F458384

General Info

Members Datasets Scaffolds Average Seq Length
519 202 1038 165

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10000061|Ga0075433_100000617
Length 189
Sequence MSGATPISNGPPAARAGHADPATTNRAEHAAPAPIKFSAEQLAEVRRLQGLYPDKRGALLPVLHMAQDTFGYISLETEAYVAGLFELPPAHVHEVVTFYTLYFQQPKGRHVIAVCHNLSCHLAGAQDILRHLETRLGIRRGETSEDGRVTLQAVECLCACEAAPMAQVDERYELNLTSEKCDRILQDLR

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
154 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
155 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.39
Rhizosphere 98.84
Stem 0
Stem Tuber 0
Unclassified 6.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10000061 3300006852 Bacteria 47469
2 JGI25406J46586_10028354 3300003203 Bacteria 2134
3 rootH2_10100990 3300003320 Bacteria 4472
4 Ga0065714_10085112 3300005288 Bacteria 2164
5 Ga0065712_10344540 3300005290 Bacteria 796
6 Ga0065712_10439013 3300005290 Unclassified 696
7 Ga0065707_10175149 3300005295 Bacteria 1456
8 Ga0070658_10026788 3300005327 Bacteria 4628
9 Ga0070658_10259243 3300005327 Bacteria 1476
10 Ga0070683_100005141 3300005329 Bacteria 10883
11 Ga0070683_100576981 3300005329 Bacteria 1076
12 Ga0070683_101310030 3300005329 Bacteria 696
13 Ga0070670_100505785 3300005331 Bacteria 1075
14 Ga0070680_101675394 3300005336 Unclassified 551
15 Ga0070660_100018658 3300005339 Bacteria 5072
16 Ga0070660_100703789 3300005339 Unclassified 847
17 Ga0070689_100413560 3300005340 Bacteria 1142
18 Ga0070692_10263058 3300005345 Bacteria 1038
19 Ga0070669_100035722 3300005353 Bacteria 3600
20 Ga0070675_100396049 3300005354 Bacteria 1231
21 Ga0070675_100842424 3300005354 Bacteria 839
22 Ga0070671_100012313 3300005355 Bacteria 6887
23 Ga0070674_100319621 3300005356 Bacteria 1244
24 Ga0070688_100714194 3300005365 Unclassified 777
25 Ga0070659_100034934 3300005366 Bacteria 3912
26 Ga0070659_100110555 3300005366 Bacteria 2218
27 Ga0070659_100232263 3300005366 Bacteria 1524
28 Ga0070705_100020738 3300005440 Bacteria 3485
29 Ga0070705_100055779 3300005440 Bacteria 2324
30 Ga0070705_101318499 3300005440 Bacteria 599
31 Ga0070694_100478540 3300005444 Bacteria 988
32 Ga0070708_100222453 3300005445 Bacteria 1770
33 Ga0070708_100295196 3300005445 Bacteria 1526
34 Ga0070708_100875725 3300005445 Bacteria 843
35 Ga0070681_10093850 3300005458 Bacteria 2950
36 Ga0070681_10236238 3300005458 Bacteria 1742
37 Ga0070681_10787412 3300005458 Bacteria 868
38 Ga0068867_100262104 3300005459 Bacteria 1409
39 Ga0070706_100530608 3300005467 Bacteria 1095
40 Ga0070707_100026677 3300005468 Bacteria 5487
41 Ga0070707_100081037 3300005468 Bacteria 3133
42 Ga0070698_100049880 3300005471 Bacteria 4271
43 Ga0070698_100062569 3300005471 Bacteria 3754
44 Ga0070698_100861772 3300005471 Bacteria 851
45 Ga0070699_100004968 3300005518 Bacteria 11727
46 Ga0070699_100005082 3300005518 Bacteria 11582
47 Ga0070699_100239366 3300005518 Bacteria 1619
48 Ga0070699_100340615 3300005518 Bacteria 1350
49 Ga0070699_101175153 3300005518 Bacteria 704
50 Ga0070679_100019927 3300005530 Bacteria 6533
51 Ga0070679_100395769 3300005530 Unclassified 1328
52 Ga0070679_100487598 3300005530 Unclassified 1177
53 Ga0070679_100939785 3300005530 Bacteria 808
54 Ga0070684_100011020 3300005535 Bacteria 7191
55 Ga0070684_100495491 3300005535 Bacteria 1131
56 Ga0070697_100022782 3300005536 Bacteria 4978
57 Ga0070697_100030190 3300005536 Bacteria 4353
58 Ga0070697_100040591 3300005536 Bacteria 3766
59 Ga0070697_100075528 3300005536 Bacteria 2770
60 Ga0070697_100082389 3300005536 Bacteria 2652
61 Ga0068853_100341700 3300005539 Bacteria 1391
62 Ga0068853_100581235 3300005539 Unclassified 1063
63 Ga0068853_100898715 3300005539 Bacteria 850
64 Ga0070672_100114292 3300005543 Bacteria 2203
65 Ga0070695_100064240 3300005545 Bacteria 2387
66 Ga0070696_100044573 3300005546 Bacteria 3071
67 Ga0070696_100214574 3300005546 Bacteria 1442
68 Ga0070704_100014054 3300005549 Bacteria 4990
69 Ga0070704_100022750 3300005549 Bacteria 4083
70 Ga0070704_100860478 3300005549 Bacteria 813
71 Ga0068855_100073312 3300005563 Bacteria 3978
72 Ga0068855_100111384 3300005563 Bacteria 3142
73 Ga0068855_100146722 3300005563 Bacteria 2685
74 Ga0070664_100001338 3300005564 Bacteria 19647
75 Ga0068857_100079844 3300005577 Bacteria 2921
76 Ga0068857_100086627 3300005577 Bacteria 2801
77 Ga0068857_100263181 3300005577 Bacteria 1583
78 Ga0068856_100479969 3300005614 Bacteria 1264
79 Ga0068856_101217126 3300005614 Bacteria 769
80 Ga0070702_100138367 3300005615 Bacteria 1548
81 Ga0068852_100583837 3300005616 Bacteria 1121
82 Ga0068859_100515691 3300005617 Bacteria 1290
83 Ga0068861_100240878 3300005719 Bacteria 1538
84 Ga0068861_100673685 3300005719 Bacteria 958
85 Ga0068863_100218712 3300005841 Bacteria 1835
86 Ga0068863_100823773 3300005841 Bacteria 926
87 Ga0068862_100563735 3300005844 Bacteria 1089
88 Ga0068862_100563893 3300005844 Bacteria 1089
89 Ga0068862_100634217 3300005844 Unclassified 1029
