605
423 Ga0501072_0028179 3300049588 Bacteria 4384
424 Ga0501072_0080587 3300049588 Bacteria 2580
425 Ga0501073_0003416 3300049589 Bacteria 11944
426 Ga0501073_0004363 3300049589 Bacteria 10622
427 Ga0501073_0016264 3300049589 Bacteria 5391
428 Ga0501073_0053970 3300049589 Bacteria 2814
429 Ga0501073_0231919 3300049589 Bacteria 1275
430 Ga0501074_0012628 3300049590 Bacteria 6142
431 Ga0501074_0072002 3300049590 Bacteria 2484
432 Ga0501075_0012692 3300049591 Bacteria 5993
433 Ga0501076_0048444 3300049592 Bacteria 3359
434 Ga0501076_0215930 3300049592 Bacteria 1568
435 Ga0501076_0293357 3300049592 Bacteria 1332
436 Ga0501077_0012436 3300049593 Bacteria 5330
437 Ga0501077_0027732 3300049593 Bacteria 3596
438 Ga0501077_0130804 3300049593 Bacteria 1591
439 Ga0501077_0134896 3300049593 Bacteria 1566
440 Ga0501077_0174668 3300049593 Bacteria 1365
441 Ga0501249_000256 3300049679 Bacteria 15740
442 Ga0501079_0001097 3300049741 Bacteria 18812
443 Ga0501079_0003431 3300049741 Bacteria 11637
444 Ga0501079_0043210 3300049741 Bacteria 3478
445 Ga0501079_0167797 3300049741 Bacteria 1712
446 Ga0501079_0396781 3300049741 Bacteria 1082
447 Ga0501080_0017279 3300049742 Bacteria 6667
448 Ga0501080_0027217 3300049742 Bacteria 5318
449 Ga0501080_0027632 3300049742 Bacteria 5275
450 Ga0501080_0034869 3300049742 Bacteria 4699
451 Ga0501080_0045492 3300049742 Bacteria 4086
452 Ga0501080_0068842 3300049742 Bacteria 3292
453 Ga0501080_0091663 3300049742 Bacteria 2822
454 Ga0501080_0131683 3300049742 Bacteria 2315
455 Ga0501080_0225271 3300049742 Bacteria 1715
456 Ga0501081_0009871 3300049743 Bacteria 6218
457 Ga0501081_0049874 3300049743 Bacteria 2883
458 Ga0501083_0001227 3300049744 Bacteria 17358
459 Ga0501083_0007517 3300049744 Bacteria 7720
460 Ga0501083_0010791 3300049744 Bacteria 6425
461 Ga0501083_0015074 3300049744 Bacteria 5410
462 Ga0501083_0084802 3300049744 Bacteria 2096
463 Ga0501083_0178256 3300049744 Bacteria 1388
464 Ga0501083_0226198 3300049744 Bacteria 1218
465 Ga0501035_0026375 3300049822 Bacteria 5316
466 Ga0501035_0033515 3300049822 Bacteria 4671
467 Ga0501035_0049616 3300049822 Bacteria 3760
468 Ga0501035_0095914 3300049822 Bacteria 2607
469 Ga0501035_0172298 3300049822 Bacteria 1869
470 Ga0501035_0447398 3300049822 Bacteria 1069
471 Ga0501044_0000342 3300049823 Bacteria 58651
472 Ga0501044_0007427 3300049823 Bacteria 12056
473 Ga0501044_0009846 3300049823 Bacteria 10389
474 Ga0501044_0018781 3300049823 Bacteria 7406
475 Ga0501044_0028615 3300049823 Bacteria 5881
476 Ga0501044_0030269 3300049823 Bacteria 5706
477 Ga0501044_0237785 3300049823 Bacteria 1766
478 Ga0501044_0308348 3300049823 Bacteria 1510
479 Ga0501045_0043639 3300049824 Bacteria 3265
480 Ga0501045_0053637 3300049824 Bacteria 2946
481 Ga0501045_0107757 3300049824 Bacteria 2065
482 nmdc:mga03683_20367_c1 3300050489 Bacteria 2544
483 nmdc:mga0k408_2024_c1 3300050493 Bacteria 9615
484 nmdc:mga05p37_321361_c1 3300050507 Bacteria 1832
485 nmdc:mga06r32_12091_c1 3300050510 Bacteria 7783
486 Ga0500555_007830 3300053103 Bacteria 3039
487 Ga0500593_085877 3300053117 Bacteria 1340
488 Ga0500595_002163 3300053119 Bacteria 9997
489 Ga0500595_012106 3300053119 Bacteria 3345
490 Ga0500595_027399 3300053119 Bacteria 1952
491 Ga0500568_0006786 3300053139 Bacteria 5707
