F458397

General Info

Members Datasets Scaffolds Average Seq Length
519 274 504 418

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10003502|Ga0105238_100035023
Length 473
Sequence MRTIGSAFLRIASAVLVVLYQNSQGVQNVAWESRRQEVPYIEETELNDEIERTPRAGGFALVLIVCLYALWGMAHNLNDILIAQFKKVFELTDLQSSLVQSCFYIAYLIMPIPVALLLQRFGYKRGVIAGLCLYGAGAFLFWPAANSLTYAAFLAALFVIASGLTFIETAGTGIIVVLGSPRTTEWRINFAQAFNPVGSILGILIGRQFVLSGVELSSTTRAAMNSSEYAAYRVSEGHAVQWPYLVIGLVVMAVAILISITRFPAAATERHRGSPFAGLGALLRSRLFVFGVIAQFFYVGTQIGVWSFLIRYSKHAVPGMSEKLAALYLTASLVLFLIGRFFSLVLLRRYSSAQIGVVFAAAXXXLTVVGIFASGSIGIAAVVGASFFMSIMFPAIYAIGLHGNEAHSKPASALMIMSITGGAVLTAAMGAISDQATISVAYAVPLTGFLVVLAYCSFAVLSGRTGGTPTVAH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
10 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
11 2818991435 Caulobacter henricii 536 Isolate Unclassified
12 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
13 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
14 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
15 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
16 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
17 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
34 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
35 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
170 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
173 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
174 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
221 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
222 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
223 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
256 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
257 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
258 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
261 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
262 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
263 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
266 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.64
Nodule 0
Rhizoplane 2.7
Rhizosphere 69.56
Stem 0
Stem Tuber 0
Unclassified 13.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_599388 2162886007 Bacteria 4431
2 JGI24741J21665_1000192 3300001915 Bacteria 17936
3 JGI24740J21852_10001303 3300001979 Bacteria 11343
4 JGI24740J21852_10004569 3300001979 Bacteria 5953
5 JGI24739J22299_10009252 3300001989 Bacteria 3677
6 JGI24739J22299_10010558 3300001989 Bacteria 3428
7 JGI24739J22299_10022531 3300001989 Bacteria 2234
8 JGI24739J22299_10023614 3300001989 Bacteria 2171
9 JGI24737J22298_10000478 3300001990 Bacteria 13845
10 JGI24737J22298_10001431 3300001990 Bacteria 8495
11 JGI24735J21928_10000006 3300002067 Bacteria 339303
12 JGI24735J21928_10009552 3300002067 Bacteria 3109
13 JGI24735J21928_10030842 3300002067 Bacteria 1591
14 JGI25157J39369_1000688 3300002741 Bacteria 18357
15 JGI25165J46597_1000007 3300003214 Bacteria 518996
16 rootH1_10001690 3300003316 Bacteria 3195
17 rootH1_10001690 3300003323 Bacteria 6112
18 rootH1_10015253 3300003316 Bacteria 4550
19 rootH1_10025334 3300003316 Bacteria 12134
20 rootH1_10044186 3300003316 Bacteria 3919
21 rootH2_10054415 3300003320 Bacteria 5495
22 rootL2_10023886 3300003322 Bacteria 1467
23 rootL2_10056736 3300003322 Bacteria 9615
24 rootL2_10074859 3300003322 Bacteria 1775
25 rootL2_10116132 3300003322 Bacteria 6852
26 rootL2_10204688 3300003322 Bacteria 2419
27 rootH1_10013001 3300003323 Bacteria 7005
28 rootH1_10013002 3300003323 Bacteria 4810
29 rootH1_10089880 3300003323 Bacteria 5967
30 Ga0055525_1000096 3300003759 Bacteria 137836
31 Ga0055542_1000012 3300003762 Bacteria 391808
32 Ga0055529_1000002 3300003763 Bacteria 537914
33 Ga0055529_1000021 3300003763 Bacteria 321484
34 Ga0055537_1001600 3300003773 Bacteria 8535
35 Ga0055524_1000345 3300003775 Bacteria 42426
36 Ga0055524_1019189 3300003775 Bacteria 2345
37 Ga0055528_1011022 3300003790 Bacteria 3624
38 Ga0055530_10000061 3300003791 Bacteria 95363
39 Ga0055531_10000035 3300003794 Bacteria 147414
40 Ga0055531_10003135 3300003794 Bacteria 10657
41 Ga0055531_10003469 3300003794 Bacteria 10032
42 Ga0065165_1000660 3300005262 Bacteria 49811
43 Ga0065165_1007383 3300005262 Bacteria 5420
44 Ga0065704_10073031 3300005289 Bacteria 7663
45 Ga0070658_10005243 3300005327 Bacteria 10531
46 Ga0070658_10008238 3300005327 Bacteria 8384
47 Ga0070676_10023350 3300005328 Bacteria 3476
48 Ga0070670_100082708 3300005331 Bacteria 2759
49 Ga0070670_100140068 3300005331 Bacteria 2092
50 Ga0070666_10000005 3300005335 Bacteria 343092
51 Ga0070666_10017169 3300005335 Bacteria 4637
52 Ga0070666_10036326 3300005335 Bacteria 3270
53 Ga0070660_100003037 3300005339 Bacteria 11554
54 Ga0070660_100042830 3300005339 Bacteria 3457
55 Ga0070660_100186332 3300005339 Bacteria 1680
56 Ga0070661_100005388 3300005344 Bacteria 8818
57 Ga0070661_100005520 3300005344 Bacteria 8716
58 Ga0070675_100059763 3300005354 Bacteria 3145
59 Ga0070671_100009724 3300005355 Bacteria 7724
60 Ga0070671_100104590 3300005355 Bacteria 2376
61 Ga0070674_100006094 3300005356 Bacteria 7012
62 Ga0070674_100015548 3300005356 Bacteria 4753
63 Ga0070673_100072152 3300005364 Bacteria 2776
64 Ga0070659_100136730 3300005366 Bacteria 1993
65 Ga0070667_100006541 3300005367 Bacteria 9687
66 Ga0070667_100023452 3300005367 Bacteria 5120
67 Ga0070667_100028348 3300005367 Bacteria 4661
68 Ga0070667_100033528 3300005367 Bacteria 4293
69 Ga0070667_100082993 3300005367 Bacteria 2744
70 Ga0070714_100027069 3300005435 Bacteria 4744
71 Ga0070713_100001768 3300005436 Bacteria 13947
72 Ga0070663_100003883 3300005455 Bacteria 8710
73 Ga0070663_100116900 3300005455 Bacteria 2010
74 Ga0070678_100000254 3300005456 Bacteria 24734
75 Ga0070678_100062701 3300005456 Bacteria 2746
76 Ga0070662_100004118 3300005457 Bacteria 9141
77 Ga0070684_100096965 3300005535 Bacteria 2629
78 Ga0068853_100012404 3300005539 Bacteria 6933
79 Ga0068853_100123935 3300005539 Bacteria 2307
80 Ga0070672_100007102 3300005543 Bacteria 7574
81 Ga0070686_100028091 3300005544 Bacteria 3409
82 Ga0070665_100001943 3300005548 Bacteria 23303
83 Ga0070665_100013154 3300005548 Bacteria 8334
84 Ga0070665_100021493 3300005548 Bacteria 6487
85 Ga0070665_100039006 3300005548 Bacteria 4776
86 Ga0070665_100051841 3300005548 Bacteria 4115
87 Ga0068855_100000183 3300005563 Bacteria 80725
88 Ga0068855_100001262 3300005563 Bacteria 31405
89 Ga0068855_100139209 3300005563 Bacteria 2768
90 Ga0068855_100158399 3300005563 Bacteria 2571
91 Ga0068855_100173765 3300005563 Bacteria 2439
92 Ga0070664_100006941 3300005564 Bacteria 9125
93 Ga0068857_100116882 3300005577 Unclassified 2400
94 Ga0068854_100009744 3300005578 Bacteria 6210
95 Ga0068854_100015646 3300005578 Bacteria 5034
96 Ga0068856_100018305 3300005614 Bacteria 6791
97 Ga0068852_100004914 3300005616 Bacteria 9491
98 Ga0068852_100134508 3300005616 Bacteria 2281
99 Ga0068859_100000211 3300005617 Bacteria 58042
100 Ga0068864_100074518 3300005618 Bacteria 2962
101 Ga0068851_10005927 3300005834 Bacteria 5562
102 Ga0068863_100000714 3300005841 Bacteria 33402
103 Ga0068863_100000780 3300005841 Bacteria 32027
104 Ga0068863_100003996 3300005841 Bacteria 14561
105 Ga0068858_100001049 3300005842 Bacteria 28556
106 Ga0068858_100005568 3300005842 Bacteria 12322
107 Ga0068860_100000185 3300005843 Bacteria 99579
108 Ga0068860_100000330 3300005843 Bacteria 64327
109 Ga0068860_100011389 3300005843 Bacteria 8763