90 Ga0081455_10060705 3300005937 Bacteria 3185
91 Ga0081539_10000035 3300005985 Bacteria 302689
92 Ga0097621_100140159 3300006237 Bacteria 2066
93 Ga0075428_100001055 3300006844 Bacteria 29285
94 Ga0075428_100002318 3300006844 Bacteria 20619
95 Ga0075428_100004726 3300006844 Bacteria 15077
96 Ga0075428_100023937 3300006844 Bacteria 6756
97 Ga0075428_100034555 3300006844 Bacteria 5575
98 Ga0075428_100643636 3300006844 Bacteria 1131
99 Ga0075428_100648653 3300006844 Bacteria 1126
100 Ga0075428_100995412 3300006844 Bacteria 888
101 Ga0075430_100000330 3300006846 Bacteria 33985
102 Ga0075430_100121361 3300006846 Bacteria 2179
103 Ga0075430_100220943 3300006846 Bacteria 1572
104 Ga0075431_100000322 3300006847 Bacteria 37762
105 Ga0075431_100000455 3300006847 Bacteria 33646
106 Ga0075431_100008578 3300006847 Bacteria 10233
107 Ga0075431_100060764 3300006847 Bacteria 3899
108 Ga0075431_100126977 3300006847 Bacteria 2632
109 Ga0075431_100129933 3300006847 Bacteria 2599
110 Ga0075431_100158273 3300006847 Bacteria 2330
111 Ga0075431_100351415 3300006847 Bacteria 1482
112 Ga0075431_101032842 3300006847 Bacteria 788
113 Ga0075433_10335017 3300006852 Bacteria 1338
114 Ga0075433_10631397 3300006852 Bacteria 939
115 Ga0075434_100010044 3300006871 Bacteria 8863
116 Ga0075434_100030055 3300006871 Bacteria 5348
117 Ga0075434_100040376 3300006871 Bacteria 4620
118 Ga0075434_100124746 3300006871 Bacteria 2592
119 Ga0075434_100179773 3300006871 Bacteria 2135
120 Ga0075434_100329385 3300006871 Bacteria 1548
121 Ga0075434_100761392 3300006871 Bacteria 985
122 Ga0075434_100903315 3300006871 Bacteria 898
123 Ga0075434_102190614 3300006871 Bacteria 557
124 Ga0075429_100001140 3300006880 Bacteria 21430
125 Ga0075429_100023994 3300006880 Bacteria 5290
126 Ga0075429_100043922 3300006880 Bacteria 3888
127 Ga0075429_100066973 3300006880 Bacteria 3125
128 Ga0075429_100102183 3300006880 Bacteria 2503
129 Ga0075429_100125846 3300006880 Bacteria 2241
130 Ga0068865_100479076 3300006881 Bacteria 1034
131 Ga0075436_100023068 3300006914 Bacteria 4274
132 Ga0075436_100300974 3300006914 Bacteria 1149
133 Ga0075436_100520246 3300006914 Bacteria 872
134 Ga0097620_100515696 3300006931 Bacteria 1290
135 Ga0075435_100004215 3300007076 Bacteria 9871
136 Ga0075435_100076677 3300007076 Bacteria 2740
137 Ga0075435_100081049 3300007076 Bacteria 2665
138 Ga0075435_100398489 3300007076 Bacteria 1183
139 Ga0075435_100836997 3300007076 Bacteria 802
140 Ga0099794_10148023 3300007265 Bacteria 1191
141 Ga0099794_10216830 3300007265 Bacteria 982
142 Ga0105250_10424515 3300009092 Unclassified 593
143 Ga0111539_10087428 3300009094 Bacteria 3662
144 Ga0111539_10192494 3300009094 Bacteria 2379
145 Ga0111539_10629043 3300009094 Bacteria 1250
146 Ga0111539_11527987 3300009094 Bacteria 774
147 Ga0111539_12165827 3300009094 Unclassified 645
148 Ga0114129_10000936 3300009147 Bacteria 38136
149 Ga0114129_10001217 3300009147 Bacteria 34192
150 Ga0114129_10002676 3300009147 Bacteria 24793
151 Ga0114129_10003145 3300009147 Bacteria 23174
152 Ga0114129_10005852 3300009147 Bacteria 17412
153 Ga0114129_10098703 3300009147 Bacteria 4042
154 Ga0114129_10118694 3300009147 Bacteria 3644
155 Ga0114129_10172318 3300009147 Bacteria 2949
156 Ga0114129_10187051 3300009147 Bacteria 2814
157 Ga0114129_10189988 3300009147 Bacteria 2790
158 Ga0114129_10313085 3300009147 Bacteria 2089
159 Ga0114129_10358840 3300009147 Bacteria 1929
160 Ga0114129_10553881 3300009147 Bacteria 1495
161 Ga0114129_10933630 3300009147 Bacteria 1097
162 Ga0105243_10207403 3300009148 Bacteria 1723
163 Ga0105243_10454531 3300009148 Bacteria 1203
164 Ga0105241_10503561 3300009174 Bacteria 1080
165 Ga0105241_10996124 3300009174 Bacteria 784
166 Ga0105248_10583058 3300009177 Bacteria 1262
167 Ga0105237_10183707 3300009545 Bacteria 2091
168 Ga0105249_10946522 3300009553 Bacteria 929
169 Ga0157373_10018427 3300013100 Bacteria 5083
170 Ga0157373_10097526 3300013100 Bacteria 2069
171 Ga0157373_10128344 3300013100 Bacteria 1783
172 Ga0157373_10140351 3300013100 Bacteria 1699
173 Ga0157373_10446386 3300013100 Bacteria 930
174 Ga0157373_10496249 3300013100 Unclassified 881
175 Ga0157371_10000168 3300013102 Bacteria 95185
176 Ga0157371_10001473 3300013102 Bacteria 24412
177 Ga0157371_10012460 3300013102 Bacteria 6497
178 Ga0157371_10012519 3300013102 Bacteria 6483
179 Ga0157371_10019868 3300013102 Bacteria 4949
180 Ga0157371_10024544 3300013102 Bacteria 4400
181 Ga0157371_10054615 3300013102 Bacteria 2836
182 Ga0157371_10076946 3300013102 Bacteria 2363
183 Ga0157371_10089979 3300013102 Bacteria 2174
184 Ga0157371_10196774 3300013102 Unclassified 1444
185 Ga0157371_10422854 3300013102 Bacteria 977
186 Ga0157370_10000817 3300013104 Bacteria 39404
187 Ga0157370_10007905 3300013104 Bacteria 11520
188 Ga0157369_10055484 3300013105 Bacteria 4277
189 Ga0157369_10057853 3300013105 Bacteria 4181
190 Ga0157369_10085509 3300013105 Bacteria 3370
191 Ga0157369_10445548 3300013105 Bacteria 1341