492 Ga0500573_0000026 3300053140 Bacteria 144363
493 Ga0500639_047404 3300053163 Bacteria 2245
494 Ga0500645_046011 3300053730 Bacteria 1281
495 Ga0500645_071533 3300053730 Bacteria 995
496 Ga0501084_0003400 3300054114 Bacteria 12899
497 Ga0501084_0009584 3300054114 Bacteria 8011
498 Ga0501084_0057336 3300054114 Bacteria 3260
499 Ga0501084_0116711 3300054114 Bacteria 2244
500 Ga0501084_0123556 3300054114 Bacteria 2177
501 Ga0501084_0149451 3300054114 Bacteria 1968
502 Ga0501082_0000168 3300060353 Bacteria 56207
503 Ga0501082_0003809 3300060353 Bacteria 13189
504 Ga0501082_0011677 3300060353 Bacteria 7550
505 Ga0501082_0031091 3300060353 Bacteria 4601
506 Ga0501082_0034346 3300060353 Bacteria 4373
507 Ga0501082_0037829 3300060353 Bacteria 4161
508 Ga0501082_0167390 3300060353 Bacteria 1910
509 Ga0501082_0251674 3300060353 Bacteria 1537
510 Ga0530510_0029985 3300061734 Bacteria 3906
511 2644088552 2643221614 Bacteria 4260023
512 2644343788 2643221661 Bacteria 4267604
513 2644368734 2643221666 Bacteria 4265935
514 2671120747 2667528175 Bacteria 7532676
515 2842696165 2842694124 Bacteria 4063419
516 2885383293 2885374607 Bacteria 8927485
517 2894236468 2894232714 Bacteria 8834183
518 2910247847 2910245624 Bacteria 6935613
519 8002060452 8002060224 Bacteria 4026565
520 Ga0495621_0010737
521 JGI25153J46596_10000362
522 Ga0055524_1013305
523 Ga0070658_10013678
524 Ga0070658_10034448
525 Ga0070658_10146852
526 Ga0070658_10363612
527 Ga0070676_10014966
528 Ga0070683_100115334
529 Ga0068869_100042207
530 Ga0070666_10003899
531 Ga0070666_10039230
532 Ga0070666_10168383
533 Ga0070680_100027855
534 Ga0070680_100179525
535 Ga0068868_100052446
536 Ga0068868_100169482
537 Ga0070660_100151027
538 Ga0070660_100236474
539 Ga0070661_100042858
540 Ga0070661_100196863
541 Ga0070668_100214959
542 Ga0070669_100113432
543 Ga0070673_100040706
544 Ga0070659_100202847
545 Ga0070667_100020369
546 Ga0070667_100147268
547 Ga0070709_10279395
548 Ga0070710_10044293
549 Ga0070678_100122378
550 Ga0070681_10000057
551 Ga0070681_10196730
552 Ga0068867_100026549
553 Ga0068867_100083210
554 Ga0070679_100000043
555 Ga0070679_100004129
556 Ga0070679_100044057
557 Ga0070679_100108720
558 Ga0070679_100284453
559 Ga0070684_100089072
560 Ga0070684_100171200
561 Ga0068853_100044309
562 Ga0068853_100048979
563 Ga0070665_100005669
564 Ga0070665_100025155
565 Ga0070665_100067481
566 Ga0070665_100128606
567 Ga0068855_100000267
568 Ga0068855_100000468
569 Ga0068855_100029992
570 Ga0068855_100467716
571 Ga0070664_100443502
572 Ga0068857_100049498
573 Ga0068856_100034568
574 Ga0068856_100056553
575 Ga0068856_100190698
576 Ga0068852_100014984
577 Ga0068852_100088567
578 Ga0068852_100138253
579 Ga0068859_100606413
580 Ga0068864_100096868
581 Ga0068861_100516080
582 Ga0068851_10085545
583 Ga0068863_100030940
584 Ga0068858_100214118
585 Ga0068860_100022607
586 Ga0068860_100147340
587 Ga0068860_100243343
588 Ga0068862_100013003
589 Ga0068862_100026950
590 Ga0081455_10001962
591 Ga0081455_10005926
592 Ga0081539_10049463
593 Ga0075366_10002613
594 Ga0097621_100000784
595 Ga0097621_100019181
596 Ga0068871_100002170
597 Ga0068871_100004990
598 Ga0068871_100012698
599 Ga0068871_100049371
600 Ga0075431_100015092
601 Ga0068865_100074325
602 Ga0068865_100190495