110 Ga0075366_10053203 3300006195 Bacteria 2405
111 Ga0075366_10059558 3300006195 Bacteria 2268
112 Ga0068865_100131873 3300006881 Bacteria 1873
113 Ga0097620_100000211 3300006931 Bacteria 58042
114 Ga0105240_10012894 3300009093 Bacteria 11511
115 Ga0105240_10013334 3300009093 Bacteria 11296
116 Ga0105240_10021853 3300009093 Bacteria 8501
117 Ga0105240_10030686 3300009093 Bacteria 6983
118 Ga0105240_10037706 3300009093 Bacteria 6210
119 Ga0105240_10089162 3300009093 Bacteria 3773
120 Ga0105240_10376384 3300009093 Bacteria 1604
121 Ga0105247_10000260 3300009101 Bacteria 48812
122 Ga0105243_10000441 3300009148 Bacteria 43295
123 Ga0105241_10000496 3300009174 Bacteria 29797
124 Ga0105248_10001076 3300009177 Bacteria 30156
125 Ga0105237_10002423 3300009545 Bacteria 23160
126 Ga0105237_10030583 3300009545 Bacteria 5468
127 Ga0105237_10111200 3300009545 Bacteria 2731
128 Ga0105238_10000688 3300009551 Bacteria 35470
129 Ga0105238_10003502 3300009551 Bacteria 15626
130 Ga0105238_10058335 3300009551 Bacteria 3869
131 Ga0105238_10238408 3300009551 Bacteria 1796
132 Ga0105249_10013876 3300009553 Bacteria 7121
133 Ga0105249_10015031 3300009553 Bacteria 6848
134 Ga0105239_10000024 3300010375 Bacteria 256334
135 Ga0105239_10033185 3300010375 Bacteria 5669
136 Ga0105239_10037903 3300010375 Bacteria 5282
137 Ga0105239_10110195 3300010375 Bacteria 3051
138 Ga0105239_10130363 3300010375 Bacteria 2796
139 Ga0105239_10253506 3300010375 Unclassified 1977
140 Ga0105239_10337372 3300010375 Unclassified 1701
141 Ga0105246_10056925 3300011119 Bacteria 2704
142 Ga0105246_10115039 3300011119 Bacteria 1983
143 Ga0105246_10118733 3300011119 Bacteria 1956
144 Ga0157373_10012678 3300013100 Bacteria 6196
145 Ga0157373_10016243 3300013100 Bacteria 5433
146 Ga0157371_10002077 3300013102 Bacteria 19617
147 Ga0157369_10072322 3300013105 Bacteria 3701
148 Ga0157369_10135493 3300013105 Bacteria 2608
149 Ga0157369_10152421 3300013105 Bacteria 2443
150 Ga0157374_10083234 3300013296 Bacteria 3040
151 Ga0157378_10269795 3300013297 Bacteria 1636
152 Ga0163162_10000281 3300013306 Bacteria 46556
153 Ga0163162_10105979 3300013306 Bacteria 2906
154 Ga0163162_10294884 3300013306 Bacteria 1753
155 Ga0157372_10037265 3300013307 Bacteria 5362
156 Ga0157372_10096307 3300013307 Bacteria 3372
157 Ga0157372_10296052 3300013307 Bacteria 1882
158 Ga0163163_10020754 3300014325 Bacteria 6193
159 Ga0163163_10111745 3300014325 Bacteria 2761
160 Ga0163163_10205537 3300014325 Bacteria 2017
161 Ga0157379_10007683 3300014968 Bacteria 9335
162 Ga0163161_10025681 3300017792 Bacteria 4171
163 Ga0213872_10001198 3300021361 Bacteria 17580
164 Ga0209674_100898 3300025226 Bacteria 9646
165 Ga0209563_100058 3300025230 Bacteria 302571
166 Ga0207425_1007001 3300025245 Bacteria 3028
167 Ga0209646_1007687 3300025246 Bacteria 1750
168 Ga0209026_1000010 3300025250 Bacteria 511986
169 Ga0209148_1000008 3300025254 Bacteria 1504371
170 Ga0209148_1000318 3300025254 Bacteria 67692
171 Ga0209233_1000026 3300025261 Bacteria 678466
172 Ga0209565_1000008 3300025263 Bacteria 774179
173 Ga0209565_1000183 3300025263 Bacteria 76983
174 Ga0209455_1000002 3300025272 Bacteria 1505459
175 Ga0209673_1000848 3300025273 Bacteria 39892
176 Ga0209673_1002083 3300025273 Bacteria 15037
177 Ga0209673_1030364 3300025273 Bacteria 1704
178 Ga0209675_1004298 3300025291 Bacteria 6399
179 Ga0209564_1001441 3300025295 Bacteria 24287
180 Ga0209564_1007091 3300025295 Bacteria 5860
181 Ga0209758_1002223 3300025297 Bacteria 20148
182 Ga0209758_1002655 3300025297 Bacteria 17700
183 Ga0209758_1004526 3300025297 Bacteria 11514
184 Ga0209050_1000014 3300025298 Bacteria 774327
185 Ga0209050_1004047 3300025298 Bacteria 10284
186 Ga0209050_1005412 3300025298 Bacteria 8051
187 Ga0209050_1020702 3300025298 Bacteria 2434
188 Ga0209256_1000009 3300025299 Bacteria 922071
189 Ga0209256_1000010 3300025299 Bacteria 912110
190 Ga0209256_1000694 3300025299 Bacteria 44757
191 Ga0209257_1000019 3300025304 Bacteria 774261
192 Ga0209257_1000326 3300025304 Bacteria 99865
193 Ga0209257_1000457 3300025304 Bacteria 75784
194 Ga0209257_1003277 3300025304 Bacteria 14131
195 Ga0207656_10003316 3300025321 Bacteria 5514
196 Ga0207710_10000322 3300025900 Bacteria 36632
197 Ga0207680_10000005 3300025903 Bacteria 660983
198 Ga0207680_10006048 3300025903 Bacteria 5828
199 Ga0207680_10039526 3300025903 Bacteria 2738
200 Ga0207680_10076134 3300025903 Bacteria 2095
201 Ga0207647_10022357 3300025904 Bacteria 4201
202 Ga0207647_10033275 3300025904 Bacteria 3302
203 Ga0207645_10040505 3300025907 Bacteria 2983
204 Ga0207645_10053332 3300025907 Bacteria 2584
205 Ga0207705_10000175 3300025909 Bacteria 68190
206 Ga0207705_10012504 3300025909 Bacteria 6130
207 Ga0207654_10000020 3300025911 Bacteria 167053
208 Ga0207695_10009873 3300025913 Bacteria 11730
209 Ga0207695_10011751 3300025913 Bacteria 10576
210 Ga0207695_10015761 3300025913 Bacteria 8882
211 Ga0207695_10018838 3300025913 Bacteria 7966
212 Ga0207695_10066236 3300025913 Bacteria 3711
213 Ga0207695_10117580 3300025913 Bacteria 2630
214 Ga0207671_10006292 3300025914 Bacteria 10605
215 Ga0207671_10009369 3300025914 Bacteria 8189
216 Ga0207671_10037715 3300025914 Bacteria 3583
217 Ga0207671_10044956 3300025914 Bacteria 3264
218 Ga0207657_10003643 3300025919 Bacteria 16405
219 Ga0207657_10011169 3300025919 Bacteria 8927
220 Ga0207657_10111766 3300025919 Bacteria 2255
221 Ga0207649_10000356 3300025920 Bacteria 34254
222 Ga0207649_10068786 3300025920 Bacteria 2253
223 Ga0207694_10000387 3300025924 Bacteria 40972
224 Ga0207694_10001048 3300025924 Bacteria 24066
225 Ga0207694_10007150 3300025924 Bacteria 8484
226 Ga0207694_10032768 3300025924 Unclassified 3978
227 Ga0207650_10037699 3300025925 Bacteria 3525
228 Ga0207650_10226856 3300025925 Bacteria 1505
229 Ga0207700_10001549 3300025928 Bacteria 13039
230 Ga0207664_10027619 3300025929 Bacteria 4305
231 Ga0207644_10116877 3300025931 Unclassified 2025
232 Ga0207690_10000063 3300025932 Bacteria 95620
233 Ga0207690_10083609 3300025932 Bacteria 2235
234 Ga0207706_10003215 3300025933 Bacteria 15684
235 Ga0207706_10046770 3300025933 Bacteria 3830
236 Ga0207709_10000093 3300025935 Bacteria 139110
237 Ga0207669_10000501 3300025937 Bacteria 17123
238 Ga0207669_10003631 3300025937 Bacteria 6695
239 Ga0207669_10008254 3300025937 Bacteria 4881
240 Ga0207691_10089487 3300025940 Bacteria 2760
241 Ga0207679_10071198 3300025945 Bacteria 2622
242 Ga0207667_10000006 3300025949 Bacteria 679876
243 Ga0207667_10000007 3300025949 Bacteria 630590
244 Ga0207667_10000486 3300025949 Bacteria 52631
245 Ga0207667_10134146 3300025949 Bacteria 2550
246 Ga0207651_10010868 3300025960 Bacteria 5066
247 Ga0207712_10031275 3300025961 Bacteria 3583
248 Ga0207712_10042649 3300025961 Bacteria 3126
249 Ga0207640_10000042 3300025981 Bacteria 102885
250 Ga0207640_10001038 3300025981 Bacteria 15363
251 Ga0207640_10006146 3300025981 Bacteria 6571
252 Ga0207658_10006010 3300025986 Bacteria 8292
253 Ga0207658_10013372 3300025986 Bacteria 5605
254 Ga0207658_10030157 3300025986 Bacteria 3838
255 Ga0207658_10036866 3300025986 Unclassified 3508
256 Ga0207658_10105797 3300025986 Bacteria 2214
257 Ga0207703_10001692 3300026035 Bacteria 19824
258 Ga0207703_10002171 3300026035 Bacteria 17238
259 Ga0207639_10000785 3300026041 Bacteria 21614
260 Ga0207639_10006296 3300026041 Bacteria 8063
261 Ga0207678_10000225 3300026067 Bacteria 50510
262 Ga0207678_10077065 3300026067 Unclassified 2856
263 Ga0207702_10002347 3300026078 Bacteria 18064