192 Ga0157374_10077433 3300013296 Bacteria 3147
193 Ga0157374_10547580 3300013296 Bacteria 1165
194 Ga0157378_10425674 3300013297 Bacteria 1313
195 Ga0163162_10007463 3300013306 Bacteria 10637
196 Ga0157372_10012017 3300013307 Bacteria 9219
197 Ga0157372_10036833 3300013307 Bacteria 5394
198 Ga0157372_10043901 3300013307 Bacteria 4952
199 Ga0157372_10168529 3300013307 Bacteria 2533
200 Ga0157372_10231663 3300013307 Bacteria 2142
201 Ga0157372_10330151 3300013307 Bacteria 1776
202 Ga0157372_10406428 3300013307 Bacteria 1586
203 Ga0157372_10467708 3300013307 Bacteria 1470
204 Ga0157372_10478512 3300013307 Bacteria 1452
205 Ga0157372_10969545 3300013307 Bacteria 985
206 Ga0157372_11169362 3300013307 Bacteria 889
207 Ga0157372_11625325 3300013307 Bacteria 744
208 Ga0157372_12088962 3300013307 Bacteria 651
209 Ga0157375_10156120 3300013308 Bacteria 2421
210 Ga0157377_10013169 3300014745 Bacteria 4180
211 Ga0157379_10332248 3300014968 Bacteria 1389
212 Ga0157376_11660608 3300014969 Bacteria 674
213 Ga0207656_10030722 3300025321 Bacteria 2221
214 Ga0207642_10155892 3300025899 Bacteria 1221
215 Ga0207705_10050085 3300025909 Bacteria 3006
216 Ga0207705_10057441 3300025909 Bacteria 2806
217 Ga0207705_10286647 3300025909 Bacteria 1261
218 Ga0207684_10012946 3300025910 Bacteria 7224
219 Ga0207684_10031579 3300025910 Bacteria 4504
220 Ga0207684_10366543 3300025910 Bacteria 1240
221 Ga0207684_10736772 3300025910 Bacteria 836
222 Ga0207654_10023563 3300025911 Bacteria 3299
223 Ga0207654_10338445 3300025911 Bacteria 1033
224 Ga0207707_10233753 3300025912 Bacteria 1599
225 Ga0207707_10604548 3300025912 Bacteria 928
226 Ga0207695_10358062 3300025913 Bacteria 1346
227 Ga0207671_10452634 3300025914 Bacteria 1022
228 Ga0207660_10674415 3300025917 Unclassified 843
229 Ga0207662_10459232 3300025918 Bacteria 872
230 Ga0207657_10016216 3300025919 Bacteria 7191
231 Ga0207657_10430002 3300025919 Bacteria 1037
232 Ga0207652_10000181 3300025921 Bacteria 66711
233 Ga0207652_10124433 3300025921 Bacteria 2296
234 Ga0207652_10129049 3300025921 Bacteria 2254
235 Ga0207652_10547068 3300025921 Bacteria 1041
236 Ga0207646_10004503 3300025922 Bacteria 15100
237 Ga0207646_10005081 3300025922 Bacteria 13975
238 Ga0207646_11203011 3300025922 Bacteria 664
239 Ga0207681_10016302 3300025923 Bacteria 4646
240 Ga0207681_11170062 3300025923 Unclassified 646
241 Ga0207650_10422715 3300025925 Bacteria 1106
242 Ga0207644_10131737 3300025931 Bacteria 1915
243 Ga0207690_10110974 3300025932 Bacteria 1975
244 Ga0207706_10065704 3300025933 Bacteria 3194
245 Ga0207670_10369541 3300025936 Bacteria 1140
246 Ga0207691_10137688 3300025940 Bacteria 2153
247 Ga0207691_10189204 3300025940 Bacteria 1796
248 Ga0207689_10741478 3300025942 Bacteria 829
249 Ga0207661_10005535 3300025944 Bacteria 8911
250 Ga0207679_10002952 3300025945 Bacteria 10540
251 Ga0207667_10075667 3300025949 Bacteria 3495
252 Ga0207667_11121400 3300025949 Bacteria 769
253 Ga0207712_10854928 3300025961 Unclassified 802
254 Ga0207640_11280135 3300025981 Bacteria 654
255 Ga0207658_10687790 3300025986 Bacteria 924
256 Ga0207677_10098101 3300026023 Bacteria 2149
257 Ga0207703_10256293 3300026035 Bacteria 1579
258 Ga0207639_10352498 3300026041 Unclassified 1315
259 Ga0207708_10733204 3300026075 Bacteria 847
260 Ga0207702_10437869 3300026078 Bacteria 1266
261 Ga0207641_10090646 3300026088 Bacteria 2674
262 Ga0207648_10152564 3300026089 Bacteria 2039
263 Ga0207674_10071640 3300026116 Bacteria 3482
264 Ga0207674_10113539 3300026116 Unclassified 2682
265 Ga0207674_10455295 3300026116 Bacteria 1237
266 Ga0207675_100713817 3300026118 Bacteria 1012
267 Ga0209982_1007223 3300027552 Bacteria 1623
268 Ga0209588_1125717 3300027671 Unclassified 819
269 Ga0209974_10024659 3300027876 Bacteria 1990
270 Ga0207428_10289938 3300027907 Bacteria 1213
271 Ga0268265_10466408 3300028380 Bacteria 1183
272 Ga0268265_10771343 3300028380 Bacteria 935
273 Ga0265318_10132312 3300028577 Bacteria 917
274 Ga0265331_10324510 3300031250 Bacteria 689
275 Ga0265327_10000421 3300031251 Bacteria 77515
276 Ga0307408_100030013 3300031548 Bacteria 3772
277 Ga0307408_100102774 3300031548 Bacteria 2180
278 Ga0307408_100144220 3300031548 Bacteria 1872
279 Ga0265314_10009334 3300031711 Bacteria 8301
280 Ga0307405_10125379 3300031731 Bacteria 1765
281 Ga0307405_10343730 3300031731 Bacteria 1148
282 Ga0307405_10425409 3300031731 Bacteria 1046
283 Ga0307413_11590982 3300031824 Bacteria 580
284 Ga0307410_10105383 3300031852 Bacteria 2030
285 Ga0307407_10106127 3300031903 Bacteria 1754
286 Ga0307412_10360919 3300031911 Bacteria 1170
287 Ga0307409_100081880 3300031995 Bacteria 2611
288 Ga0307409_100598881 3300031995 Bacteria 1089
289 Ga0307416_100014723 3300032002 Bacteria 5374
290 Ga0307416_100040476 3300032002 Bacteria 3621
291 Ga0307416_100159806 3300032002 Bacteria 2081
292 Ga0307416_100298391 3300032002 Bacteria 1600
293 Ga0307411_10038933 3300032005 Bacteria 3004