603 Ga0097620_100606363
604 Ga0105240_10001197
605 Ga0105240_10046921
606 Ga0105240_10078082
607 Ga0105240_10157438
608 Ga0105240_10254899
609 Ga0105245_10042716
610 Ga0105245_10042995
611 Ga0105245_10406922
612 Ga0105247_10009165
613 Ga0114129_10006555
614 Ga0105243_10010237
615 Ga0105241_10006183
616 Ga0105241_10031988
617 Ga0105241_10306233
618 Ga0105241_10431669
619 Ga0105242_10006142
620 Ga0105242_10013358
621 Ga0105242_10148027
622 Ga0105248_10093888
623 Ga0105237_10068786
624 Ga0105237_10130125
625 Ga0105237_10253577
626 Ga0105238_10050188
627 Ga0105238_10107579
628 Ga0105238_10109050
629 Ga0105238_10149972
630 Ga0105238_10231607
631 Ga0105238_10346684
632 Ga0105249_10457030
633 Ga0105239_10019462
634 Ga0105239_10024995
635 Ga0105239_10035573
636 Ga0105239_10162260
637 Ga0105239_10177954
638 Ga0105246_10004462
639 Ga0157371_10196245
640 Ga0157370_10023718
641 Ga0157370_10082603
642 Ga0157370_10363438
643 Ga0157369_10068688
644 Ga0157369_10170509
645 Ga0157374_10134377
646 Ga0157378_10007188
647 Ga0157378_10110943
648 Ga0157378_10120597
649 Ga0157378_10130418
650 Ga0163162_10009230
651 Ga0157372_10104200
652 Ga0157372_10279094
653 Ga0157375_10004694
654 Ga0163163_10000004
655 Ga0163163_10015448
656 Ga0157379_10007697
657 Ga0157379_10016709
658 Ga0163161_10042679
659 Ga0213872_10016057
660 Ga0213872_10051147
661 Ga0213874_10000653
662 Ga0213871_10001018
663 Ga0209025_1013224
664 Ga0209758_1000008
665 Ga0209256_1001212
666 Ga0207692_10137817
667 Ga0207642_10022401
668 Ga0207680_10033691
669 Ga0207680_10194731
670 Ga0207645_10046667
671 Ga0207645_10249052
672 Ga0207705_10112319
673 Ga0207705_10148310
674 Ga0207654_10348693
675 Ga0207707_10000001
676 Ga0207707_10079452
677 Ga0207695_10000012
678 Ga0207695_10017143
679 Ga0207695_10034545
680 Ga0207695_10136414
681 Ga0207693_10088724
682 Ga0207660_10023997
683 Ga0207660_10130847
684 Ga0207657_10068662
685 Ga0207652_10000147
686 Ga0207652_10000489
687 Ga0207652_10025951
688 Ga0207652_10144893
689 Ga0207694_10000156
690 Ga0207694_10079180
691 Ga0207687_10076856
692 Ga0207687_10106711
693 Ga0207690_10132958
694 Ga0207706_10023986
695 Ga0207686_10007097
696 Ga0207686_10014546
697 Ga0207686_10014599
698 Ga0207686_10040108
699 Ga0207709_10009199
700 Ga0207709_10189287
701 Ga0207670_10054655
702 Ga0207704_10009175
703 Ga0207704_10105723
704 Ga0207704_10161422
705 Ga0207711_10021122
706 Ga0207711_10203741
707 Ga0207661_10127084
708 Ga0207661_10419588
709 Ga0207667_10000068
710 Ga0207667_10002816
711 Ga0207667_10044044
712 Ga0207667_10068579
713 Ga0207651_10063567
714 Ga0207651_10248114
715 Ga0207658_10004979
716 Ga0207658_10027881
717 Ga0207677_10158623
718 Ga0207703_10236830
719 Ga0207639_10031279
720 Ga0207639_10042693
721 Ga0207639_10051660
722 Ga0207702_10128107
723 Ga0207702_10351780
724 Ga0207641_10019847
725 Ga0207648_10005128
726 Ga0207648_10365662
727 Ga0207674_10043946
728 Ga0207674_10152427
729 Ga0207683_10046495
730 Ga0207683_10260981
731 Ga0207698_10006097
732 Ga0207698_10039651
733 Ga0207698_10069853
734 Ga0207698_10135519
735 Ga0268266_10000364
736 Ga0268266_10041960
737 Ga0268266_10058094
738 Ga0268266_10283449
739 Ga0268266_10395634
740 Ga0268265_10024823
741 Ga0268265_10101338
742 Ga0268264_10017819
743 Ga0268264_10139820
744 Ga0268264_10200911
745 Ga0265338_10052288