264 Ga0207702_10055769 3300026078 Bacteria 3352
265 Ga0207702_10089993 3300026078 Bacteria 2685
266 Ga0207702_10133831 3300026078 Bacteria 2234
267 Ga0207641_10000135 3300026088 Bacteria 108689
268 Ga0207641_10000393 3300026088 Bacteria 51636
269 Ga0207674_10008800 3300026116 Bacteria 11622
270 Ga0207683_10000181 3300026121 Bacteria 54142
271 Ga0207683_10010154 3300026121 Bacteria 8034
272 Ga0207683_10079167 3300026121 Bacteria 2913
273 Ga0207683_10298002 3300026121 Bacteria 1475
274 Ga0207698_10005364 3300026142 Bacteria 7913
275 Ga0268266_10000004 3300028379 Bacteria 1495817
276 Ga0268266_10000008 3300028379 Bacteria 1161875
277 Ga0268266_10006593 3300028379 Bacteria 10602
278 Ga0268266_10028873 3300028379 Bacteria 4714
279 Ga0268266_10037280 3300028379 Bacteria 4143
280 Ga0268264_10000081 3300028381 Bacteria 248362
281 Ga0268264_10000088 3300028381 Bacteria 235344
282 Ga0268264_10028058 3300028381 Bacteria 4604
283 Ga0307515_10058107 3300028794 Bacteria 5579
284 Ga0307515_10148647 3300028794 Bacteria 2464
285 Ga0307515_10151927 3300028794 Bacteria 2415
286 Ga0307511_10000227 3300030521 Bacteria 57255
287 Ga0307513_10038831 3300031456 Bacteria 5284
288 Ga0307509_10000152 3300031507 Bacteria 106873
289 Ga0307509_10131310 3300031507 Bacteria 2460
290 Ga0307411_10102895 3300032005 Unclassified 2025
291 Ga0307510_10000061 3300033180 Bacteria 82810
292 Ga0307510_10005829 3300033180 Bacteria 14690
293 Ga0307510_10010353 3300033180 Bacteria 11075
294 Ga0307510_10012691 3300033180 Bacteria 9997
295 Ga0395901_0081093 3300038443 Bacteria 3389
296 Ga0436361_0143236 3300039447 Bacteria 116593
297 Ga0439436_0023306 3300041404 Bacteria 1831
298 Ga0439439_0017169 3300041406 Bacteria 1777
299 Ga0439461_0000938 3300041410 Bacteria 4359
300 Ga0439465_0000889 3300041413 Bacteria 9445
301 Ga0439465_0015154 3300041413 Bacteria 2405
302 Ga0451800_1324369 3300041459 Bacteria 2710
303 Ga0451802_0008807 3300041460 Bacteria 2003
304 Ga0451807_1741878 3300041486 Bacteria 6386
305 Ga0451843_1240649 3300041509 Bacteria 2223
306 Ga0439431_0000346 3300041997 Bacteria 9719
307 Ga0439448_0000804 3300042005 Bacteria 7625
308 Ga0439448_0001461 3300042005 Bacteria 6127
309 Ga0439432_011589 3300042006 Bacteria 3037
310 Ga0439452_015383 3300042010 Bacteria 2101
311 Ga0439455_0000189 3300042012 Bacteria 7085
312 Ga0439455_0000568 3300042012 Bacteria 5273
313 Ga0439462_0000664 3300042015 Bacteria 6975
314 Ga0439458_0000013 3300042157 Bacteria 27447
315 Ga0439434_0002510 3300042435 Bacteria 5340
316 Ga0439434_0012467 3300042435 Bacteria 2515
317 Ga0439459_0003116 3300042438 Bacteria 2606
318 Ga0451577_0212166 3300042876 Bacteria 1749
319 Ga0466969_0014302 3300044656 Bacteria 4172
320 Ga0466982_0000013 3300044672 Bacteria 136227
321 Ga0466964_0003523 3300044706 Bacteria 5719
322 Ga0453684_0022721 3300044712 Bacteria 9290
323 Ga0466971_0010842 3300044719 Bacteria 3985
324 Ga0466968_0024342 3300044735 Bacteria 2472
325 Ga0466970_0009612 3300044765 Bacteria 4892
326 Ga0466960_0003521 3300044901 Bacteria 6027
327 Ga0466959_0011104 3300045049 Bacteria 6464
328 Ga0466958_0037486 3300045836 Bacteria 2905
329 Ga0495590_0002018 3300046457 Bacteria 8538
330 Ga0495629_0067794 3300046459 Bacteria 2490
331 Ga0495638_0000230 3300046460 Bacteria 76565
332 Ga0495638_0014340 3300046460 Bacteria 5363
333 Ga0495638_0020473 3300046460 Bacteria 4370
334 Ga0495650_0000014 3300046471 Bacteria 581606
335 Ga0495650_0000020 3300046471 Bacteria 533839
336 Ga0495650_0000083 3300046471 Bacteria 237725
337 Ga0495650_0000207 3300046471 Bacteria 127568
338 Ga0495650_0000247 3300046471 Bacteria 106616
339 Ga0495650_0003092 3300046471 Bacteria 12487
340 Ga0495584_0003917 3300046491 Bacteria 8047
341 Ga0495585_0000031 3300046492 Bacteria 143899
342 Ga0495585_0001044 3300046492 Bacteria 22944
343 Ga0495607_0006578 3300046501 Bacteria 8162
344 Ga0495607_0034730 3300046501 Bacteria 3057
345 Ga0495583_0001697 3300046506 Bacteria 21264
346 Ga0495583_0004955 3300046506 Bacteria 9245
347 Ga0495583_0011814 3300046506 Bacteria 4991
348 Ga0495583_0043650 3300046506 Bacteria 2086
349 Ga0495606_0000020 3300046507 Bacteria 274490
350 Ga0495606_0004821 3300046507 Bacteria 13251
351 Ga0495606_0009458 3300046507 Bacteria 8247
352 Ga0495606_0130741 3300046507 Bacteria 1493
353 Ga0495610_0000140 3300046512 Bacteria 80219
354 Ga0495610_0000365 3300046512 Bacteria 47274
355 Ga0495610_0017609 3300046512 Bacteria 4067
356 Ga0495610_0068592 3300046512 Bacteria 1661
357 Ga0495616_0000385 3300046513 Bacteria 34392
358 Ga0495616_0000460 3300046513 Bacteria 30949
359 Ga0495616_0003951 3300046513 Bacteria 9442
360 Ga0495620_0012404 3300046515 Bacteria 4403
361 Ga0495631_0002177 3300046518 Bacteria 11311
362 Ga0495631_0022976 3300046518 Bacteria 2895
363 Ga0495631_0082114 3300046518 Bacteria 1390
364 Ga0495632_0000997 3300046519 Bacteria 24718
365 Ga0495632_0037439 3300046519 Bacteria 2462
366 Ga0495632_0042258 3300046519 Bacteria 2285
367 Ga0495637_0006086 3300046520 Bacteria 6082
368 Ga0495637_0006350 3300046520 Bacteria 5941
369 Ga0495643_0000619 3300046522 Bacteria 42328
370 Ga0495648_0000097 3300046524 Bacteria 109887
371 Ga0495648_0004007 3300046524 Bacteria 12728
372 Ga0495648_0095735 3300046524 Bacteria 1651
373 Ga0495663_0000245 3300046525 Bacteria 21455
374 Ga0495652_0079599 3300046529 Bacteria 2709
375 Ga0495654_0000016 3300046530 Bacteria 306416
376 Ga0495654_0000186 3300046530 Bacteria 60912
377 Ga0495609_0027297 3300046538 Bacteria 2610
378 Ga0495645_0031646 3300046543 Unclassified 3856
379 Ga0495633_0002574 3300046558 Bacteria 12703
380 Ga0495633_0005632 3300046558 Bacteria 7595
381 Ga0495633_0033864 3300046558 Bacteria 2460
382 Ga0495668_0000056 3300046616 Bacteria 197862
383 Ga0495668_0003804 3300046616 Bacteria 11061
384 Ga0495668_0005752 3300046616 Bacteria 8287
385 Ga0495611_0001160 3300046648 Bacteria 13758
386 Ga0495611_0007848 3300046648 Bacteria 4531
387 Ga0495625_0000009 3300046660 Bacteria 404954
388 Ga0495625_0000051 3300046660 Bacteria 193325
389 Ga0495625_0000496 3300046660 Bacteria 58853
390 Ga0495625_0001046 3300046660 Bacteria 36303
391 Ga0495625_0005567 3300046660 Bacteria 11424
392 Ga0495625_0007394 3300046660 Bacteria 9569
393 Ga0495625_0009250 3300046660 Bacteria 8268
394 Ga0495625_0012093 3300046660 Bacteria 7003
395 Ga0495625_0014594 3300046660 Bacteria 6260
396 Ga0495625_0017368 3300046660 Bacteria 5634
397 Ga0495625_0041863 3300046660 Bacteria 3332
398 Ga0495625_0048192 3300046660 Bacteria 3069
399 Ga0495661_0053221 3300046665 Bacteria 2435
400 Ga0495669_0000023 3300046684 Bacteria 117158
401 Ga0495670_0000014 3300046691 Bacteria 138993
402 Ga0495670_0046337 3300046691 Bacteria 2172
403 Ga0495670_0050554 3300046691 Bacteria 2081
404 Ga0495671_0068703 3300046692 Bacteria 1742
405 Ga0495649_0000008 3300046694 Bacteria 483706
406 Ga0495589_0016617 3300046794 Bacteria 3780
407 Ga0495660_0045093 3300046810 Bacteria 2422
408 Ga0495660_0052332 3300046810 Bacteria 2218
409 Ga0495660_0113319 3300046810 Bacteria 1381
410 Ga0495672_0000782 3300047320 Bacteria 34487
411 Ga0495672_0001504 3300047320 Bacteria 22843
412 Ga0495672_0035263 3300047320 Bacteria 3082
413 Ga0495683_0013006 3300047323 Bacteria 4360
414 Ga0495687_000076 3300047443 Bacteria 149259
415 Ga0495673_0000204 3300047469 Bacteria 89887
416 Ga0495673_0000334 3300047469 Bacteria 60299
417 Ga0495673_0005450 3300047469 Bacteria 7689
418 Ga0495681_0002609 3300047470 Bacteria 12798