294 Ga0307411_10860015 3300032005 Bacteria 803
295 Ga0307411_10879803 3300032005 Bacteria 795
296 Ga0373955_0050463 3300035172 Bacteria 2263
297 Ga0395899_0002874 3300037312 Bacteria 13842
298 Ga0395899_0121763 3300037312 Bacteria 1868
299 Ga0395899_0166610 3300037312 Bacteria 1554
300 Ga0395899_0197940 3300037312 Bacteria 1403
301 Ga0395899_0392060 3300037312 Unclassified 920
302 Ga0395899_0594098 3300037312 Bacteria 706
303 Ga0395900_0001963 3300037418 Bacteria 23228
304 Ga0395900_0002402 3300037418 Bacteria 20657
305 Ga0395900_0068341 3300037418 Bacteria 3651
306 Ga0395900_0100541 3300037418 Bacteria 2970
307 Ga0395900_0105919 3300037418 Bacteria 2888
308 Ga0395900_0112373 3300037418 Bacteria 2797
309 Ga0395900_0354871 3300037418 Bacteria 1439
310 Ga0395900_1312061 3300037418 Unclassified 638
311 Ga0395898_0005476 3300037466 Bacteria 13714
312 Ga0395898_0098621 3300037466 Bacteria 2805
313 Ga0395898_0320597 3300037466 Bacteria 1478
314 Ga0395898_0568083 3300037466 Unclassified 1076
315 Ga0395898_0754246 3300037466 Bacteria 914
316 Ga0395905_0028897 3300037471 Bacteria 5226
317 Ga0395905_0041651 3300037471 Bacteria 4310
318 Ga0395905_0324295 3300037471 Bacteria 1430
319 Ga0395905_0385152 3300037471 Bacteria 1296
320 Ga0395901_0003453 3300038443 Bacteria 15929
321 Ga0395901_0010392 3300038443 Bacteria 9428
322 Ga0395901_0068548 3300038443 Bacteria 3695
323 Ga0395901_0304586 3300038443 Bacteria 1651
324 Ga0395901_0689801 3300038443 Bacteria 1020
325 Ga0395901_0845277 3300038443 Bacteria 901
326 Ga0395901_1467065 3300038443 Bacteria 639
327 Ga0242420_059595 3300038996 Bacteria 759
328 Ga0436365_0623046 3300039437 Bacteria 1321
329 Ga0436363_0052529 3300039450 Bacteria 941
330 Ga0436363_0358829 3300039450 Bacteria 1367
331 Ga0451793_0949842 3300041452 Unclassified 615
332 Ga0451577_0104864 3300042876 Bacteria 2526
333 Ga0453683_0033674 3300044673 Bacteria 3232
334 Ga0453683_0879498 3300044673 Bacteria 592
335 Ga0466959_0085296 3300045049 Bacteria 2273
336 Ga0451576_0556904 3300045051 Bacteria 1204
337 Ga0451576_0823362 3300045051 Bacteria 975
338 Ga0451576_1653328 3300045051 Bacteria 664
339 Ga0495580_0005955 3300046472 Bacteria 9999
340 Ga0495594_0203698 3300046499 Bacteria 1128
341 Ga0495669_0062323 3300046684 Bacteria 1690
342 Ga0495636_0010351 3300047318 Bacteria 3683
343 Ga0496109_1157708 3300048912 Bacteria 710
344 Ga0501292_038463 3300049515 Unclassified 821
345 Ga0501299_101005 3300049522 Bacteria 670
346 Ga0501311_026432 3300049527 Bacteria 818
347 Ga0501031_0061029 3300049568 Bacteria 2457
348 Ga0501031_0361619 3300049568 Bacteria 939
349 Ga0501032_0224305 3300049569 Bacteria 1223
350 Ga0501033_0433629 3300049570 Bacteria 914
351 Ga0501033_0570586 3300049570 Bacteria 778
352 Ga0501034_0000002 3300049571 Bacteria 565510
353 Ga0501036_0108658 3300049572 Bacteria 2344
354 Ga0501036_0203342 3300049572 Bacteria 1666
355 Ga0501036_0386025 3300049572 Bacteria 1169
356 Ga0501036_1130311 3300049572 Unclassified 639
357 Ga0501037_0167822 3300049573 Bacteria 1562
358 Ga0501038_0031246 3300049574 Bacteria 4707
359 Ga0501038_0355510 3300049574 Bacteria 1140
360 Ga0501039_0029422 3300049575 Bacteria 4231
361 Ga0501039_0128203 3300049575 Bacteria 1991
362 Ga0501039_0248219 3300049575 Bacteria 1400
363 Ga0501039_0346317 3300049575 Bacteria 1168
364 Ga0501039_1033229 3300049575 Bacteria 638
365 Ga0501040_0018320 3300049576 Bacteria 4647
366 Ga0501040_0054288 3300049576 Bacteria 2747
367 Ga0501040_0762790 3300049576 Bacteria 700
368 Ga0501041_0099477 3300049577 Bacteria 1799
369 Ga0501041_0170767 3300049577 Bacteria 1361
370 Ga0501041_0298367 3300049577 Bacteria 1015
371 Ga0501041_0443253 3300049577 Bacteria 824
372 Ga0501042_0028586 3300049578 Bacteria 3930
373 Ga0501042_0051637 3300049578 Bacteria 2933
374 Ga0501042_0097679 3300049578 Bacteria 2111
375 Ga0501042_0360143 3300049578 Bacteria 1053
376 Ga0501042_0504767 3300049578 Bacteria 878
377 Ga0501042_0620703 3300049578 Bacteria 786
378 Ga0501043_0037281 3300049579 Bacteria 3824
379 Ga0501043_0224073 3300049579 Bacteria 1454
380 Ga0501046_0038397 3300049580 Bacteria 3843
381 Ga0501046_0195118 3300049580 Bacteria 1509
382 Ga0501046_0241989 3300049580 Unclassified 1330
383 Ga0501046_0298528 3300049580 Bacteria 1177
384 Ga0501046_0412898 3300049580 Bacteria 974
385 Ga0501046_0428023 3300049580 Bacteria 954
386 Ga0501048_0083484 3300049582 Bacteria 2253
387 Ga0501048_0090074 3300049582 Bacteria 2164
388 Ga0501048_0184746 3300049582 Bacteria 1478
389 Ga0501067_0020063 3300049583 Bacteria 3698
390 Ga0501068_0126134 3300049584 Bacteria 1599
391 Ga0501068_0138343 3300049584 Bacteria 1526
392 Ga0501068_0476424 3300049584 Bacteria 809
393 Ga0501068_0501875 3300049584 Bacteria 787
394 Ga0501069_0106930 3300049585 Bacteria 1591
395 Ga0501069_0262076 3300049585 Bacteria 1009
396 Ga0501069_0313768 3300049585 Bacteria 920
397 Ga0501070_0723740 3300049586 Bacteria 786
398 Ga0501071_0097445 3300049587 Bacteria 2165