746 Ga0265330_10012510
747 Ga0265330_10036736
748 Ga0265330_10097136
749 Ga0265328_10000668
750 Ga0265325_10000965
751 Ga0265329_10012011
752 Ga0265340_10000409
753 Ga0265340_10035448
754 Ga0265339_10000928
755 Ga0265339_10010103
756 Ga0265331_10000049
757 Ga0265331_10001693
758 Ga0265327_10025328
759 Ga0265327_10030141
760 Ga0265316_10003027
761 Ga0265316_10004443
762 Ga0265316_10049496
763 Ga0265316_10080194
764 Ga0265316_10123742
765 Ga0307513_10002302
766 Ga0307513_10170682
767 Ga0307408_100260289
768 Ga0265313_10003154
769 Ga0265313_10037914
770 Ga0265313_10052694
771 Ga0265313_10054309
772 Ga0265314_10022477
773 Ga0265314_10035073
774 Ga0265314_10094638
775 Ga0265342_10045543
776 Ga0265342_10108859
777 Ga0307516_10022592
778 Ga0307516_10049718
779 Ga0307510_10150662
780 Ga0373940_0003398
781 Ga0373955_0109387
782 Ga0373937_0068204
783 Ga0316582_0077629
784 Ga0316582_0085420
785 Ga0316584_0006027
786 Ga0395899_0014590
787 Ga0395900_0005379
788 Ga0395900_0015442
789 Ga0395900_0081826
790 Ga0395900_0298513
791 Ga0395898_0004253
792 Ga0395898_0036173
793 Ga0395898_0157225
794 Ga0395905_0067009
795 Ga0395905_0267443
796 Ga0436364_0468604
797 Ga0436364_1254677
798 Ga0436364_1524223
799 Ga0395901_0007428
800 Ga0395901_0010960
801 Ga0395901_0112724
802 Ga0400486_31283
803 Ga0400483_095621
804 Ga0400483_231048
805 Ga0436365_1934144
806 Ga0436360_0617322
807 Ga0436360_1055181
808 Ga0436361_0761887
809 Ga0436361_0858330
810 Ga0436361_1113559
811 Ga0436361_1139693
812 Ga0436363_1498986
813 Ga0451795_1698426
814 Ga0439445_0013882
815 Ga0439434_0050964
816 Ga0451577_0021289
817 Ga0466966_0056624
818 Ga0453684_0000015
819 Ga0453684_0000020
820 Ga0453684_0038206
821 Ga0466957_0055945
822 Ga0451576_0463328
823 Ga0466967_0026787
824 Ga0495603_0017475
825 Ga0495587_0037729
826 Ga0495636_0041633
827 Ga0495686_0000096
828 Ga0496101_0314067
829 Ga0496102_0126141
830 Ga0496102_0269722
831 Ga0496104_0013315
832 Ga0496105_0002278
833 Ga0496108_0000479
834 Ga0496109_0003408
835 Ga0496110_0232043
836 Ga0496111_0003436
837 Ga0496112_0159831
838 Ga0496115_0009683
839 Ga0496118_0019657
840 Ga0496119_0012340
841 Ga0496126_0201765
842 Ga0496126_0220282
843 Ga0495682_0002606
844 Ga0501031_0001463
845 Ga0501032_0004296
846 Ga0501032_0093067
847 Ga0501032_0312799
848 Ga0501033_0003941
849 Ga0501033_0006872
850 Ga0501033_0015364
851 Ga0501033_0016698
852 Ga0501033_0022242
853 Ga0501033_0167139
854 Ga0501033_0229134
855 Ga0501034_0014238
856 Ga0501034_0025750
857 Ga0501034_0105636
858 Ga0501034_0109669
859 Ga0501034_0111541
860 Ga0501034_0115546
861 Ga0501034_0175187
862 Ga0501034_0209059
863 Ga0501034_0309757
864 Ga0501034_0479451
865 Ga0501034_0511124
866 Ga0501036_0000573
867 Ga0501036_0030888
868 Ga0501036_0061903
869 Ga0501036_0075414
870 Ga0501036_0112784
871 Ga0501037_0001138
872 Ga0501037_0029399
873 Ga0501037_0073432
874 Ga0501037_0077224
875 Ga0501037_0115324
876 Ga0501037_0244088
877 Ga0501038_0012200
878 Ga0501038_0015737
879 Ga0501038_0025018
880 Ga0501038_0040121
881 Ga0501038_0102947
882 Ga0501038_0108170
883 Ga0501038_0170042
884 Ga0501038_0320740
885 Ga0501039_0016930
886 Ga0501039_0024866
887 Ga0501039_0276823
888 Ga0501040_0002585
889 Ga0501040_0050119
890 Ga0501041_0001154
891 Ga0501041_0012260
892 Ga0501041_0277174