419 Ga0495681_0009568 3300047470 Bacteria 5954
420 Ga0495686_0000161 3300047472 Bacteria 126951
421 Ga0495686_0000615 3300047472 Bacteria 49221
422 Ga0495686_0002246 3300047472 Bacteria 18625
423 Ga0496102_0000261 3300048905 Bacteria 67440
424 Ga0496103_0000052 3300048906 Bacteria 149437
425 Ga0496104_0015227 3300048907 Bacteria 6963
426 Ga0496105_0000173 3300048908 Bacteria 42940
427 Ga0496107_0000645 3300048910 Bacteria 19616
428 Ga0496107_0028471 3300048910 Bacteria 3971
429 Ga0496110_0002413 3300048913 Bacteria 13991
430 Ga0496111_0009793 3300048914 Bacteria 6407
431 Ga0496115_0000086 3300048918 Bacteria 86625
432 Ga0496115_0007757 3300048918 Bacteria 7915
433 Ga0496116_0003600 3300048919 Bacteria 15236
434 Ga0496117_0000141 3300048920 Bacteria 158041
435 Ga0496118_0000103 3300048921 Bacteria 158099
436 Ga0496118_0031872 3300048921 Bacteria 4358
437 Ga0496118_0039092 3300048921 Bacteria 3791
438 Ga0496118_0067315 3300048921 Bacteria 2608
439 Ga0496118_0071059 3300048921 Bacteria 2508
440 Ga0496119_0008218 3300048922 Bacteria 9226
441 Ga0496119_0046921 3300048922 Bacteria 2692
442 Ga0496120_0010715 3300048923 Bacteria 6362
443 Ga0496120_0074493 3300048923 Bacteria 1854
444 Ga0496121_0000156 3300048924 Bacteria 149376
445 Ga0496121_0000515 3300048924 Bacteria 73665
446 Ga0496121_0000837 3300048924 Bacteria 55803
447 Ga0496121_0001621 3300048924 Bacteria 37294
448 Ga0496121_0002051 3300048924 Bacteria 31889
449 Ga0496121_0020797 3300048924 Bacteria 6469
450 Ga0496121_0022399 3300048924 Bacteria 6134
451 Ga0496122_0000049 3300048925 Bacteria 268493
452 Ga0496122_0005013 3300048925 Bacteria 16020
453 Ga0496123_0000042 3300048926 Bacteria 254481
454 Ga0496123_0011085 3300048926 Bacteria 7866
455 Ga0496124_0000041 3300048927 Bacteria 303887
456 Ga0496125_0000816 3300048928 Bacteria 50685
457 Ga0496125_0012791 3300048928 Bacteria 8296
458 Ga0496125_0041002 3300048928 Bacteria 3964
459 Ga0496126_0000155 3300048929 Bacteria 158816
460 Ga0496126_0002266 3300048929 Bacteria 26518
461 Ga0496126_0031340 3300048929 Bacteria 5026
462 Ga0496126_0069812 3300048929 Bacteria 3132
463 Ga0495678_000571 3300049459 Bacteria 35053
464 Ga0495678_015330 3300049459 Bacteria 3530
465 Ga0501033_0002682 3300049570 Bacteria 14944
466 Ga0501033_0063630 3300049570 Bacteria 2715
467 Ga0501034_0003664 3300049571 Bacteria 17373
468 Ga0501037_0036473 3300049573 Bacteria 3623
469 Ga0501043_0147029 3300049579 Bacteria 1845
470 Ga0501044_0002767 3300049823 Bacteria 19968
471 Ga0501044_0003966 3300049823 Bacteria 16575
472 Ga0501044_0040228 3300049823 Bacteria 4873
473 nmdc:mga0k408_8739_c1 3300050493 Bacteria 5449
474 Ga0495601_0067802 3300053077 Bacteria 2273
475 Ga0500610_0000116 3300053079 Bacteria 24225
476 Ga0500644_0000245 3300053088 Bacteria 30821
477 Ga0500566_0002505 3300053094 Bacteria 10913
478 Ga0500554_008107 3300053102 Bacteria 2452
479 Ga0500556_0001013 3300053104 Bacteria 14773
480 Ga0500569_002311 3300053109 Bacteria 3737
481 Ga0500594_0000331 3300053118 Bacteria 10607
482 Ga0500595_000256 3300053119 Bacteria 35290
483 Ga0500614_004736 3300053123 Bacteria 2862
484 Ga0500618_000145 3300053125 Bacteria 58724
485 Ga0500642_0002671 3300053130 Bacteria 5272
486 Ga0500658_0000562 3300053134 Bacteria 15628
487 Ga0500658_0036244 3300053134 Bacteria 1956
488 Ga0500559_0000007 3300053136 Bacteria 226236
489 Ga0500559_0000924 3300053136 Bacteria 18627
490 Ga0500559_0039838 3300053136 Bacteria 2045
491 Ga0500564_000064 3300053138 Bacteria 28288
492 Ga0500568_0011087 3300053139 Bacteria 4199
493 Ga0500616_0054434 3300053153 Bacteria 2096
494 Ga0500619_008177 3300053154 Bacteria 2525
495 Ga0500622_0000261 3300053156 Bacteria 53821
496 Ga0500622_0005430 3300053156 Bacteria 7661
497 Ga0500622_0010234 3300053156 Bacteria 5155
498 Ga0500627_0000276 3300053158 Bacteria 14635
499 Ga0500627_0015190 3300053158 Bacteria 2969
500 Ga0500636_0001285 3300053177 Bacteria 13628
501 Ga0500645_000003 3300053730 Bacteria 305887
502 Ga0500645_001543 3300053730 Bacteria 11501
503 Ga0500609_000442 3300053731 Bacteria 6157
504 Ga0466962_0011701 3300061719 Bacteria 4224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042005 Ga0439448_0001461 Ga0439448_0001461_5084_6091 324
2 3300003322 rootL2_10023886 rootL2_100238863 333
3 3300046692 Ga0495671_0068703 Ga0495671_0068703_16_1110 347
4 3300049459 Ga0495678_015330 Ga0495678_015330_1801_3036 365
5 3300046460 Ga0495638_0020473 Ga0495638_0020473_12_1163 366
6 3300049571 Ga0501034_0003664 Ga0501034_0003664_10242_11522 368
7 3300053156 Ga0500622_0010234 Ga0500622_0010234_3091_4386 368
8 3300047320 Ga0495672_0035263 Ga0495672_0035263_66_1361 369
9 3300053139 Ga0500568_0011087 Ga0500568_0011087_2286_3581 369
10 3300053177 Ga0500636_0001285 Ga0500636_0001285_4432_5700 371
11 3300021361 Ga0213872_10001198 Ga0213872_1000119813 373
12 3300039447 Ga0436361_0143236 Ga0436361_0143236_24752_25960 373
13 3300046459 Ga0495629_0067794 Ga0495629_0067794_167_1435 373
14 3300053154 Ga0500619_008177 Ga0500619_008177_293_1561 373
15 3300013306 Ga0163162_10294884 Ga0163162_102948841 374
16 3300003214 JGI25165J46597_1000007 JGI25165J46597_1000007297 375
17 3300025261 Ga0209233_1000026 Ga0209233_1000026299 375
18 3300053119 Ga0500595_000256 Ga0500595_000256_17803_19071 376
19 3300053156 Ga0500622_0005430 Ga0500622_0005430_990_2285 378
20 3300005563 Ga0068855_100000183 Ga0068855_10000018348 379
21 3300025949 Ga0207667_10000007 Ga0207667_10000007551 379
22 3300047472 Ga0495686_0002246 Ga0495686_0002246_3609_4916 379
23 3300044765 Ga0466970_0009612 Ga0466970_0009612_959_2263 380
24 3300046471 Ga0495650_0003092 Ga0495650_0003092_434_1750 382
25 3300046520 Ga0495637_0006350 Ga0495637_0006350_3222_4538 382
26 3300046558 Ga0495633_0002574 Ga0495633_0002574_7012_8277 382
27 3300048924 Ga0496121_0020797 Ga0496121_0020797_3995_5215 382
28 3300001989 JGI24739J22299_10023614 JGI24739J22299_100236142 383
29 3300005563 Ga0068855_100139209 Ga0068855_1001392092 383
30 3300017792 Ga0163161_10025681 Ga0163161_100256812 383
31 3300025919 Ga0207657_10111766 Ga0207657_101117661 383
32 3300026121 Ga0207683_10079167 Ga0207683_100791673 383
33 3300041459 Ga0451800_1324369 Ga0451800_1324369_172_1437 383
34 3300041486 Ga0451807_1741878 Ga0451807_1741878_4468_5736 384
35 3300047472 Ga0495686_0000615 Ga0495686_0000615_10172_11362 384
36 3300048921 Ga0496118_0071059 Ga0496118_0071059_207_1397 384
37 3300049570 Ga0501033_0063630 Ga0501033_0063630_1440_2630 384
38 3300049579 Ga0501043_0147029 Ga0501043_0147029_631_1821 384
39 3300046660 Ga0495625_0041863 Ga0495625_0041863_789_2054 385
40 3300046691 Ga0495670_0050554 Ga0495670_0050554_758_2023 385
41 3300005328 Ga0070676_10023350 Ga0070676_100233503 387
42 3300005356 Ga0070674_100015548 Ga0070674_1000155482 387
43 3300005364 Ga0070673_100072152 Ga0070673_1000721523 387
44 3300005548 Ga0070665_100051841 Ga0070665_1000518414 387
45 3300025933 Ga0207706_10046770 Ga0207706_100467704 387
46 3300025937 Ga0207669_10000501 Ga0207669_1000050120 387
47 3300025960 Ga0207651_10010868 Ga0207651_100108682 387
48 3300028379 Ga0268266_10037280 Ga0268266_100372803 387
49 3300046471 Ga0495650_0000083 Ga0495650_0000083_200844_202112 387
50 3300046491 Ga0495584_0003917 Ga0495584_0003917_1031_2296 387
51 3300046506 Ga0495583_0001697 Ga0495583_0001697_8808_10076 387
52 3300046506 Ga0495583_0011814 Ga0495583_0011814_2908_4173 387
53 3300046518 Ga0495631_0002177 Ga0495631_0002177_8149_9414 387