399 Ga0501071_0123284 3300049587 Bacteria 1922
400 Ga0501071_0543066 3300049587 Bacteria 893
401 Ga0501072_0027745 3300049588 Bacteria 4417
402 Ga0501072_0044822 3300049588 Bacteria 3477
403 Ga0501072_0065514 3300049588 Bacteria 2865
404 Ga0501072_0105824 3300049588 Bacteria 2237
405 Ga0501072_0542041 3300049588 Bacteria 919
406 Ga0501072_0600860 3300049588 Bacteria 867
407 Ga0501073_0380080 3300049589 Bacteria 976
408 Ga0501074_0102356 3300049590 Bacteria 2050
409 Ga0501075_0004884 3300049591 Bacteria 9136
410 Ga0501075_0008098 3300049591 Bacteria 7310
411 Ga0501075_0015614 3300049591 Bacteria 5452
412 Ga0501075_0099705 3300049591 Bacteria 2206
413 Ga0501075_0228385 3300049591 Bacteria 1419
414 Ga0501075_0231850 3300049591 Bacteria 1408
415 Ga0501075_0934787 3300049591 Unclassified 659
416 Ga0501076_0006675 3300049592 Bacteria 8371
417 Ga0501076_0044080 3300049592 Bacteria 3517
418 Ga0501076_0050642 3300049592 Bacteria 3286
419 Ga0501076_0156850 3300049592 Bacteria 1853
420 Ga0501076_0158521 3300049592 Bacteria 1843
421 Ga0501077_0008761 3300049593 Bacteria 6277
422 Ga0501077_0012992 3300049593 Bacteria 5216
423 Ga0501077_0116075 3300049593 Bacteria 1697
424 Ga0501077_0497260 3300049593 Bacteria 782
425 Ga0501077_0764680 3300049593 Bacteria 621
426 Ga0501236_091150 3300049670 Bacteria 586
427 Ga0501079_0017737 3300049741 Bacteria 5438
428 Ga0501079_0026240 3300049741 Bacteria 4466
429 Ga0501079_0080919 3300049741 Bacteria 2511
430 Ga0501079_0135163 3300049741 Bacteria 1920
431 Ga0501079_0145895 3300049741 Bacteria 1844
432 Ga0501079_0204688 3300049741 Bacteria 1542
433 Ga0501080_0249724 3300049742 Bacteria 1618
434 Ga0501080_0310532 3300049742 Bacteria 1429
435 Ga0501081_0011505 3300049743 Bacteria 5789
436 Ga0501081_0018480 3300049743 Bacteria 4630
437 Ga0501081_0051392 3300049743 Bacteria 2843
438 Ga0501081_0117951 3300049743 Bacteria 1888
439 Ga0501081_0174504 3300049743 Bacteria 1553
440 Ga0501081_0357595 3300049743 Bacteria 1077
441 Ga0501081_0608515 3300049743 Bacteria 818
442 Ga0501083_0654177 3300049744 Unclassified 683
443 Ga0501035_0390598 3300049822 Bacteria 1159
444 Ga0501035_0635085 3300049822 Unclassified 867
445 Ga0501035_1186830 3300049822 Bacteria 593
446 Ga0501045_0064987 3300049824 Bacteria 2679
447 Ga0501045_0300716 3300049824 Bacteria 1194
448 Ga0501045_0599074 3300049824 Bacteria 816
449 nmdc:mga05p37_1060328_c1 3300050507 Bacteria 854
450 nmdc:mga05p37_1423_c1 3300050507 Bacteria 27829
451 nmdc:mga05p37_142538_c1 3300050507 Bacteria 2935
452 nmdc:mga05p37_23351_c1 3300050507 Bacteria 7505
453 nmdc:mga05p37_374119_c1 3300050507 Bacteria 1671
454 nmdc:mga05p37_42137_c1 3300050507 Bacteria 5609
455 nmdc:mga05p37_462715_c1 3300050507 Bacteria 1465
456 nmdc:mga05p37_477984_c1 3300050507 Bacteria 1436
457 nmdc:mga05p37_7542_c1 3300050507 Bacteria 12827
458 nmdc:mga05p37_769_c1 3300050507 Bacteria 35683
459 nmdc:mga05p37_863273_c1 3300050507 Bacteria 981
460 nmdc:mga05p37_95531_c1 3300050507 Bacteria 3662
461 nmdc:mga05p37_959623_c1 3300050507 Bacteria 914
462 nmdc:mga09592_104283_c1 3300050508 Bacteria 2430
463 nmdc:mga09592_142021_c1 3300050508 Bacteria 2070
464 nmdc:mga09592_222462_c1 3300050508 Bacteria 1635
465 nmdc:mga09592_3906_c1 3300050508 Bacteria 12002
466 nmdc:mga09592_50118_c1 3300050508 Bacteria 3522
467 nmdc:mga09592_92258_c1 3300050508 Bacteria 2589
468 nmdc:mga0qj67_140_c1 3300050509 Bacteria 48848
469 nmdc:mga0qj67_28800_c1 3300050509 Bacteria 4313
470 nmdc:mga0qj67_34255_c1 3300050509 Bacteria 3966
471 nmdc:mga0qj67_361540_c1 3300050509 Bacteria 1173
472 nmdc:mga0qj67_4886_c1 3300050509 Bacteria 9744
473 nmdc:mga06r32_1165_c1 3300050510 Bacteria 23660
474 nmdc:mga06r32_1198029_c1 3300050510 Bacteria 706
475 nmdc:mga06r32_146915_c1 3300050510 Bacteria 2335
476 nmdc:mga06r32_2388_c1 3300050510 Bacteria 16811
477 nmdc:mga06r32_244809_c1 3300050510 Bacteria 1780
478 nmdc:mga06r32_48438_c1 3300050510 Bacteria 4062
479 nmdc:mga06r32_561299_c1 3300050510 Unclassified 1115
480 nmdc:mga06r32_6381_c1 3300050510 Bacteria 10598
481 nmdc:mga06r32_6726_c1 3300050510 Bacteria 10330
482 nmdc:mga06r32_78371_c1 3300050510 Bacteria 3212
483 nmdc:mga08y16_177616_c1 3300050511 Bacteria 2211
484 nmdc:mga08y16_36102_c1 3300050511 Bacteria 5190
485 nmdc:mga0n895_200105_c1 3300050512 Bacteria 2029
486 nmdc:mga0n895_327293_c1 3300050512 Bacteria 1553
487 nmdc:mga0n895_356378_c1 3300050512 Bacteria 1482
488 nmdc:mga0n895_442774_c1 3300050512 Bacteria 1312
489 nmdc:mga0n895_506005_c1 3300050512 Bacteria 1216
490 nmdc:mga0n895_632099_c1 3300050512 Bacteria 1071
491 nmdc:mga0n895_66315_c1 3300050512 Bacteria 3574
492 nmdc:mga0n895_760630_c1 3300050512 Bacteria 961
493 nmdc:mga0n895_838425_c1 3300050512 Unclassified 908
494 nmdc:mga0rr50_14947_c1 3300050513 Bacteria 5110
495 nmdc:mga0rr50_80862_c1 3300050513 Bacteria 2506
496 nmdc:mga08x19_123532_c1 3300050514 Bacteria 1737
497 nmdc:mga0a205_259977_c1 3300050515 Bacteria 1614