893 Ga0501042_0013775
894 Ga0501042_0020319
895 Ga0501043_0023317
896 Ga0501043_0033686
897 Ga0501043_0060910
898 Ga0501043_0082833
899 Ga0501043_0129833
900 Ga0501043_0143031
901 Ga0501043_0194799
902 Ga0501043_0325997
903 Ga0501046_0001777
904 Ga0501046_0038767
905 Ga0501046_0041662
906 Ga0501046_0070070
907 Ga0501046_0171357
908 Ga0501046_0220606
909 Ga0501047_0000643
910 Ga0501047_0002089
911 Ga0501047_0002378
912 Ga0501047_0004116
913 Ga0501047_0013238
914 Ga0501047_0014215
915 Ga0501047_0017074
916 Ga0501047_0025741
917 Ga0501047_0033795
918 Ga0501047_0042961
919 Ga0501047_0052674
920 Ga0501047_0055565
921 Ga0501047_0082567
922 Ga0501047_0116396
923 Ga0501047_0263946
924 Ga0501047_0287097
925 Ga0501048_0000470
926 Ga0501048_0098093
927 Ga0501048_0122818
928 Ga0501048_0273571
929 Ga0501067_0000547
930 Ga0501067_0004722
931 Ga0501067_0016670
932 Ga0501067_0020202
933 Ga0501067_0030425
934 Ga0501067_0040105
935 Ga0501067_0114085
936 Ga0501067_0203586
937 Ga0501069_0000714
938 Ga0501069_0166967
939 Ga0501070_0008339
940 Ga0501072_0003246
941 Ga0501072_0003635
942 Ga0501072_0028179
943 Ga0501072_0080587
944 Ga0501073_0003416
945 Ga0501073_0004363
946 Ga0501073_0016264
947 Ga0501073_0053970
948 Ga0501073_0231919
949 Ga0501074_0012628
950 Ga0501074_0072002
951 Ga0501075_0012692
952 Ga0501076_0048444
953 Ga0501076_0215930
954 Ga0501076_0293357
955 Ga0501077_0012436
956 Ga0501077_0027732
957 Ga0501077_0130804
958 Ga0501077_0134896
959 Ga0501077_0174668
960 Ga0501249_000256
961 Ga0501079_0001097
962 Ga0501079_0003431
963 Ga0501079_0043210
964 Ga0501079_0167797
965 Ga0501079_0396781
966 Ga0501080_0017279
967 Ga0501080_0027217
968 Ga0501080_0027632
969 Ga0501080_0034869
970 Ga0501080_0045492
971 Ga0501080_0068842
972 Ga0501080_0091663
973 Ga0501080_0131683
974 Ga0501080_0225271
975 Ga0501081_0009871
976 Ga0501081_0049874
977 Ga0501083_0001227
978 Ga0501083_0007517
979 Ga0501083_0010791
980 Ga0501083_0015074
981 Ga0501083_0084802
982 Ga0501083_0178256
983 Ga0501083_0226198
984 Ga0501035_0026375
985 Ga0501035_0033515
986 Ga0501035_0049616
987 Ga0501035_0095914
988 Ga0501035_0172298
989 Ga0501035_0447398
990 Ga0501044_0000342
991 Ga0501044_0007427
992 Ga0501044_0009846
993 Ga0501044_0018781
994 Ga0501044_0028615
995 Ga0501044_0030269
996 Ga0501044_0237785
997 Ga0501044_0308348
998 Ga0501045_0043639
999 Ga0501045_0053637
1000 Ga0501045_0107757
1001 nmdc:mga03683_20367_c1
1002 nmdc:mga0k408_2024_c1
1003 nmdc:mga05p37_321361_c1
1004 nmdc:mga06r32_12091_c1
1005 Ga0500555_007830
1006 Ga0500593_085877
1007 Ga0500595_002163
1008 Ga0500595_012106
1009 Ga0500595_027399
1010 Ga0500568_0006786
1011 Ga0500573_0000026
1012 Ga0500639_047404
1013 Ga0500645_046011
1014 Ga0500645_071533
1015 Ga0501084_0003400
1016 Ga0501084_0009584
1017 Ga0501084_0057336
1018 Ga0501084_0116711
1019 Ga0501084_0123556
1020 Ga0501084_0149451
1021 Ga0501082_0000168
1022 Ga0501082_0003809
1023 Ga0501082_0011677
1024 Ga0501082_0031091
1025 Ga0501082_0034346
1026 Ga0501082_0037829
1027 Ga0501082_0167390
1028 Ga0501082_0251674
1029 Ga0530510_0029985
1030 2644088552
1031 2644343788
1032 2644368734
1033 2671120747
1034 2842696165
1035 2885383293
1036 2894236468
1037 2910247847
1038 8002060452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02153