54 3300046616 Ga0495668_0000056 Ga0495668_0000056_66541_67806 387
55 3300046648 Ga0495611_0001160 Ga0495611_0001160_9295_10560 387
56 3300046660 Ga0495625_0007394 Ga0495625_0007394_2952_4217 387
57 3300046684 Ga0495669_0000023 Ga0495669_0000023_103295_104560 387
58 3300046810 Ga0495660_0045093 Ga0495660_0045093_212_1477 387
59 3300047443 Ga0495687_000076 Ga0495687_000076_98298_99563 387
60 3300047470 Ga0495681_0002609 Ga0495681_0002609_155_1420 387
61 3300053079 Ga0500610_0000116 Ga0500610_0000116_10334_11599 387
62 3300001915 JGI24741J21665_1000192 JGI24741J21665_100019214 388
63 3300001979 JGI24740J21852_10001303 JGI24740J21852_1000130312 388
64 3300001979 JGI24740J21852_10004569 JGI24740J21852_100045694 388
65 3300001989 JGI24739J22299_10009252 JGI24739J22299_100092523 388
66 3300001989 JGI24739J22299_10022531 JGI24739J22299_100225312 388
67 3300001990 JGI24737J22298_10001431 JGI24737J22298_100014315 388
68 3300002067 JGI24735J21928_10009552 JGI24735J21928_100095523 388
69 3300005327 Ga0070658_10005243 Ga0070658_100052439 388
70 3300005339 Ga0070660_100003037 Ga0070660_1000030376 388
71 3300005339 Ga0070660_100042830 Ga0070660_1000428301 388
72 3300005339 Ga0070660_100186332 Ga0070660_1001863321 388
73 3300005344 Ga0070661_100005520 Ga0070661_1000055202 388
74 3300005366 Ga0070659_100136730 Ga0070659_1001367301 388
75 3300005455 Ga0070663_100003883 Ga0070663_1000038835 388
76 3300005457 Ga0070662_100004118 Ga0070662_1000041184 388
77 3300005539 Ga0068853_100123935 Ga0068853_1001239352 388
78 3300005563 Ga0068855_100158399 Ga0068855_1001583992 388
79 3300005564 Ga0070664_100006941 Ga0070664_1000069416 388
80 3300005578 Ga0068854_100015646 Ga0068854_1000156462 388
81 3300005834 Ga0068851_10005927 Ga0068851_100059273 388
82 3300006195 Ga0075366_10053203 Ga0075366_100532032 388
83 3300009093 Ga0105240_10376384 Ga0105240_103763841 388
84 3300009174 Ga0105241_10000496 Ga0105241_1000049624 388
85 3300009545 Ga0105237_10111200 Ga0105237_101112002 388
86 3300009551 Ga0105238_10058335 Ga0105238_100583353 388
87 3300010375 Ga0105239_10037903 Ga0105239_100379033 388
88 3300010375 Ga0105239_10110195 Ga0105239_101101952 388
89 3300010375 Ga0105239_10337372 Ga0105239_103373722 388
90 3300013100 Ga0157373_10012678 Ga0157373_100126784 388
91 3300013100 Ga0157373_10016243 Ga0157373_100162433 388
92 3300013102 Ga0157371_10002077 Ga0157371_100020775 388
93 3300013105 Ga0157369_10072322 Ga0157369_100723223 388
94 3300013105 Ga0157369_10152421 Ga0157369_101524212 388
95 3300014325 Ga0163163_10020754 Ga0163163_100207542 388
96 3300025254 Ga0209148_1000318 Ga0209148_10003185 388
97 3300025321 Ga0207656_10003316 Ga0207656_100033162 388
98 3300025904 Ga0207647_10022357 Ga0207647_100223572 388
99 3300025904 Ga0207647_10033275 Ga0207647_100332753 388
100 3300025909 Ga0207705_10000175 Ga0207705_1000017571 388
101 3300025911 Ga0207654_10000020 Ga0207654_1000002079 388
102 3300025913 Ga0207695_10011751 Ga0207695_100117519 388
103 3300025914 Ga0207671_10009369 Ga0207671_100093696 388
104 3300025919 Ga0207657_10003643 Ga0207657_100036434 388
105 3300025919 Ga0207657_10011169 Ga0207657_100111695 388
106 3300025920 Ga0207649_10000356 Ga0207649_100003564 388
107 3300025924 Ga0207694_10007150 Ga0207694_100071506 388
108 3300025932 Ga0207690_10000063 Ga0207690_100000632 388
109 3300025932 Ga0207690_10083609 Ga0207690_100836091 388
110 3300025933 Ga0207706_10003215 Ga0207706_100032154 388
111 3300025945 Ga0207679_10071198 Ga0207679_100711982 388
112 3300025949 Ga0207667_10000006 Ga0207667_10000006155 388
113 3300025981 Ga0207640_10001038 Ga0207640_100010387 388
114 3300026041 Ga0207639_10000785 Ga0207639_1000078511 388
115 3300026067 Ga0207678_10000225 Ga0207678_100002255 388
116 3300026078 Ga0207702_10002347 Ga0207702_100023477 388
117 3300026116 Ga0207674_10008800 Ga0207674_1000880010 388
118 3300026142 Ga0207698_10005364 Ga0207698_100053646 388
119 3300038443 Ga0395901_0081093 Ga0395901_0081093_790_1998 388
120 3300042012 Ga0439455_0000189 Ga0439455_0000189_1756_2964 388
121 3300046524 Ga0495648_0095735 Ga0495648_0095735_51_1319 388
122 3300046558 Ga0495633_0033864 Ga0495633_0033864_723_1964 388
123 3300053730 Ga0500645_000003 Ga0500645_000003_200177_201442 388
124 3300003762 Ga0055542_1000012 Ga0055542_1000012351 389
125 3300003763 Ga0055529_1000002 Ga0055529_1000002267 389
126 3300003763 Ga0055529_1000021 Ga0055529_1000021214 389
127 3300025254 Ga0209148_1000008 Ga0209148_1000008984 389
128 3300025272 Ga0209455_1000002 Ga0209455_1000002441 389
129 3300046492 Ga0495585_0001044 Ga0495585_0001044_20274_21650 389
130 3300046507 Ga0495606_0009458 Ga0495606_0009458_1679_2944 389
131 3300046522 Ga0495643_0000619 Ga0495643_0000619_38374_39639 389
132 3300046660 Ga0495625_0000496 Ga0495625_0000496_46751_48127 389
133 3300047323 Ga0495683_0013006 Ga0495683_0013006_2776_4041 389
134 3300053130 Ga0500642_0002671 Ga0500642_0002671_3492_4757 389
135 3300025246 Ga0209646_1007687 Ga0209646_10076872 390
136 3300046501 Ga0495607_0006578 Ga0495607_0006578_4175_5401 390
137 3300046506 Ga0495583_0004955 Ga0495583_0004955_2257_3522 390
138 3300046525 Ga0495663_0000245 Ga0495663_0000245_15627_16892 390
139 3300046648 Ga0495611_0007848 Ga0495611_0007848_1801_3066 390
140 3300046660 Ga0495625_0048192 Ga0495625_0048192_902_2167 390
141 3300048905 Ga0496102_0000261 Ga0496102_0000261_26074_27339 390
142 3300048906 Ga0496103_0000052 Ga0496103_0000052_41004_42269 390
143 3300048907 Ga0496104_0015227 Ga0496104_0015227_437_1702 390
144 3300048908 Ga0496105_0000173 Ga0496105_0000173_13342_14607 390
145 3300048910 Ga0496107_0028471 Ga0496107_0028471_2355_3620 390
146 3300048913 Ga0496110_0002413 Ga0496110_0002413_7949_9214 390
147 3300048914 Ga0496111_0009793 Ga0496111_0009793_1196_2461 390
148 3300048918 Ga0496115_0000086 Ga0496115_0000086_26021_27286 390
149 3300048919 Ga0496116_0003600 Ga0496116_0003600_3311_4576 390
150 3300048920 Ga0496117_0000141 Ga0496117_0000141_115772_117037 390
151 3300048921 Ga0496118_0000103 Ga0496118_0000103_115830_117095 390
152 3300048922 Ga0496119_0008218 Ga0496119_0008218_6435_7700 390
153 3300048923 Ga0496120_0010715 Ga0496120_0010715_2891_4156 390
154 3300048924 Ga0496121_0000156 Ga0496121_0000156_40986_42251 390
155 3300048925 Ga0496122_0005013 Ga0496122_0005013_7920_9185 390
156 3300048926 Ga0496123_0011085 Ga0496123_0011085_1885_3150 390
157 3300048927 Ga0496124_0000041 Ga0496124_0000041_42877_44142 390
158 3300048929 Ga0496126_0000155 Ga0496126_0000155_115824_117089 390
159 3300003791 Ga0055530_10000061 Ga0055530_1000006113 391
160 3300003794 Ga0055531_10000035 Ga0055531_1000003545 391
161 3300025298 Ga0209050_1000014 Ga0209050_1000014407 391
162 3300025304 Ga0209257_1000019 Ga0209257_1000019285 391
163 3300046507 Ga0495606_0130741 Ga0495606_0130741_53_1261 391
164 iso_pu_bacteria 2512564014 2512644818 391
165 3300042005 Ga0439448_0000804 Ga0439448_0000804_2936_4198 392
166 3300042012 Ga0439455_0000568 Ga0439455_0000568_1655_2917 392
167 3300042157 Ga0439458_0000013 Ga0439458_0000013_7834_9096 392
168 3300046524 Ga0495648_0000097 Ga0495648_0000097_63163_64428 392
169 3300048921 Ga0496118_0031872 Ga0496118_0031872_1825_3051 392
170 3300048922 Ga0496119_0046921 Ga0496119_0046921_386_1612 392
171 3300053136 Ga0500559_0039838 Ga0500559_0039838_58_1278 392
172 3300005335 Ga0070666_10036326 Ga0070666_100363263 393
173 3300025903 Ga0207680_10076134 Ga0207680_100761342 393
174 3300025937 Ga0207669_10008254 Ga0207669_100082545 393