498 nmdc:mga0a205_421957_c1 3300050515 Bacteria 1196
499 nmdc:mga0a205_440225_c1 3300050515 Bacteria 1164
500 nmdc:mga0a205_520533_c1 3300050515 Bacteria 1046
501 nmdc:mga0a205_92268_c1 3300050515 Bacteria 2926
502 Ga0501084_0002045 3300054114 Bacteria 16117
503 Ga0501084_0014269 3300054114 Bacteria 6582
504 Ga0501084_0136029 3300054114 Bacteria 2069
505 Ga0501084_0243107 3300054114 Bacteria 1519
506 Ga0501084_0249682 3300054114 Unclassified 1498
507 Ga0501084_0414709 3300054114 Bacteria 1138
508 Ga0501084_0589586 3300054114 Bacteria 939
509 Ga0590071_012672 3300059421 Bacteria 1975
510 Ga0590074_020823 3300059423 Bacteria 1129
511 Ga0590075_030012 3300059424 Bacteria 1376
512 Ga0501082_0034484 3300060353 Bacteria 4362
513 Ga0501082_0190771 3300060353 Bacteria 1783
514 Ga0501082_0538461 3300060353 Bacteria 1021
515 Ga0530510_0001055 3300061734 Bacteria 18266
516 Ga0530510_0018697 3300061734 Bacteria 4914
517 Ga0530510_0024404 3300061734 Bacteria 4313
518 Ga0530510_0056287 3300061734 Bacteria 2841
519 Ga0530510_0522078 3300061734 Unclassified 901
520 Ga0075433_10000061
521 JGI25406J46586_10028354
522 rootH2_10100990
523 Ga0065714_10085112
524 Ga0065712_10344540
525 Ga0065712_10439013
526 Ga0065707_10175149
527 Ga0070658_10026788
528 Ga0070658_10259243
529 Ga0070683_100005141
530 Ga0070683_100576981
531 Ga0070683_101310030
532 Ga0070670_100505785
533 Ga0070680_101675394
534 Ga0070660_100018658
535 Ga0070660_100703789
536 Ga0070689_100413560
537 Ga0070692_10263058
538 Ga0070669_100035722
539 Ga0070675_100396049
540 Ga0070675_100842424
541 Ga0070671_100012313
542 Ga0070674_100319621
543 Ga0070688_100714194
544 Ga0070659_100034934
545 Ga0070659_100110555
546 Ga0070659_100232263
547 Ga0070705_100020738
548 Ga0070705_100055779
549 Ga0070705_101318499
550 Ga0070694_100478540
551 Ga0070708_100222453
552 Ga0070708_100295196
553 Ga0070708_100875725
554 Ga0070681_10093850
555 Ga0070681_10236238
556 Ga0070681_10787412
557 Ga0068867_100262104
558 Ga0070706_100530608
559 Ga0070707_100026677
560 Ga0070707_100081037
561 Ga0070698_100049880
562 Ga0070698_100062569
563 Ga0070698_100861772
564 Ga0070699_100004968
565 Ga0070699_100005082
566 Ga0070699_100239366
567 Ga0070699_100340615
568 Ga0070699_101175153
569 Ga0070679_100019927
570 Ga0070679_100395769
571 Ga0070679_100487598
572 Ga0070679_100939785
573 Ga0070684_100011020
574 Ga0070684_100495491
575 Ga0070697_100022782
576 Ga0070697_100030190
577 Ga0070697_100040591
578 Ga0070697_100075528
579 Ga0070697_100082389
580 Ga0068853_100341700
581 Ga0068853_100581235
582 Ga0068853_100898715
583 Ga0070672_100114292
584 Ga0070695_100064240
585 Ga0070696_100044573
586 Ga0070696_100214574
587 Ga0070704_100014054
588 Ga0070704_100022750
589 Ga0070704_100860478
590 Ga0068855_100073312
591 Ga0068855_100111384
592 Ga0068855_100146722
593 Ga0070664_100001338
594 Ga0068857_100079844
595 Ga0068857_100086627
596 Ga0068857_100263181
597 Ga0068856_100479969
598 Ga0068856_101217126
599 Ga0070702_100138367
600 Ga0068852_100583837
601 Ga0068859_100515691
602 Ga0068861_100240878
603 Ga0068861_100673685
604 Ga0068863_100218712
605 Ga0068863_100823773
606 Ga0068862_100563735
607 Ga0068862_100563893
608 Ga0068862_100634217
609 Ga0081455_10060705
610 Ga0081539_10000035
611 Ga0097621_100140159
612 Ga0075428_100001055
613 Ga0075428_100002318
614 Ga0075428_100004726
615 Ga0075428_100023937
616 Ga0075428_100034555
617 Ga0075428_100643636
618 Ga0075428_100648653
619 Ga0075428_100995412
620 Ga0075430_100000330
621 Ga0075430_100121361
622 Ga0075430_100220943
623 Ga0075431_100000322
624 Ga0075431_100000455
625 Ga0075431_100008578
626 Ga0075431_100060764
627 Ga0075431_100126977
628 Ga0075431_100129933
629 Ga0075431_100158273
630 Ga0075431_100351415
631 Ga0075431_101032842
632 Ga0075433_10335017
633 Ga0075433_10631397
634 Ga0075434_100010044
635 Ga0075434_100030055
636 Ga0075434_100040376
637 Ga0075434_100124746
638 Ga0075434_100179773
639 Ga0075434_100329385
640 Ga0075434_100761392
641 Ga0075434_100903315
642 Ga0075434_102190614
643 Ga0075429_100001140
644 Ga0075429_100023994
645 Ga0075429_100043922
646 Ga0075429_100066973
647 Ga0075429_100102183
648 Ga0075429_100125846
649 Ga0068865_100479076
650 Ga0075436_100023068
651 Ga0075436_100300974
652 Ga0075436_100520246
653 Ga0097620_100515696
654 Ga0075435_100004215
655 Ga0075435_100076677
656 Ga0075435_100081049
657 Ga0075435_100398489
658 Ga0075435_100836997
659 Ga0099794_10148023
660 Ga0099794_10216830
661 Ga0105250_10424515
662 Ga0111539_10087428
663 Ga0111539_10192494
664 Ga0111539_10629043
665 Ga0111539_11527987
666 Ga0111539_12165827
667 Ga0114129_10000936
668 Ga0114129_10001217
669 Ga0114129_10002676
670 Ga0114129_10003145
671 Ga0114129_10005852
672 Ga0114129_10098703
673 Ga0114129_10118694
674 Ga0114129_10172318
675 Ga0114129_10187051
676 Ga0114129_10189988
677 Ga0114129_10313085
678 Ga0114129_10358840
679 Ga0114129_10553881
680 Ga0114129_10933630
681 Ga0105243_10207403
682 Ga0105243_10454531