PDH_N

Prephenate dehydrogenase, nucleotide-binding domain

19

174

0.98

PF20463

PDH_C

Prephenate dehydrogenase, dimerization domain

176

278

0.96

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

1

104

0.84

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

6

99

0.77

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

6

175

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wji-assembly1.cif.gz_A-2 crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine 0.9626 2 281
4wji-assembly1.cif.gz_A-2 crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine 0.9239 2 281
3ggp-assembly2.cif.gz_D crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+ 0.9176 1 274
7mqv-assembly1.cif.gz_B crystal structure of truncated (act domain removed) prephenate dehydrogenase tyra from bacillus anthracis in complex with nad 0.9039 3 272
2g5c-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from aquifex aeolicus 0.8996 5 274
ID Description Score Start End Superfamily
af_Q2FYS1_177_282_1.10.3660.10 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9511 168 272 1.10.3660.10
af_Q9UTM9_3_407_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.938 4 36 3.50.50.60
3gggD02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9362 166 274 1.10.3660.10
3ggpC02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9352 166 268 1.10.3660.10
3ggoD02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9343 166 271 1.10.3660.10
ID Description Score Start End GO Terms
AF-A0A1F2ZZQ4-F1-model_v4 Prephenate/arogenate dehydrogenase domain-containing protein 0.9731 1 279 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A2F0AHQ8-F1-model_v4 Prephenate/arogenate dehydrogenase domain-containing protein 0.9695 2 275 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A1W4U6B5-F1-model_v4 deleted 0.9689 112 279
AF-A0A5C8PLW7-F1-model_v4 Prephenate/arogenate dehydrogenase family protein 0.9685 1 279 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A5R2MZD0-F1-model_v4 Prephenate dehydrogenase/arogenate dehydrogenase family protein 0.9684 124 239 GO:0004665
GO:0006571
GO:0008977
GO:0070403

Map