175 3300048923 Ga0496120_0074493 Ga0496120_0074493_516_1748 393
176 3300005578 Ga0068854_100009744 Ga0068854_1000097442 394
177 3300009093 Ga0105240_10012894 Ga0105240_1001289412 394
178 3300009093 Ga0105240_10021853 Ga0105240_100218533 394
179 3300009545 Ga0105237_10002423 Ga0105237_100024239 394
180 3300010375 Ga0105239_10000024 Ga0105239_1000002451 394
181 3300025913 Ga0207695_10015761 Ga0207695_100157613 394
182 3300025913 Ga0207695_10018838 Ga0207695_100188383 394
183 3300025914 Ga0207671_10006292 Ga0207671_100062922 394
184 3300025931 Ga0207644_10116877 Ga0207644_101168772 394
185 3300025981 Ga0207640_10006146 Ga0207640_100061463 394
186 3300048921 Ga0496118_0039092 Ga0496118_0039092_1784_3022 394
187 3300048924 Ga0496121_0000515 Ga0496121_0000515_10321_11559 394
188 3300048924 Ga0496121_0000837 Ga0496121_0000837_43310_44551 394
189 3300048929 Ga0496126_0031340 Ga0496126_0031340_3264_4502 394
190 3300049823 Ga0501044_0040228 Ga0501044_0040228_182_1417 394
191 3300041404 Ga0439436_0023306 Ga0439436_0023306_26_1336 396
192 3300041406 Ga0439439_0017169 Ga0439439_0017169_212_1522 396
193 3300041413 Ga0439465_0015154 Ga0439465_0015154_502_1812 396
194 3300042435 Ga0439434_0012467 Ga0439434_0012467_715_2025 396
195 3300046471 Ga0495650_0000247 Ga0495650_0000247_61457_62719 396
196 3300046513 Ga0495616_0003951 Ga0495616_0003951_8143_9387 396
197 3300046538 Ga0495609_0027297 Ga0495609_0027297_1339_2583 396
198 3300046660 Ga0495625_0000009 Ga0495625_0000009_143163_144407 396
199 3300046694 Ga0495649_0000008 Ga0495649_0000008_104682_105926 396
200 3300046810 Ga0495660_0113319 Ga0495660_0113319_95_1339 396
201 3300009551 Ga0105238_10000688 Ga0105238_100006882 397
202 3300013306 Ga0163162_10000281 Ga0163162_1000028124 397
203 3300044656 Ga0466969_0014302 Ga0466969_0014302_2915_4132 397
204 3300048924 Ga0496121_0022399 Ga0496121_0022399_1900_3162 397
205 3300048928 Ga0496125_0041002 Ga0496125_0041002_2272_3534 397
206 3300048929 Ga0496126_0002266 Ga0496126_0002266_10859_12121 397
207 3300049823 Ga0501044_0002767 Ga0501044_0002767_1121_2344 397
208 3300053125 Ga0500618_000145 Ga0500618_000145_10703_12010 397
209 3300053136 Ga0500559_0000924 Ga0500559_0000924_12273_13580 397
210 3300031507 Ga0307509_10000152 Ga0307509_1000015222 398
211 3300005356 Ga0070674_100006094 Ga0070674_1000060946 399
212 3300005456 Ga0070678_100000254 Ga0070678_10000025417 399
213 3300009148 Ga0105243_10000441 Ga0105243_1000044127 399
214 3300011119 Ga0105246_10118733 Ga0105246_101187332 399
215 3300025907 Ga0207645_10040505 Ga0207645_100405052 399
216 3300025935 Ga0207709_10000093 Ga0207709_1000009328 399
217 3300025937 Ga0207669_10003631 Ga0207669_100036314 399
218 3300026121 Ga0207683_10000181 Ga0207683_100001813 399
219 3300003316 rootH1_10044186 rootH1_100441863 400
220 3300003320 rootH2_10054415 rootH2_100544153 400
221 3300003322 rootL2_10204688 rootL2_102046882 400
222 3300003323 rootH1_10089880 rootH1_100898803 400
223 3300003759 Ga0055525_1000096 Ga0055525_100009653 400
224 3300005435 Ga0070714_100027069 Ga0070714_1000270691 400
225 3300005436 Ga0070713_100001768 Ga0070713_1000017682 400
226 3300025226 Ga0209674_100898 Ga0209674_1008987 400
227 3300025230 Ga0209563_100058 Ga0209563_10005870 400
228 3300025304 Ga0209257_1000457 Ga0209257_100045726 400
229 3300025928 Ga0207700_10001549 Ga0207700_1000154910 400
230 3300025929 Ga0207664_10027619 Ga0207664_100276193 400
231 3300005344 Ga0070661_100005388 Ga0070661_1000053882 401
232 3300053134 Ga0500658_0000562 Ga0500658_0000562_13189_14499 401
233 3300003323 rootH1_10013002 rootH1_100130023 402
234 3300005262 Ga0065165_1007383 Ga0065165_10073834 402
235 3300046691 Ga0495670_0000014 Ga0495670_0000014_135279_136535 402
236 3300005331 Ga0070670_100140068 Ga0070670_1001400682 403
237 3300005354 Ga0070675_100059763 Ga0070675_1000597633 403
238 3300005355 Ga0070671_100104590 Ga0070671_1001045902 403
239 3300005367 Ga0070667_100082993 Ga0070667_1000829932 403
240 3300005456 Ga0070678_100062701 Ga0070678_1000627012 403
241 3300005616 Ga0068852_100134508 Ga0068852_1001345082 403
242 3300005618 Ga0068864_100074518 Ga0068864_1000745183 403
243 3300013297 Ga0157378_10269795 Ga0157378_102697951 403
244 3300025907 Ga0207645_10053332 Ga0207645_100533322 403
245 3300025986 Ga0207658_10105797 Ga0207658_101057972 403
246 3300026121 Ga0207683_10010154 Ga0207683_100101544 403
247 3300053094 Ga0500566_0002505 Ga0500566_0002505_6550_7842 403
248 3300033180 Ga0307510_10010353 Ga0307510_100103534 404
249 3300042876 Ga0451577_0212166 Ga0451577_0212166_94_1359 404
250 3300044712 Ga0453684_0022721 Ga0453684_0022721_2161_3426 404
251 3300053136 Ga0500559_0000007 Ga0500559_0000007_167534_168847 404
252 3300002741 JGI25157J39369_1000688 JGI25157J39369_100068813 405
253 3300005327 Ga0070658_10008238 Ga0070658_100082384 405
254 3300005335 Ga0070666_10000005 Ga0070666_1000000552 405
255 3300005367 Ga0070667_100033528 Ga0070667_1000335284 405
256 3300005548 Ga0070665_100039006 Ga0070665_1000390063 405
257 3300025250 Ga0209026_1000010 Ga0209026_1000010104 405
258 3300025903 Ga0207680_10000005 Ga0207680_10000005408 405
259 3300025909 Ga0207705_10012504 Ga0207705_100125044 405
260 3300025920 Ga0207649_10068786 Ga0207649_100687863 405
261 3300025924 Ga0207694_10001048 Ga0207694_1000104817 405
262 3300025986 Ga0207658_10030157 Ga0207658_100301572 405
263 3300026121 Ga0207683_10298002 Ga0207683_102980021 405
264 3300028379 Ga0268266_10000004 Ga0268266_100000041122 405
265 3300041410 Ga0439461_0000938 Ga0439461_0000938_1010_2311 405
266 3300041413 Ga0439465_0000889 Ga0439465_0000889_7925_9226 405
267 3300041997 Ga0439431_0000346 Ga0439431_0000346_494_1795 405
268 3300042006 Ga0439432_011589 Ga0439432_011589_619_1920 405
269 3300042010 Ga0439452_015383 Ga0439452_015383_723_2024 405
270 3300042015 Ga0439462_0000664 Ga0439462_0000664_474_1775 405
271 3300042435 Ga0439434_0002510 Ga0439434_0002510_3020_4321 405
272 3300044672 Ga0466982_0000013 Ga0466982_0000013_19789_21093 405
273 3300044706 Ga0466964_0003523 Ga0466964_0003523_869_2173 405
274 3300044719 Ga0466971_0010842 Ga0466971_0010842_2577_3881 405
275 3300044735 Ga0466968_0024342 Ga0466968_0024342_535_1839 405
276 3300044901 Ga0466960_0003521 Ga0466960_0003521_3378_4682 405
277 3300045836 Ga0466958_0037486 Ga0466958_0037486_523_1827 405
278 3300061719 Ga0466962_0011701 Ga0466962_0011701_2264_3568 405
279 3300009093 Ga0105240_10089162 Ga0105240_100891623 406
280 3300032005 Ga0307411_10102895 Ga0307411_101028951 407
281 3300048918 Ga0496115_0007757 Ga0496115_0007757_989_2263 407
282 3300003316 rootH1_10001690 rootH1_100016902 408
283 3300003316 rootH1_10015253 rootH1_100152534 408
284 3300005367 Ga0070667_100028348 Ga0070667_1000283483 408
285 3300005563 Ga0068855_100173765 Ga0068855_1001737652 408
286 3300005577 Ga0068857_100116882 Ga0068857_1001168822 408
287 3300005841 Ga0068863_100000780 Ga0068863_1000007804 408
288 3300005843 Ga0068860_100000330 Ga0068860_10000033020 408
289 3300009545 Ga0105237_10030583 Ga0105237_100305832 408
290 3300025903 Ga0207680_10006048 Ga0207680_100060483 408
291 3300025986 Ga0207658_10036866 Ga0207658_100368662 408
292 3300026078 Ga0207702_10055769 Ga0207702_100557693 408
293 3300026088 Ga0207641_10000135 Ga0207641_1000013521 408
294 3300028381 Ga0268264_10000081 Ga0268264_1000008130 408
295 3300005543 Ga0070672_100007102 Ga0070672_1000071025 409
296 3300013296 Ga0157374_10083234 Ga0157374_100832342 409