683 Ga0105241_10503561
684 Ga0105241_10996124
685 Ga0105248_10583058
686 Ga0105237_10183707
687 Ga0105249_10946522
688 Ga0157373_10018427
689 Ga0157373_10097526
690 Ga0157373_10128344
691 Ga0157373_10140351
692 Ga0157373_10446386
693 Ga0157373_10496249
694 Ga0157371_10000168
695 Ga0157371_10001473
696 Ga0157371_10012460
697 Ga0157371_10012519
698 Ga0157371_10019868
699 Ga0157371_10024544
700 Ga0157371_10054615
701 Ga0157371_10076946
702 Ga0157371_10089979
703 Ga0157371_10196774
704 Ga0157371_10422854
705 Ga0157370_10000817
706 Ga0157370_10007905
707 Ga0157369_10055484
708 Ga0157369_10057853
709 Ga0157369_10085509
710 Ga0157369_10445548
711 Ga0157374_10077433
712 Ga0157374_10547580
713 Ga0157378_10425674
714 Ga0163162_10007463
715 Ga0157372_10012017
716 Ga0157372_10036833
717 Ga0157372_10043901
718 Ga0157372_10168529
719 Ga0157372_10231663
720 Ga0157372_10330151
721 Ga0157372_10406428
722 Ga0157372_10467708
723 Ga0157372_10478512
724 Ga0157372_10969545
725 Ga0157372_11169362
726 Ga0157372_11625325
727 Ga0157372_12088962
728 Ga0157375_10156120
729 Ga0157377_10013169
730 Ga0157379_10332248
731 Ga0157376_11660608
732 Ga0207656_10030722
733 Ga0207642_10155892
734 Ga0207705_10050085
735 Ga0207705_10057441
736 Ga0207705_10286647
737 Ga0207684_10012946
738 Ga0207684_10031579
739 Ga0207684_10366543
740 Ga0207684_10736772
741 Ga0207654_10023563
742 Ga0207654_10338445
743 Ga0207707_10233753
744 Ga0207707_10604548
745 Ga0207695_10358062
746 Ga0207671_10452634
747 Ga0207660_10674415
748 Ga0207662_10459232
749 Ga0207657_10016216
750 Ga0207657_10430002
751 Ga0207652_10000181
752 Ga0207652_10124433
753 Ga0207652_10129049
754 Ga0207652_10547068
755 Ga0207646_10004503
756 Ga0207646_10005081
757 Ga0207646_11203011
758 Ga0207681_10016302
759 Ga0207681_11170062
760 Ga0207650_10422715
761 Ga0207644_10131737
762 Ga0207690_10110974
763 Ga0207706_10065704
764 Ga0207670_10369541
765 Ga0207691_10137688
766 Ga0207691_10189204
767 Ga0207689_10741478
768 Ga0207661_10005535
769 Ga0207679_10002952
770 Ga0207667_10075667
771 Ga0207667_11121400
772 Ga0207712_10854928
773 Ga0207640_11280135
774 Ga0207658_10687790
775 Ga0207677_10098101
776 Ga0207703_10256293
777 Ga0207639_10352498
778 Ga0207708_10733204
779 Ga0207702_10437869
780 Ga0207641_10090646
781 Ga0207648_10152564
782 Ga0207674_10071640
783 Ga0207674_10113539
784 Ga0207674_10455295
785 Ga0207675_100713817
786 Ga0209982_1007223
787 Ga0209588_1125717
788 Ga0209974_10024659
789 Ga0207428_10289938
790 Ga0268265_10466408
791 Ga0268265_10771343
792 Ga0265318_10132312
793 Ga0265331_10324510
794 Ga0265327_10000421
795 Ga0307408_100030013
796 Ga0307408_100102774
797 Ga0307408_100144220
798 Ga0265314_10009334
799 Ga0307405_10125379
800 Ga0307405_10343730
801 Ga0307405_10425409
802 Ga0307413_11590982
803 Ga0307410_10105383
804 Ga0307407_10106127
805 Ga0307412_10360919
806 Ga0307409_100081880
807 Ga0307409_100598881
808 Ga0307416_100014723
809 Ga0307416_100040476
810 Ga0307416_100159806
811 Ga0307416_100298391
812 Ga0307411_10038933
813 Ga0307411_10860015
814 Ga0307411_10879803
815 Ga0373955_0050463
816 Ga0395899_0002874
817 Ga0395899_0121763
818 Ga0395899_0166610
819 Ga0395899_0197940
820 Ga0395899_0392060
821 Ga0395899_0594098
822 Ga0395900_0001963
823 Ga0395900_0002402
824 Ga0395900_0068341
825 Ga0395900_0100541
826 Ga0395900_0105919
827 Ga0395900_0112373
828 Ga0395900_0354871
829 Ga0395900_1312061
830 Ga0395898_0005476
831 Ga0395898_0098621
832 Ga0395898_0320597
833 Ga0395898_0568083
834 Ga0395898_0754246
835 Ga0395905_0028897
836 Ga0395905_0041651
837 Ga0395905_0324295
838 Ga0395905_0385152
839 Ga0395901_0003453
840 Ga0395901_0010392
841 Ga0395901_0068548
842 Ga0395901_0304586
843 Ga0395901_0689801
844 Ga0395901_0845277
845 Ga0395901_1467065
846 Ga0242420_059595
847 Ga0436365_0623046
848 Ga0436363_0052529
849 Ga0436363_0358829
850 Ga0451793_0949842
851 Ga0451577_0104864
852 Ga0453683_0033674
853 Ga0453683_0879498
854 Ga0466959_0085296
855 Ga0451576_0556904
856 Ga0451576_0823362
857 Ga0451576_1653328
858 Ga0495580_0005955
859 Ga0495594_0203698
860 Ga0495669_0062323
861 Ga0495636_0010351
862 Ga0496109_1157708
863 Ga0501292_038463
864 Ga0501299_101005
865 Ga0501311_026432
866 Ga0501031_0061029
867 Ga0501031_0361619
868 Ga0501032_0224305
869 Ga0501033_0433629
870 Ga0501033_0570586
871 Ga0501034_0000002
872 Ga0501036_0108658
873 Ga0501036_0203342
874 Ga0501036_0386025
875 Ga0501036_1130311
876 Ga0501037_0167822
877 Ga0501038_0031246
878 Ga0501038_0355510
879 Ga0501039_0029422
880 Ga0501039_0128203
881 Ga0501039_0248219
882 Ga0501039_0346317
883 Ga0501039_1033229
884 Ga0501040_0018320
885 Ga0501040_0054288
886 Ga0501040_0762790
887 Ga0501041_0099477
888 Ga0501041_0170767
889 Ga0501041_0298367
890 Ga0501041_0443253
891 Ga0501042_0028586
892 Ga0501042_0051637
893 Ga0501042_0097679
894 Ga0501042_0360143
895 Ga0501042_0504767
896 Ga0501042_0620703
897 Ga0501043_0037281
898 Ga0501043_0224073
899 Ga0501046_0038397
900 Ga0501046_0195118