297 3300025940 Ga0207691_10089487 Ga0207691_100894872 409
298 3300025949 Ga0207667_10134146 Ga0207667_101341462 409
299 3300026067 Ga0207678_10077065 Ga0207678_100770653 409
300 3300033180 Ga0307510_10012691 Ga0307510_100126916 409
301 3300049570 Ga0501033_0002682 Ga0501033_0002682_6478_7782 409
302 3300049573 Ga0501037_0036473 Ga0501037_0036473_1741_3045 409
303 3300049823 Ga0501044_0003966 Ga0501044_0003966_7993_9297 409
304 iso_pu_bacteria 2599185184 2599476906 409
305 iso_pu_bacteria 2928078545 2928078817 409
306 iso_pu_bacteria 2928147474 2928151505 409
307 iso_pu_bacteria 2932082852 2932085476 409
308 3300031456 Ga0307513_10038831 Ga0307513_100388313 411
309 3300009093 Ga0105240_10030686 Ga0105240_100306865 412
310 3300009551 Ga0105238_10238408 Ga0105238_102384082 412
311 3300009553 Ga0105249_10013876 Ga0105249_100138766 412
312 3300014325 Ga0163163_10205537 Ga0163163_102055371 412
313 3300053109 Ga0500569_002311 Ga0500569_002311_337_1608 412
314 3300001989 JGI24739J22299_10010558 JGI24739J22299_100105583 413
315 3300001990 JGI24737J22298_10000478 JGI24737J22298_1000047812 413
316 3300002067 JGI24735J21928_10000006 JGI24735J21928_10000006116 413
317 3300003316 rootH1_10025334 rootH1_100253345 413
318 3300003322 rootL2_10056736 rootL2_100567365 413
319 3300003322 rootL2_10074859 rootL2_100748592 413
320 3300003323 rootH1_10013001 rootH1_100130014 413
321 3300005563 Ga0068855_100001262 Ga0068855_1000012627 413
322 3300006195 Ga0075366_10059558 Ga0075366_100595582 413
323 3300013105 Ga0157369_10135493 Ga0157369_101354932 413
324 3300013307 Ga0157372_10037265 Ga0157372_100372653 413
325 3300025913 Ga0207695_10117580 Ga0207695_101175802 413
326 3300025949 Ga0207667_10000486 Ga0207667_1000048623 413
327 3300025981 Ga0207640_10000042 Ga0207640_100000426 413
328 3300046471 Ga0495650_0000014 Ga0495650_0000014_482912_484210 413
329 3300046492 Ga0495585_0000031 Ga0495585_0000031_42552_43850 413
330 3300046506 Ga0495583_0043650 Ga0495583_0043650_671_1969 413
331 3300046507 Ga0495606_0000020 Ga0495606_0000020_84227_85525 413
332 3300046512 Ga0495610_0017609 Ga0495610_0017609_2287_3585 413
333 3300046512 Ga0495610_0068592 Ga0495610_0068592_172_1470 413
334 3300046529 Ga0495652_0079599 Ga0495652_0079599_1386_2684 413
335 3300046558 Ga0495633_0005632 Ga0495633_0005632_835_2133 413
336 3300046665 Ga0495661_0053221 Ga0495661_0053221_305_1603 413
337 3300050493 nmdc:mga0k408_8739_c1 nmdc:mga0k408_8739_c1_672_1970 413
338 iso_pu_bacteria 2582581280 2585153303 413
339 iso_pu_bacteria 2582581293 2585196992 413
340 iso_pu_bacteria 2643221545 2643746975 413
341 iso_pu_bacteria 2643221552 2643778917 413
342 iso_pu_bacteria 2643221584 2643930563 413
343 iso_pu_bacteria 2643221691 2644507818 413
344 iso_pu_bacteria 2818991435 2819539220 413
345 iso_pu_bacteria 2818991454 2819648265 413
346 3300028794 Ga0307515_10151927 Ga0307515_101519272 414
347 3300033180 Ga0307510_10005829 Ga0307510_1000582915 414
348 3300045049 Ga0466959_0011104 Ga0466959_0011104_3748_5016 414
349 3300046471 Ga0495650_0000020 Ga0495650_0000020_26297_27604 414
350 3300046513 Ga0495616_0000460 Ga0495616_0000460_10653_11960 414
351 3300046518 Ga0495631_0022976 Ga0495631_0022976_181_1488 414
352 3300046524 Ga0495648_0004007 Ga0495648_0004007_5832_7139 414
353 3300046530 Ga0495654_0000186 Ga0495654_0000186_4383_5690 414
354 3300046616 Ga0495668_0003804 Ga0495668_0003804_5312_6619 414
355 3300046660 Ga0495625_0001046 Ga0495625_0001046_15290_16597 414
356 3300046660 Ga0495625_0014594 Ga0495625_0014594_2206_3513 414
357 3300046794 Ga0495589_0016617 Ga0495589_0016617_762_2069 414
358 3300047469 Ga0495673_0000204 Ga0495673_0000204_37728_39035 414
359 3300047469 Ga0495673_0000334 Ga0495673_0000334_55100_56407 414
360 3300047469 Ga0495673_0005450 Ga0495673_0005450_2244_3551 414
361 3300047470 Ga0495681_0009568 Ga0495681_0009568_2712_4019 414
362 3300053088 Ga0500644_0000245 Ga0500644_0000245_19837_21144 414
363 3300053134 Ga0500658_0036244 Ga0500658_0036244_148_1455 414
364 3300053138 Ga0500564_000064 Ga0500564_000064_17332_18639 414
365 3300053158 Ga0500627_0000276 Ga0500627_0000276_9677_10984 414
366 3300033180 Ga0307510_10000061 Ga0307510_1000006154 415
367 3300047472 Ga0495686_0000161 Ga0495686_0000161_112884_114170 416
368 3300048910 Ga0496107_0000645 Ga0496107_0000645_9656_10963 416
369 3300048924 Ga0496121_0001621 Ga0496121_0001621_22048_23355 416
370 3300003775 Ga0055524_1019189 Ga0055524_10191892 417
371 3300003790 Ga0055528_1011022 Ga0055528_10110222 417
372 3300003794 Ga0055531_10003135 Ga0055531_100031357 417
373 3300005262 Ga0065165_1000660 Ga0065165_10006604 417
374 3300005548 Ga0070665_100013154 Ga0070665_1000131545 417
375 3300025263 Ga0209565_1000183 Ga0209565_100018349 417
376 3300025273 Ga0209673_1000848 Ga0209673_100084817 417
377 3300025273 Ga0209673_1030364 Ga0209673_10303642 417
378 3300025291 Ga0209675_1004298 Ga0209675_10042987 417
379 3300025295 Ga0209564_1001441 Ga0209564_100144113 417
380 3300025295 Ga0209564_1007091 Ga0209564_10070912 417
381 3300025297 Ga0209758_1002223 Ga0209758_100222311 417
382 3300025297 Ga0209758_1002655 Ga0209758_100265512 417
383 3300025298 Ga0209050_1005412 Ga0209050_10054124 417
384 3300025298 Ga0209050_1020702 Ga0209050_10207022 417
385 3300025299 Ga0209256_1000694 Ga0209256_100069426 417
386 3300025304 Ga0209257_1000326 Ga0209257_100032635 417
387 3300025961 Ga0207712_10042649 Ga0207712_100426493 417
388 3300028379 Ga0268266_10006593 Ga0268266_1000659310 417
389 3300028794 Ga0307515_10058107 Ga0307515_100581073 417
390 3300042438 Ga0439459_0003116 Ga0439459_0003116_360_1664 417
391 3300046457 Ga0495590_0002018 Ga0495590_0002018_7000_8316 417
392 3300046460 Ga0495638_0000230 Ga0495638_0000230_69294_70598 417
393 3300046460 Ga0495638_0014340 Ga0495638_0014340_3370_4674 417
394 3300046471 Ga0495650_0000207 Ga0495650_0000207_53140_54444 417
395 3300046501 Ga0495607_0034730 Ga0495607_0034730_796_2100 417
396 3300046507 Ga0495606_0004821 Ga0495606_0004821_6931_8235 417
397 3300046512 Ga0495610_0000140 Ga0495610_0000140_15898_17202 417
398 3300046512 Ga0495610_0000365 Ga0495610_0000365_42797_44113 417
399 3300046513 Ga0495616_0000385 Ga0495616_0000385_2354_3658 417
400 3300046515 Ga0495620_0012404 Ga0495620_0012404_639_1943 417
401 3300046518 Ga0495631_0082114 Ga0495631_0082114_46_1350 417
402 3300046519 Ga0495632_0000997 Ga0495632_0000997_18264_19568 417
403 3300046519 Ga0495632_0042258 Ga0495632_0042258_758_2062 417
404 3300046520 Ga0495637_0006086 Ga0495637_0006086_1192_2496 417
405 3300046530 Ga0495654_0000016 Ga0495654_0000016_251610_252914 417
406 3300046616 Ga0495668_0005752 Ga0495668_0005752_6707_8011 417
407 3300046660 Ga0495625_0000051 Ga0495625_0000051_136517_137815 417
408 3300046660 Ga0495625_0005567 Ga0495625_0005567_4708_6012 417
409 3300046660 Ga0495625_0009250 Ga0495625_0009250_2159_3475 417
410 3300046660 Ga0495625_0012093 Ga0495625_0012093_836_2140 417
411 3300046660 Ga0495625_0017368 Ga0495625_0017368_1028_2332 417
412 3300046691 Ga0495670_0046337 Ga0495670_0046337_275_1579 417
413 3300046810 Ga0495660_0052332 Ga0495660_0052332_120_1424 417
414 3300047320 Ga0495672_0000782 Ga0495672_0000782_29278_30582 417
415 3300047320 Ga0495672_0001504 Ga0495672_0001504_1312_2628 417
416 3300049459 Ga0495678_000571 Ga0495678_000571_31681_32997 417
417 3300053102 Ga0500554_008107 Ga0500554_008107_215_1525 417
418 3300053104 Ga0500556_0001013 Ga0500556_0001013_9633_10937 417
419 3300053118 Ga0500594_0000331 Ga0500594_0000331_2236_3552 417
420 3300053123 Ga0500614_004736 Ga0500614_004736_269_1579 417
421 3300053153 Ga0500616_0054434 Ga0500616_0054434_774_2078 417
422 3300053156 Ga0500622_0000261 Ga0500622_0000261_45424_46740 417
423 3300053158 Ga0500627_0015190 Ga0500627_0015190_1650_2954 417
424 3300053730 Ga0500645_001543 Ga0500645_001543_8084_9400 417
425 3300053731 Ga0500609_000442 Ga0500609_000442_1503_2807 417
426 3300025924 Ga0207694_10000387 Ga0207694_1000038722 418
427 iso_pu_bacteria 2849573788 2849573938 418
428 iso_pu_bacteria 2898329390 2898333665 418
429 3300002067 JGI24735J21928_10030842 JGI24735J21928_100308421 419
430 3300005335 Ga0070666_10017169 Ga0070666_100171694 419
431 3300005355 Ga0070671_100009724 Ga0070671_1000097242 419
432 3300005367 Ga0070667_100006541 Ga0070667_1000065418 419
433 3300005544 Ga0070686_100028091 Ga0070686_1000280913 419
434 3300005617 Ga0068859_100000211 Ga0068859_10000021135 419
435 3300005841 Ga0068863_100003996 Ga0068863_1000039964 419
436 3300005842 Ga0068858_100005568 Ga0068858_1000055687 419
437 3300005843 Ga0068860_100011389 Ga0068860_1000113895 419
438 3300006931 Ga0097620_100000211 Ga0097620_10000021135 419
439 3300009101 Ga0105247_10000260 Ga0105247_1000026017 419
440 3300009177 Ga0105248_10001076 Ga0105248_100010764 419
441 3300013306 Ga0163162_10105979 Ga0163162_101059792 419
442 3300014325 Ga0163163_10111745 Ga0163163_101117451 419
443 3300014968 Ga0157379_10007683 Ga0157379_100076836 419
444 3300025900 Ga0207710_10000322 Ga0207710_1000032226 419
445 3300025903 Ga0207680_10039526 Ga0207680_100395262 419
446 3300025986 Ga0207658_10006010 Ga0207658_100060102 419
447 3300026035 Ga0207703_10002171 Ga0207703_100021718 419
448 3300028381 Ga0268264_10028058 Ga0268264_100280583 419
449 3300030521 Ga0307511_10000227 Ga0307511_100002275 419
450 3300048924 Ga0496121_0002051 Ga0496121_0002051_24902_26206 419
451 3300048928 Ga0496125_0012791 Ga0496125_0012791_5987_7291 419
452 iso_pu_bacteria 2643221622 2644128815 419
453 3300003773 Ga0055537_1001600 Ga0055537_10016003 420
454 3300003775 Ga0055524_1000345 Ga0055524_100034516 420
455 3300003794 Ga0055531_10003469 Ga0055531_100034694 420
456 3300025245 Ga0207425_1007001 Ga0207425_10070012 420
457 3300025263 Ga0209565_1000008 Ga0209565_1000008270 420
458 3300025273 Ga0209673_1002083 Ga0209673_10020835 420
459 3300025297 Ga0209758_1004526 Ga0209758_10045265 420
460 3300025298 Ga0209050_1004047 Ga0209050_10040472 420
461 3300025299 Ga0209256_1000009 Ga0209256_1000009600 420
462 3300025299 Ga0209256_1000010 Ga0209256_1000010524 420
463 3300025304 Ga0209257_1003277 Ga0209257_10032776 420
464 3300009093 Ga0105240_10037706 Ga0105240_100377062 421
465 3300048921 Ga0496118_0067315 Ga0496118_0067315_836_2149 421
466 3300005535 Ga0070684_100096965 Ga0070684_1000969652 423
467 3300010375 Ga0105239_10253506 Ga0105239_102535062 423
468 3300011119 Ga0105246_10115039 Ga0105246_101150392 423
469 3300026078 Ga0207702_10133831 Ga0207702_101338312 423
470 3300041460 Ga0451802_0008807 Ga0451802_0008807_453_1760 423
471 3300041509 Ga0451843_1240649 Ga0451843_1240649_553_1860 423
472 3300046543 Ga0495645_0031646 Ga0495645_0031646_724_2061 423
473 3300053077 Ga0495601_0067802 Ga0495601_0067802_579_1916 423
474 3300010375 Ga0105239_10130363 Ga0105239_101303632 424
475 3300005331 Ga0070670_100082708 Ga0070670_1000827082 425
476 3300005367 Ga0070667_100023452 Ga0070667_1000234522 425
477 3300005539 Ga0068853_100012404 Ga0068853_1000124042 425
478 3300005548 Ga0070665_100001943 Ga0070665_10000194314 425
479 3300005614 Ga0068856_100018305 Ga0068856_1000183052 425
480 3300005616 Ga0068852_100004914 Ga0068852_1000049144 425
481 3300005842 Ga0068858_100001049 Ga0068858_10000104915 425
482 3300006881 Ga0068865_100131873 Ga0068865_1001318732 425
483 3300009553 Ga0105249_10015031 Ga0105249_100150312 425
484 3300010375 Ga0105239_10033185 Ga0105239_100331852 425
485 3300013307 Ga0157372_10096307 Ga0157372_100963072 425
486 3300025913 Ga0207695_10009873 Ga0207695_100098735 425
487 3300025925 Ga0207650_10037699 Ga0207650_100376992 425
488 3300025961 Ga0207712_10031275 Ga0207712_100312753 425
489 3300025986 Ga0207658_10013372 Ga0207658_100133722 425
490 3300026035 Ga0207703_10001692 Ga0207703_100016923 425
491 3300026041 Ga0207639_10006296 Ga0207639_100062963 425
492 3300028379 Ga0268266_10000008 Ga0268266_10000008707 425
493 3300003322 rootL2_10116132 rootL2_101161324 426
494 3300009551 Ga0105238_10003502 Ga0105238_100035023 426
495 3300025914 Ga0207671_10044956 Ga0207671_100449562 426
496 3300028794 Ga0307515_10148647 Ga0307515_101486471 426
497 3300005455 Ga0070663_100116900 Ga0070663_1001169001 428
498 3300005548 Ga0070665_100021493 Ga0070665_1000214934 428
499 3300005841 Ga0068863_100000714 Ga0068863_10000071425 428
500 3300005843 Ga0068860_100000185 Ga0068860_10000018567 428
501 3300009093 Ga0105240_10013334 Ga0105240_100133346 428
502 3300011119 Ga0105246_10056925 Ga0105246_100569252 428
503 3300013307 Ga0157372_10296052 Ga0157372_102960522 428
504 3300025913 Ga0207695_10066236 Ga0207695_100662364 428
505 3300025914 Ga0207671_10037715 Ga0207671_100377153 428
506 3300025924 Ga0207694_10032768 Ga0207694_100327684 428
507 3300025925 Ga0207650_10226856 Ga0207650_102268561 428
508 3300026078 Ga0207702_10089993 Ga0207702_100899931 428
509 3300026088 Ga0207641_10000393 Ga0207641_1000039326 428
510 3300028379 Ga0268266_10028873 Ga0268266_100288735 428
511 3300028381 Ga0268264_10000088 Ga0268264_10000088175 428
512 3300031507 Ga0307509_10131310 Ga0307509_101313102 428
513 3300046519 Ga0495632_0037439 Ga0495632_0037439_573_1895 428
514 3300048928 Ga0496125_0000816 Ga0496125_0000816_26375_27715 428
515 3300048929 Ga0496126_0069812 Ga0496126_0069812_182_1522 428
516 2162886007 SwRhRL2b_contig_599388 SwRhRL2b_0795.00010870 431
517 3300005289 Ga0065704_10073031 Ga0065704_100730318 431
518 3300048925 Ga0496122_0000049 Ga0496122_0000049_43435_44766 431
519 3300048926 Ga0496123_0000042 Ga0496123_0000042_209694_211025 431

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

59

415

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.83 21 420
8sc6-assembly1.cif.gz_A human oct1 bound to thiamine in inward-open conformation 0.8292 58 414
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8236 25 426
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8226 18 420
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8216 21 420
ID Description Score Start End Superfamily
3o7qA02 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9604 233 417 1.20.1250.20
3o7qA02 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9214 233 417 1.20.1250.20
af_A0A1D6L8U4_23_213_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8962 23 223 1.20.1250.20
af_O23203_10_235_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8943 23 220 1.20.1250.20
af_Q54UC8_60_259_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8926 14 225 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2B7ZY08-F1-model_v4 Glucose/galactose MFS transporter 0.9079 224 414 GO:0005886
AF-A0A6S6PRM6-F1-model_v4 Glucose/galactose MFS transporter 0.9029 22 426 GO:0005354
GO:0005886
GO:0055056
GO:1904659
AF-A0A0N1KFM2-F1-model_v4 deleted 0.8925 23 228
AF-A0A508VID3-F1-model_v4 deleted 0.8913 15 419
AF-A0A379LT24-F1-model_v4 Probable metabolite transport protein CsbC 0.8796 18 228 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
86.25 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map