901 Ga0501046_0241989
902 Ga0501046_0298528
903 Ga0501046_0412898
904 Ga0501046_0428023
905 Ga0501048_0083484
906 Ga0501048_0090074
907 Ga0501048_0184746
908 Ga0501067_0020063
909 Ga0501068_0126134
910 Ga0501068_0138343
911 Ga0501068_0476424
912 Ga0501068_0501875
913 Ga0501069_0106930
914 Ga0501069_0262076
915 Ga0501069_0313768
916 Ga0501070_0723740
917 Ga0501071_0097445
918 Ga0501071_0123284
919 Ga0501071_0543066
920 Ga0501072_0027745
921 Ga0501072_0044822
922 Ga0501072_0065514
923 Ga0501072_0105824
924 Ga0501072_0542041
925 Ga0501072_0600860
926 Ga0501073_0380080
927 Ga0501074_0102356
928 Ga0501075_0004884
929 Ga0501075_0008098
930 Ga0501075_0015614
931 Ga0501075_0099705
932 Ga0501075_0228385
933 Ga0501075_0231850
934 Ga0501075_0934787
935 Ga0501076_0006675
936 Ga0501076_0044080
937 Ga0501076_0050642
938 Ga0501076_0156850
939 Ga0501076_0158521
940 Ga0501077_0008761
941 Ga0501077_0012992
942 Ga0501077_0116075
943 Ga0501077_0497260
944 Ga0501077_0764680
945 Ga0501236_091150
946 Ga0501079_0017737
947 Ga0501079_0026240
948 Ga0501079_0080919
949 Ga0501079_0135163
950 Ga0501079_0145895
951 Ga0501079_0204688
952 Ga0501080_0249724
953 Ga0501080_0310532
954 Ga0501081_0011505
955 Ga0501081_0018480
956 Ga0501081_0051392
957 Ga0501081_0117951
958 Ga0501081_0174504
959 Ga0501081_0357595
960 Ga0501081_0608515
961 Ga0501083_0654177
962 Ga0501035_0390598
963 Ga0501035_0635085
964 Ga0501035_1186830
965 Ga0501045_0064987
966 Ga0501045_0300716
967 Ga0501045_0599074
968 nmdc:mga05p37_1060328_c1
969 nmdc:mga05p37_1423_c1
970 nmdc:mga05p37_142538_c1
971 nmdc:mga05p37_23351_c1
972 nmdc:mga05p37_374119_c1
973 nmdc:mga05p37_42137_c1
974 nmdc:mga05p37_462715_c1
975 nmdc:mga05p37_477984_c1
976 nmdc:mga05p37_7542_c1
977 nmdc:mga05p37_769_c1
978 nmdc:mga05p37_863273_c1
979 nmdc:mga05p37_95531_c1
980 nmdc:mga05p37_959623_c1
981 nmdc:mga09592_104283_c1
982 nmdc:mga09592_142021_c1
983 nmdc:mga09592_222462_c1
984 nmdc:mga09592_3906_c1
985 nmdc:mga09592_50118_c1
986 nmdc:mga09592_92258_c1
987 nmdc:mga0qj67_140_c1
988 nmdc:mga0qj67_28800_c1
989 nmdc:mga0qj67_34255_c1
990 nmdc:mga0qj67_361540_c1
991 nmdc:mga0qj67_4886_c1
992 nmdc:mga06r32_1165_c1
993 nmdc:mga06r32_1198029_c1
994 nmdc:mga06r32_146915_c1
995 nmdc:mga06r32_2388_c1
996 nmdc:mga06r32_244809_c1
997 nmdc:mga06r32_48438_c1
998 nmdc:mga06r32_561299_c1
999 nmdc:mga06r32_6381_c1
1000 nmdc:mga06r32_6726_c1
1001 nmdc:mga06r32_78371_c1
1002 nmdc:mga08y16_177616_c1
1003 nmdc:mga08y16_36102_c1
1004 nmdc:mga0n895_200105_c1
1005 nmdc:mga0n895_327293_c1
1006 nmdc:mga0n895_356378_c1
1007 nmdc:mga0n895_442774_c1
1008 nmdc:mga0n895_506005_c1
1009 nmdc:mga0n895_632099_c1
1010 nmdc:mga0n895_66315_c1
1011 nmdc:mga0n895_760630_c1
1012 nmdc:mga0n895_838425_c1
1013 nmdc:mga0rr50_14947_c1
1014 nmdc:mga0rr50_80862_c1
1015 nmdc:mga08x19_123532_c1
1016 nmdc:mga0a205_259977_c1
1017 nmdc:mga0a205_421957_c1
1018 nmdc:mga0a205_440225_c1
1019 nmdc:mga0a205_520533_c1
1020 nmdc:mga0a205_92268_c1
1021 Ga0501084_0002045
1022 Ga0501084_0014269
1023 Ga0501084_0136029
1024 Ga0501084_0243107
1025 Ga0501084_0249682
1026 Ga0501084_0414709
1027 Ga0501084_0589586
1028 Ga0590071_012672
1029 Ga0590074_020823
1030 Ga0590075_030012
1031 Ga0501082_0034484
1032 Ga0501082_0190771
1033 Ga0501082_0538461
1034 Ga0530510_0001055
1035 Ga0530510_0018697
1036 Ga0530510_0024404
1037 Ga0530510_0056287
1038 Ga0530510_0522078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

45

189

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.8386 77 156
7p8n-assembly1.cif.gz_b tmhydabc- t. maritima hydrogenase with bridge closed 0.8384 80 156
7p8n-assembly1.cif.gz_B tmhydabc- t. maritima hydrogenase with bridge closed 0.8335 80 156
7p5h-assembly1.cif.gz_b tmhydabc- d2 map 0.8245 77 156
1m2d-assembly1.cif.gz_B crystal structure at 1.05 angstroms resolution of the cys59ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.8086 80 156
ID Description Score Start End Superfamily
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9853 78 158 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.978 76 157 3.40.30.10
af_B4FPX5_191_300_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9732 78 159 3.40.30.10
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9645 77 159 3.40.30.10
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9619 78 159 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A328EPZ5-F1-model_v4 Putative [Fe] hydrogenase, HymA subunit 0.8223 29 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A847XYD7-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE (EC 1.6.5.11) 0.8156 27 159 GO:0016491
GO:0046872
GO:0051537
AF-A0A1G3QN43-F1-model_v4 NADH dehydrogenase 0.796 26 158 GO:0016491
GO:0046872
GO:0051537
AF-A0A653A7F6-F1-model_v4 Respiratory-chain NADH dehydrogenase 24 Kd subunit 0.7877 10 158 GO:0016491
GO:0046872
GO:0051537
AF-A0A661PR46-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE 0.7872 10 158 GO:0016491
GO:0046872
GO:0051537

Map